F369509

General Info

Members Datasets Scaffolds Average Seq Length
260 159 260 133

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10210422|Ga0105247_102104222
Length 153
Sequence LRAREKLLLSCRGALFVSDAIKRVLFVCVENSNRSQMAEAFARMLGGTQVEAYSAGSNPSGDINPKAIAAMRELGYDLSAHGSKSLDDLPDMSFDLVATMGCGDKCLFIKARKRTDWALPDPKHMSEEEYRGVRDEIRERVRIMLEELGVTTL

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
122 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
123 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
124 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
125 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
126 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
127 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
128 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
138 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
139 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
145 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
146 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
147 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
148 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
149 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
152 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
153 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
154 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
155 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
159 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.15
Nodule 0
Rhizoplane 1.15
Rhizosphere 95.38
Stem 0
Stem Tuber 0
Unclassified 2.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_2585836 2162886006 Bacteria 823
2 Ga0065714_10008835 3300005288 Bacteria 3635
3 Ga0065715_10126480 3300005293 Unclassified 2108
4 Ga0065707_10082691 3300005295 Bacteria 12694
5 Ga0065707_10212635 3300005295 Bacteria 1249
6 Ga0070658_10088189 3300005327 Bacteria 2555
7 Ga0070658_10914302 3300005327 Bacteria 763
8 Ga0070658_11689762 3300005327 Bacteria 548
9 Ga0070676_11006142 3300005328 Bacteria 626
10 Ga0070683_100805651 3300005329 Bacteria 900
11 Ga0070690_100031369 3300005330 Bacteria 3310
12 Ga0070670_100125200 3300005331 Bacteria 2218
13 Ga0070670_100163889 3300005331 Unclassified 1927
14 Ga0070677_10092038 3300005333 Unclassified 1321
15 Ga0068869_100029524 3300005334 Bacteria 3843
16 Ga0068869_100209955 3300005334 Unclassified 1539
17 Ga0070666_10000128 3300005335 Bacteria 53252
18 Ga0070666_10023521 3300005335 Bacteria 4011
19 Ga0070666_10259758 3300005335 Bacteria 1231
20 Ga0068868_100025008 3300005338 Bacteria 4536
21 Ga0070660_100782119 3300005339 Bacteria 802
22 Ga0070689_100435320 3300005340 Bacteria 1114
23 Ga0070689_101056533 3300005340 Bacteria 724
24 Ga0070668_100082097 3300005347 Bacteria 2528
25 Ga0070669_100636283 3300005353 Bacteria 896
26 Ga0070669_101095808 3300005353 Bacteria 686
27 Ga0070675_100531945 3300005354 Bacteria 1061
28 Ga0070671_100007334 3300005355 Bacteria 8806
29 Ga0070671_100094557 3300005355 Bacteria 2505
30 Ga0070674_100061018 3300005356 Bacteria 2630
31 Ga0070673_100026234 3300005364 Bacteria 4301
32 Ga0070673_100041861 3300005364 Bacteria 3527
33 Ga0070688_100141391 3300005365 Unclassified 1635
34 Ga0070659_100002987 3300005366 Bacteria 12044
35 Ga0070659_100104478 3300005366 Unclassified 2282
36 Ga0070667_100011690 3300005367 Bacteria 7256
37 Ga0070667_100021120 3300005367 Bacteria 5408
38 Ga0070667_101495432 3300005367 Bacteria 634
39 Ga0070700_100111175 3300005441 Unclassified 1822
40 Ga0068867_100379606 3300005459 Bacteria 1187
41 Ga0070685_10034339 3300005466 Bacteria 2856
42 Ga0070706_100002218 3300005467 Bacteria 19735
43 Ga0070698_100000282 3300005471 Bacteria 51827
44 Ga0070698_100100309 3300005471 Bacteria 2868
45 Ga0070699_100066375 3300005518 Bacteria 3132
46 Ga0070697_100001766 3300005536 Bacteria 16508
47 Ga0070697_101008407 3300005536 Unclassified 740
48 Ga0068853_100075221 3300005539 Bacteria 2947
49 Ga0068853_100327026 3300005539 Bacteria 1422
50 Ga0068853_100430065 3300005539 Bacteria 1239
51 Ga0068853_100488220 3300005539 Unclassified 1162
52 Ga0068853_100846414 3300005539 Bacteria 877
53 Ga0070672_100277597 3300005543 Bacteria 1416
54 Ga0070672_100925554 3300005543 Bacteria 771
55 Ga0070695_100615518 3300005545 Bacteria 854
56 Ga0070665_100005850 3300005548 Bacteria 12614
57 Ga0070704_100095572 3300005549 Bacteria 2226
58 Ga0068855_101412105 3300005563 Bacteria 717
59 Ga0070664_100167407 3300005564 Bacteria 1948
60 Ga0070664_101179177 3300005564 Bacteria 722
61 Ga0068852_100003313 3300005616 Bacteria 11246
62 Ga0068852_100265884 3300005616 Bacteria 1649
63 Ga0068852_100485025 3300005616 Bacteria 1229
64 Ga0068859_100000018 3300005617 Bacteria 248813
65 Ga0068859_100000408 3300005617 Bacteria 42690
66 Ga0068859_100002592 3300005617 Bacteria 18396
67 Ga0068859_100003579 3300005617 Bacteria 15826
68 Ga0068859_101587322 3300005617 Bacteria 722
69 Ga0068864_100038833 3300005618 Bacteria 4067
70 Ga0068864_100088963 3300005618 Bacteria 2720
71 Ga0068861_100955285 3300005719 Bacteria 815
72 Ga0068861_101812573 3300005719 Bacteria 605
73 Ga0068851_10024249 3300005834 Unclassified 2970
74 Ga0068851_10058622 3300005834 Bacteria 1968
75 Ga0068870_10042670 3300005840 Unclassified 2362
76 Ga0068863_100008502 3300005841 Bacteria 10024
77 Ga0068863_100013341 3300005841 Bacteria 7923
78 Ga0068863_100022967 3300005841 Bacteria 5961
79 Ga0068858_100019306 3300005842 Bacteria 6373
80 Ga0068858_100695742 3300005842 Bacteria 989
81 Ga0068860_100003974 3300005843 Bacteria 15174
82 Ga0068860_100004018 3300005843 Bacteria 15106
83 Ga0068862_100001079 3300005844 Bacteria 26085
84 Ga0068862_100846779 3300005844 Bacteria 896
85 Ga0070716_100080018 3300006173 Bacteria 1947
86 Ga0097621_100020731 3300006237 Bacteria 5070
87 Ga0097621_100036870 3300006237 Bacteria 3914
88 Ga0097621_100090189 3300006237 Bacteria 2564
89 Ga0097621_101105013 3300006237 Bacteria 744
90 Ga0068871_100067479 3300006358 Bacteria 2934
91 Ga0068871_100306578 3300006358 Bacteria 1395
92 Ga0068871_101344969 3300006358 Unclassified 672
93 Ga0075434_100243513 3300006871 Bacteria 1818
94 Ga0068865_100135611 3300006881 Bacteria 1849
95 Ga0068865_101199003 3300006881 Bacteria 672
96 Ga0097620_100000018 3300006931 Bacteria 248813
97 Ga0097620_100000408 3300006931 Bacteria 42690
98 Ga0097620_100002592 3300006931 Bacteria 18396
99 Ga0097620_100003579 3300006931 Bacteria 15826
100 Ga0097620_101587410 3300006931 Bacteria 722
101 Ga0105250_10000005 3300009092 Bacteria 422580
102 Ga0105240_10058436 3300009093 Bacteria 4815
103 Ga0111539_11260416 3300009094 Bacteria 858
104 Ga0105245_10369628 3300009098 Bacteria 1425
105 Ga0105247_10006710 3300009101 Bacteria 7106
106 Ga0105247_10210422 3300009101 Bacteria 1311
107 Ga0105241_10000510 3300009174 Bacteria 29254
108 Ga0105242_10032332 3300009176 Unclassified 4183
109 Ga0105242_10461620 3300009176 Bacteria 1199
110 Ga0105242_10894068 3300009176 Bacteria 887
111 Ga0105248_10034267 3300009177 Bacteria 5676
112 Ga0105248_11286370 3300009177 Bacteria 827
113 Ga0105237_10001030 3300009545 Bacteria 37560
114 Ga0105249_10005809 3300009553 Bacteria 10672
115 Ga0105239_10105500 3300010375 Bacteria 3121
116 Ga0105246_10095375 3300011119 Bacteria 2154
117 Ga0105246_10248622 3300011119 Unclassified 1410
118 Ga0105246_11378566 3300011119 Bacteria 657
119 Ga0157373_10141952 3300013100 Bacteria 1689
120 Ga0157371_10022195 3300013102 Bacteria 4654
121 Ga0157371_10085808 3300013102 Bacteria 2230
122 Ga0157371_11405342 3300013102 Bacteria 542
123 Ga0157369_10501853 3300013105 Unclassified 1255
124 Ga0157374_11397416 3300013296 Bacteria 723
125 Ga0157378_10022348 3300013297 Bacteria 5567
126 Ga0157378_10174443 3300013297 Bacteria 2018
127 Ga0157378_10924843 3300013297 Bacteria 904
128 Ga0157378_13238612 3300013297 Unclassified 506
129 Ga0163162_10000599 3300013306 Bacteria 33336
130 Ga0163162_10072271 3300013306 Bacteria 3505
131 Ga0163162_10836519 3300013306 Bacteria 1036
132 Ga0163162_11622332 3300013306 Unclassified 738
133 Ga0163162_12928649 3300013306 Bacteria 549
134 Ga0157372_10025914 3300013307 Bacteria 6377
135 Ga0157372_10074428 3300013307 Bacteria 3830
136 Ga0157372_10466086 3300013307 Bacteria 1472
137 Ga0157372_11252398 3300013307 Unclassified 857
138 Ga0157375_10071695 3300013308 Bacteria 3479
139 Ga0157375_10536118 3300013308 Bacteria 1333
140 Ga0157375_11563735 3300013308 Bacteria 779
141 Ga0157375_12877052 3300013308 Bacteria 575
142 Ga0163163_10173711 3300014325 Bacteria 2201
143 Ga0157380_10047291 3300014326 Bacteria 3383
144 Ga0157380_10063352 3300014326 Bacteria 2964
145 Ga0157380_10121693 3300014326 Bacteria 2212
146 Ga0157380_10317825 3300014326 Bacteria 1442
147 Ga0157380_10952196 3300014326 Bacteria 889
148 Ga0157379_10001712 3300014968 Bacteria 18152
149 Ga0157379_10026426 3300014968 Bacteria 5167
150 Ga0157379_10533238 3300014968 Bacteria 1091
151 Ga0157376_10024514 3300014969 Bacteria 4738
152 Ga0157376_10078796 3300014969 Bacteria 2822
153 Ga0157376_10681579 3300014969 Bacteria 1031
154 Ga0163161_10037684 3300017792 Bacteria 3467
155 Ga0207656_10015768 3300025321 Bacteria 2931
156 Ga0207656_10026442 3300025321 Bacteria 2366
157 Ga0207696_1000346 3300025711 Bacteria 47982
158 Ga0207710_10024666 3300025900 Bacteria 2591
159 Ga0207680_10000193 3300025903 Bacteria 29312
160 Ga0207680_10063815 3300025903 Bacteria 2256
161 Ga0207647_10000210 3300025904 Bacteria 47384
162 Ga0207645_10332113 3300025907 Bacteria 1015
163 Ga0207643_10011240 3300025908 Unclassified 4835
164 Ga0207705_10650571 3300025909 Bacteria 820
165 Ga0207684_10000810 3300025910 Bacteria 36160
166 Ga0207695_10348756 3300025913 Bacteria 1368
167 Ga0207671_10001806 3300025914 Bacteria 23915
168 Ga0207657_10161327 3300025919 Unclassified 1821
169 Ga0207650_10030946 3300025925 Bacteria 3861
170 Ga0207650_10335503 3300025925 Bacteria 1241
171 Ga0207650_10499834 3300025925 Bacteria 1016
172 Ga0207650_11093772 3300025925 Bacteria 678
173 Ga0207659_10054389 3300025926 Bacteria 2859
174 Ga0207687_11052787 3300025927 Unclassified 698
175 Ga0207644_10099002 3300025931 Bacteria 2187
176 Ga0207644_10134318 3300025931 Bacteria 1898
177 Ga0207690_10510338 3300025932 Unclassified 973
178 Ga0207686_10481100 3300025934 Bacteria 960
179 Ga0207686_10875990 3300025934 Bacteria 723
180 Ga0207704_10119432 3300025938 Bacteria 1800
181 Ga0207704_10182892 3300025938 Unclassified 1516
182 Ga0207704_11785066 3300025938 Bacteria 529
183 Ga0207665_10132551 3300025939 Bacteria 1771
184 Ga0207691_10141976 3300025940 Bacteria 2116
185 Ga0207711_10001721 3300025941 Bacteria 20121
186 Ga0207689_10000602 3300025942 Bacteria 34433
187 Ga0207689_10110937 3300025942 Unclassified 2254
188 Ga0207661_10347352 3300025944 Bacteria 1338
189 Ga0207651_10033823 3300025960 Bacteria 3302
190 Ga0207712_10011576 3300025961 Bacteria 5623
191 Ga0207640_10886860 3300025981 Bacteria 778
192 Ga0207658_10017395 3300025986 Bacteria 4952
193 Ga0207658_10056397 3300025986 Bacteria 2915
194 Ga0207703_10013242 3300026035 Bacteria 6423
195 Ga0207703_11059794 3300026035 Bacteria 778
196 Ga0207639_10544771 3300026041 Bacteria 1065
197 Ga0207639_11420612 3300026041 Bacteria 651
198 Ga0207708_10824312 3300026075 Bacteria 800
199 Ga0207641_10000015 3300026088 Bacteria 321332
200 Ga0207641_10021211 3300026088 Bacteria 5340
201 Ga0207641_10263910 3300026088 Bacteria 1613
202 Ga0207648_10071807 3300026089 Unclassified 3017
203 Ga0207676_10011487 3300026095 Bacteria 6332
204 Ga0207676_10937454 3300026095 Bacteria 851
205 Ga0207683_10172587 3300026121 Bacteria 1959
206 Ga0207683_10220320 3300026121 Bacteria 1729
207 Ga0207683_10628201 3300026121 Unclassified 995
208 Ga0207683_11230780 3300026121 Bacteria 694
209 Ga0207698_10007897 3300026142 Bacteria 6701
210 Ga0209969_1041014 3300027360 Bacteria 718
211 Ga0209984_1018632 3300027424 Bacteria 939
212 Ga0268266_10002609 3300028379 Bacteria 19094
213 Ga0268265_10001053 3300028380 Bacteria 24777
214 Ga0268265_11497549 3300028380 Bacteria 678
215 Ga0268264_10000844 3300028381 Bacteria 32786
216 Ga0268264_10002838 3300028381 Bacteria 15116
217 Ga0307515_10000001 3300028794 Bacteria 4259510
218 Ga0265324_10043423 3300029957 Bacteria 1551
219 Ga0265327_10000452 3300031251 Bacteria 73846
220 Ga0265327_10019754 3300031251 Bacteria 4130
221 Ga0265316_10051565 3300031344 Bacteria 3232
222 Ga0307513_10338198 3300031456 Bacteria 1257
223 Ga0307509_10288234 3300031507 Bacteria 1398
224 Ga0307508_10000926 3300031616 Bacteria 34077
225 Ga0265314_10071867 3300031711 Bacteria 2313
226 Ga0307413_10926452 3300031824 Bacteria 742
227 Ga0307410_10134968 3300031852 Bacteria 1818
228 Ga0307410_10580464 3300031852 Bacteria 933
229 Ga0307414_12251590 3300032004 Unclassified 509
230 Ga0307411_10335412 3300032005 Unclassified 1227
231 Ga0307415_100429950 3300032126 Unclassified 1136
232 Ga0307415_101432347 3300032126 Bacteria 659
233 Ga0395900_0036264 3300037418 Bacteria 5083
234 Ga0395905_0003668 3300037471 Bacteria 16282
235 Ga0436365_1266867 3300039437 Bacteria 1349
236 Ga0451793_0450912 3300041452 Unclassified 580
237 Ga0451802_0839530 3300041460 Bacteria 508
238 Ga0450923_005495 3300042125 Unclassified 2050
239 Ga0451577_0002492 3300042876 Bacteria 21860
240 Ga0453684_0188771 3300044712 Bacteria 2412
241 Ga0453684_2383060 3300044712 Bacteria 525
242 Ga0451576_0715212 3300045051 Bacteria 1052
243 Ga0495638_0141462 3300046460 Bacteria 1404
244 Ga0495650_0231827 3300046471 Bacteria 633
245 Ga0495594_0575617 3300046499 Bacteria 639
246 Ga0495621_0018607 3300046539 Bacteria 2258
247 Ga0495635_0200179 3300046663 Bacteria 1355
248 Ga0495670_0615743 3300046691 Bacteria 592
249 Ga0495672_0012233 3300047320 Bacteria 6001
250 Ga0496108_0710675 3300048911 Bacteria 871
251 Ga0496125_0666975 3300048928 Unclassified 557
252 Ga0501290_008537 3300049513 Bacteria 1297
253 Ga0501300_022008 3300049523 Unclassified 932
254 Ga0501251_089677 3300049681 Unclassified 550
255 nmdc:mga0k408_578744_c1 3300050493 Bacteria 663
256 nmdc:mga08y16_583702_c1 3300050511 Bacteria 1128
257 nmdc:mga08y16_713742_c1 3300050511 Bacteria 1001
258 nmdc:mga0n895_258805_c1 3300050512 Bacteria 1766
259 Ga0500616_0043301 3300053153 Bacteria 2406
260 Ga0500611_000003 3300053727 Bacteria 333431

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041452 Ga0451793_0450912 Ga0451793_0450912_243_563 105
2 3300005333 Ga0070677_10092038 Ga0070677_100920382 112
3 3300005539 Ga0068853_100846414 Ga0068853_1008464142 112
4 3300005719 Ga0068861_101812573 Ga0068861_1018125731 112
5 3300006237 Ga0097621_100090189 Ga0097621_1000901893 112
6 3300006358 Ga0068871_101344969 Ga0068871_1013449691 112
7 3300025913 Ga0207695_10348756 Ga0207695_103487563 112
8 3300046663 Ga0495635_0200179 Ga0495635_0200179_13_354 112
9 3300031852 Ga0307410_10134968 Ga0307410_101349682 113
10 3300032004 Ga0307414_12251590 Ga0307414_122515901 113
11 3300032005 Ga0307411_10335412 Ga0307411_103354122 113
12 3300044712 Ga0453684_2383060 Ga0453684_2383060_34_378 113
13 3300032126 Ga0307415_100429950 Ga0307415_1004299502 115
14 3300005564 Ga0070664_101179177 Ga0070664_1011791772 116
15 3300026121 Ga0207683_11230780 Ga0207683_112307802 116
16 3300032126 Ga0307415_101432347 Ga0307415_1014323471 117
17 3300005340 Ga0070689_100435320 Ga0070689_1004353202 119
18 3300005616 Ga0068852_100265884 Ga0068852_1002658843 119
19 3300006881 Ga0068865_101199003 Ga0068865_1011990031 119
20 3300031711 Ga0265314_10071867 Ga0265314_100718673 128
21 3300049681 Ga0501251_089677 Ga0501251_089677_100_489 128
22 3300005293 Ga0065715_10126480 Ga0065715_101264803 129
23 3300005295 Ga0065707_10212635 Ga0065707_102126352 129
24 3300005328 Ga0070676_11006142 Ga0070676_110061422 129
25 3300005331 Ga0070670_100125200 Ga0070670_1001252003 129
26 3300005334 Ga0068869_100209955 Ga0068869_1002099552 129
27 3300005353 Ga0070669_101095808 Ga0070669_1010958081 129
28 3300005354 Ga0070675_100531945 Ga0070675_1005319452 129
29 3300005441 Ga0070700_100111175 Ga0070700_1001111752 129
30 3300005459 Ga0068867_100379606 Ga0068867_1003796062 129
31 3300005471 Ga0070698_100000282 Ga0070698_10000028235 129
32 3300005471 Ga0070698_100100309 Ga0070698_1001003092 129
33 3300005518 Ga0070699_100066375 Ga0070699_1000663752 129
34 3300005536 Ga0070697_101008407 Ga0070697_1010084072 129
35 3300005539 Ga0068853_100488220 Ga0068853_1004882202 129
36 3300005543 Ga0070672_100277597 Ga0070672_1002775973 129
37 3300005545 Ga0070695_100615518 Ga0070695_1006155182 129
38 3300005549 Ga0070704_100095572 Ga0070704_1000955723 129
39 3300005564 Ga0070664_100167407 Ga0070664_1001674074 129
40 3300005617 Ga0068859_101587322 Ga0068859_1015873222 129
41 3300005840 Ga0068870_10042670 Ga0068870_100426703 129
42 3300005844 Ga0068862_100846779 Ga0068862_1008467791 129
43 3300006173 Ga0070716_100080018 Ga0070716_1000800182 129
44 3300006871 Ga0075434_100243513 Ga0075434_1002435133 129
45 3300006931 Ga0097620_101587410 Ga0097620_1015874101 129
46 3300009094 Ga0111539_11260416 Ga0111539_112604162 129
47 3300009176 Ga0105242_10032332 Ga0105242_100323324 129
48 3300009177 Ga0105248_11286370 Ga0105248_112863702 129
49 3300011119 Ga0105246_11378566 Ga0105246_113785661 129
50 3300014326 Ga0157380_10047291 Ga0157380_100472913 129
51 3300014326 Ga0157380_10063352 Ga0157380_100633526 129
52 3300014326 Ga0157380_10121693 Ga0157380_101216934 129
53 3300014326 Ga0157380_10952196 Ga0157380_109521961 129
54 3300014968 Ga0157379_10533238 Ga0157379_105332382 129
55 3300014969 Ga0157376_10681579 Ga0157376_106815791 129
56 3300025907 Ga0207645_10332113 Ga0207645_103321131 129
57 3300025908 Ga0207643_10011240 Ga0207643_100112403 129
58 3300025925 Ga0207650_10335503 Ga0207650_103355032 129
59 3300025926 Ga0207659_10054389 Ga0207659_100543895 129
60 3300025938 Ga0207704_10182892 Ga0207704_101828923 129
61 3300025938 Ga0207704_11785066 Ga0207704_117850661 129
62 3300025939 Ga0207665_10132551 Ga0207665_101325513 129
63 3300025942 Ga0207689_10110937 Ga0207689_101109372 129
64 3300025981 Ga0207640_10886860 Ga0207640_108868602 129
65 3300026041 Ga0207639_10544771 Ga0207639_105447712 129
66 3300026075 Ga0207708_10824312 Ga0207708_108243121 129
67 3300026089 Ga0207648_10071807 Ga0207648_100718073 129
68 3300026121 Ga0207683_10172587 Ga0207683_101725873 129
69 3300031251 Ga0265327_10000452 Ga0265327_1000045239 129
70 3300042125 Ga0450923_005495 Ga0450923_005495_323_715 129
71 3300046460 Ga0495638_0141462 Ga0495638_0141462_138_530 129
72 3300046471 Ga0495650_0231827 Ga0495650_0231827_68_460 129
73 3300046499 Ga0495594_0575617 Ga0495594_0575617_134_526 129
74 3300046539 Ga0495621_0018607 Ga0495621_0018607_1466_1858 129
75 3300046691 Ga0495670_0615743 Ga0495670_0615743_165_557 129
76 3300049513 Ga0501290_008537 Ga0501290_008537_16_408 129
77 3300049523 Ga0501300_022008 Ga0501300_022008_272_664 129
78 3300050511 nmdc:mga08y16_583702_c1 nmdc:mga08y16_583702_c1_169_561 129
79 3300050511 nmdc:mga08y16_713742_c1 nmdc:mga08y16_713742_c1_464_856 129
80 3300050512 nmdc:mga0n895_258805_c1 nmdc:mga0n895_258805_c1_649_1041 129
81 3300053727 Ga0500611_000003 Ga0500611_000003_101004_101396 129
82 3300005330 Ga0070690_100031369 Ga0070690_1000313692 130
83 3300005353 Ga0070669_100636283 Ga0070669_1006362832 130
84 3300005719 Ga0068861_100955285 Ga0068861_1009552851 130
85 3300006237 Ga0097621_101105013 Ga0097621_1011050132 130
86 3300009093 Ga0105240_10058436 Ga0105240_100584365 130
87 3300013306 Ga0163162_11622332 Ga0163162_116223322 130
88 3300013306 Ga0163162_12928649 Ga0163162_129286491 130
89 3300014326 Ga0157380_10317825 Ga0157380_103178251 130
90 3300028794 Ga0307515_10000001 Ga0307515_100000012330 130
91 3300031251 Ga0265327_10019754 Ga0265327_100197542 130
92 3300031616 Ga0307508_10000926 Ga0307508_1000092612 130
93 3300039437 Ga0436365_1266867 Ga0436365_1266867_909_1307 130
94 3300047320 Ga0495672_0012233 Ga0495672_0012233_3665_4063 130
95 3300053153 Ga0500616_0043301 Ga0500616_0043301_578_973 130
96 3300005329 Ga0070683_100805651 Ga0070683_1008056512 131
97 3300005335 Ga0070666_10259758 Ga0070666_102597582 131
98 3300005366 Ga0070659_100104478 Ga0070659_1001044782 131
99 3300005563 Ga0068855_101412105 Ga0068855_1014121052 131
100 3300005616 Ga0068852_100485025 Ga0068852_1004850252 131
101 3300005617 Ga0068859_100000408 Ga0068859_10000040819 131
102 3300005841 Ga0068863_100013341 Ga0068863_1000133418 131
103 3300006237 Ga0097621_100020731 Ga0097621_1000207315 131
104 3300006931 Ga0097620_100000408 Ga0097620_10000040823 131
105 3300009176 Ga0105242_10461620 Ga0105242_104616202 131
106 3300009176 Ga0105242_10894068 Ga0105242_108940682 131
107 3300013100 Ga0157373_10141952 Ga0157373_101419522 131
108 3300013102 Ga0157371_10022195 Ga0157371_100221952 131
109 3300013102 Ga0157371_10085808 Ga0157371_100858083 131
110 3300013102 Ga0157371_11405342 Ga0157371_114053422 131
111 3300013297 Ga0157378_10022348 Ga0157378_100223484 131
112 3300013306 Ga0163162_10836519 Ga0163162_108365192 131
113 3300013307 Ga0157372_10025914 Ga0157372_100259145 131
114 3300013307 Ga0157372_10074428 Ga0157372_100744283 131
115 3300013307 Ga0157372_10466086 Ga0157372_104660862 131
116 3300013308 Ga0157375_10536118 Ga0157375_105361182 131
117 3300014968 Ga0157379_10026426 Ga0157379_100264266 131
118 3300017792 Ga0163161_10037684 Ga0163161_100376843 131
119 3300025934 Ga0207686_10875990 Ga0207686_108759902 131
120 3300026088 Ga0207641_10021211 Ga0207641_100212113 131
121 3300026121 Ga0207683_10220320 Ga0207683_102203202 131
122 3300026121 Ga0207683_10628201 Ga0207683_106282012 131
123 3300027424 Ga0209984_1018632 Ga0209984_10186322 131
124 3300048911 Ga0496108_0710675 Ga0496108_0710675_441_839 131
125 3300005288 Ga0065714_10008835 Ga0065714_100088351 132
126 3300005356 Ga0070674_100061018 Ga0070674_1000610182 132
127 3300005366 Ga0070659_100002987 Ga0070659_1000029876 132
128 3300005367 Ga0070667_101495432 Ga0070667_1014954322 132
129 3300005539 Ga0068853_100430065 Ga0068853_1004300651 132
130 3300005616 Ga0068852_100003313 Ga0068852_10000331311 132
131 3300013105 Ga0157369_10501853 Ga0157369_105018532 132
132 3300025904 Ga0207647_10000210 Ga0207647_1000021036 132
133 3300025919 Ga0207657_10161327 Ga0207657_101613272 132
134 3300025932 Ga0207690_10510338 Ga0207690_105103381 132
135 3300026142 Ga0207698_10007897 Ga0207698_100078972 132
136 3300031456 Ga0307513_10338198 Ga0307513_103381981 132
137 3300031824 Ga0307413_10926452 Ga0307413_109264522 132
138 3300031852 Ga0307410_10580464 Ga0307410_105804642 132
139 3300037418 Ga0395900_0036264 Ga0395900_0036264_1724_2125 132
140 3300037471 Ga0395905_0003668 Ga0395905_0003668_9971_10372 132
141 3300041460 Ga0451802_0839530 Ga0451802_0839530_79_477 132
142 3300042876 Ga0451577_0002492 Ga0451577_0002492_13853_14254 132
143 3300044712 Ga0453684_0188771 Ga0453684_0188771_374_778 132
144 3300045051 Ga0451576_0715212 Ga0451576_0715212_328_732 132
145 3300005331 Ga0070670_100163889 Ga0070670_1001638892 133
146 3300005539 Ga0068853_100075221 Ga0068853_1000752212 133
147 3300013297 Ga0157378_13238612 Ga0157378_132386121 133
148 3300025925 Ga0207650_10499834 Ga0207650_104998342 133
149 3300005327 Ga0070658_11689762 Ga0070658_116897621 134
150 3300005338 Ga0068868_100025008 Ga0068868_1000250082 134
151 3300005339 Ga0070660_100782119 Ga0070660_1007821192 134
152 3300005355 Ga0070671_100007334 Ga0070671_1000073348 134
153 3300005364 Ga0070673_100026234 Ga0070673_1000262344 134
154 3300005365 Ga0070688_100141391 Ga0070688_1001413912 134
155 3300005367 Ga0070667_100011690 Ga0070667_1000116906 134
156 3300005466 Ga0070685_10034339 Ga0070685_100343394 134
157 3300005467 Ga0070706_100002218 Ga0070706_1000022186 134
158 3300005536 Ga0070697_100001766 Ga0070697_1000017666 134
159 3300005617 Ga0068859_100002592 Ga0068859_10000259214 134
160 3300005618 Ga0068864_100088963 Ga0068864_1000889632 134
161 3300005834 Ga0068851_10024249 Ga0068851_100242493 134
162 3300005841 Ga0068863_100022967 Ga0068863_1000229676 134
163 3300005842 Ga0068858_100695742 Ga0068858_1006957422 134
164 3300005843 Ga0068860_100004018 Ga0068860_10000401813 134
165 3300006931 Ga0097620_100002592 Ga0097620_10000259214 134
166 3300013296 Ga0157374_11397416 Ga0157374_113974162 134
167 3300013307 Ga0157372_11252398 Ga0157372_112523981 134
168 3300013308 Ga0157375_12877052 Ga0157375_128770521 134
169 3300025321 Ga0207656_10026442 Ga0207656_100264424 134
170 3300025910 Ga0207684_10000810 Ga0207684_1000081017 134
171 3300025925 Ga0207650_10030946 Ga0207650_100309463 134
172 3300025925 Ga0207650_11093772 Ga0207650_110937722 134
173 3300025931 Ga0207644_10099002 Ga0207644_100990024 134
174 3300025960 Ga0207651_10033823 Ga0207651_100338232 134
175 3300025986 Ga0207658_10017395 Ga0207658_100173955 134
176 3300026035 Ga0207703_11059794 Ga0207703_110597942 134
177 3300026041 Ga0207639_11420612 Ga0207639_114206122 134
178 3300026088 Ga0207641_10263910 Ga0207641_102639102 134
179 3300026095 Ga0207676_10937454 Ga0207676_109374542 134
180 3300028381 Ga0268264_10002838 Ga0268264_100028385 134
181 3300005334 Ga0068869_100029524 Ga0068869_1000295242 135
182 3300005335 Ga0070666_10000128 Ga0070666_1000012837 135
183 3300005340 Ga0070689_101056533 Ga0070689_1010565331 135
184 3300005347 Ga0070668_100082097 Ga0070668_1000820973 135
185 3300005355 Ga0070671_100094557 Ga0070671_1000945572 135
186 3300005364 Ga0070673_100041861 Ga0070673_1000418613 135
187 3300005367 Ga0070667_100021120 Ga0070667_1000211204 135
188 3300005539 Ga0068853_100327026 Ga0068853_1003270263 135
189 3300005543 Ga0070672_100925554 Ga0070672_1009255542 135
190 3300005617 Ga0068859_100000018 Ga0068859_10000001880 135
191 3300005618 Ga0068864_100038833 Ga0068864_1000388336 135
192 3300005834 Ga0068851_10058622 Ga0068851_100586224 135
193 3300005841 Ga0068863_100008502 Ga0068863_1000085027 135
194 3300005842 Ga0068858_100019306 Ga0068858_1000193066 135
195 3300005843 Ga0068860_100003974 Ga0068860_1000039743 135
196 3300006237 Ga0097621_100036870 Ga0097621_1000368704 135
197 3300006358 Ga0068871_100306578 Ga0068871_1003065782 135
198 3300006881 Ga0068865_100135611 Ga0068865_1001356113 135
199 3300006931 Ga0097620_100000018 Ga0097620_10000001880 135
200 3300009098 Ga0105245_10369628 Ga0105245_103696283 135
201 3300009101 Ga0105247_10006710 Ga0105247_100067103 135
202 3300009174 Ga0105241_10000510 Ga0105241_1000051012 135
203 3300009545 Ga0105237_10001030 Ga0105237_1000103010 135
204 3300009553 Ga0105249_10005809 Ga0105249_1000580910 135
205 3300010375 Ga0105239_10105500 Ga0105239_101055002 135
206 3300011119 Ga0105246_10095375 Ga0105246_100953753 135
207 3300011119 Ga0105246_10248622 Ga0105246_102486222 135
208 3300013297 Ga0157378_10174443 Ga0157378_101744432 135
209 3300013297 Ga0157378_10924843 Ga0157378_109248432 135
210 3300013306 Ga0163162_10000599 Ga0163162_1000059911 135
211 3300013308 Ga0157375_11563735 Ga0157375_115637351 135
212 3300014325 Ga0163163_10173711 Ga0163163_101737112 135
213 3300014969 Ga0157376_10024514 Ga0157376_100245144 135
214 3300025321 Ga0207656_10015768 Ga0207656_100157684 135
215 3300025900 Ga0207710_10024666 Ga0207710_100246663 135
216 3300025903 Ga0207680_10000193 Ga0207680_1000019327 135
217 3300025914 Ga0207671_10001806 Ga0207671_1000180622 135
218 3300025927 Ga0207687_11052787 Ga0207687_110527872 135
219 3300025931 Ga0207644_10134318 Ga0207644_101343183 135
220 3300025934 Ga0207686_10481100 Ga0207686_104811002 135
221 3300025938 Ga0207704_10119432 Ga0207704_101194322 135
222 3300025940 Ga0207691_10141976 Ga0207691_101419764 135
223 3300025942 Ga0207689_10000602 Ga0207689_1000060212 135
224 3300025944 Ga0207661_10347352 Ga0207661_103473521 135
225 3300025961 Ga0207712_10011576 Ga0207712_100115763 135
226 3300025986 Ga0207658_10056397 Ga0207658_100563972 135
227 3300026035 Ga0207703_10013242 Ga0207703_100132424 135
228 3300026088 Ga0207641_10000015 Ga0207641_1000001526 135
229 3300026095 Ga0207676_10011487 Ga0207676_100114873 135
230 3300027360 Ga0209969_1041014 Ga0209969_10410142 135
231 3300028380 Ga0268265_11497549 Ga0268265_114975491 135
232 3300028381 Ga0268264_10000844 Ga0268264_1000084420 135
233 3300031507 Ga0307509_10288234 Ga0307509_102882342 135
234 3300005327 Ga0070658_10914302 Ga0070658_109143021 136
235 3300006358 Ga0068871_100067479 Ga0068871_1000674793 136
236 3300013306 Ga0163162_10072271 Ga0163162_100722713 136
237 3300013308 Ga0157375_10071695 Ga0157375_100716954 136
238 3300014969 Ga0157376_10078796 Ga0157376_100787963 136
239 3300025909 Ga0207705_10650571 Ga0207705_106505711 136
240 3300029957 Ga0265324_10043423 Ga0265324_100434232 136
241 3300031344 Ga0265316_10051565 Ga0265316_100515655 136
242 3300050493 nmdc:mga0k408_578744_c1 nmdc:mga0k408_578744_c1_168_587 136
243 3300005327 Ga0070658_10088189 Ga0070658_100881894 137
244 3300005335 Ga0070666_10023521 Ga0070666_100235214 137
245 3300005548 Ga0070665_100005850 Ga0070665_1000058503 137
246 3300005617 Ga0068859_100003579 Ga0068859_10000357913 137
247 3300005844 Ga0068862_100001079 Ga0068862_10000107920 137
248 3300006931 Ga0097620_100003579 Ga0097620_10000357913 137
249 3300009101 Ga0105247_10210422 Ga0105247_102104222 137
250 3300009177 Ga0105248_10034267 Ga0105248_100342674 137
251 3300025903 Ga0207680_10063815 Ga0207680_100638153 137
252 3300025941 Ga0207711_10001721 Ga0207711_1000172115 137
253 3300028379 Ga0268266_10002609 Ga0268266_1000260917 137
254 3300028380 Ga0268265_10001053 Ga0268265_1000105316 137
255 2162886006 SwRhRL3b_contig_2585836 SwRhRL3b_0360.00001190 139
256 3300005295 Ga0065707_10082691 Ga0065707_100826917 139
257 3300009092 Ga0105250_10000005 Ga0105250_10000005319 139
258 3300014968 Ga0157379_10001712 Ga0157379_100017129 139
259 3300025711 Ga0207696_1000346 Ga0207696_100034622 139
260 3300048928 Ga0496125_0666975 Ga0496125_0666975_38_457 139

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01451

LMWPc

Low molecular weight phosphotyrosine protein phosphatase

24

145

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2myp-assembly1.cif.gz_A an arsenate reductase in the phosphate binding state 0.9216 6 131
1rxi-assembly1.cif.gz_A pi258 arsenate reductase (arsc) triple mutant c10s/c15a/c82s 0.8918 6 128
2cd7-assembly1.cif.gz_A staphylococcus aureus pi258 arsenate reductase (arsc) h62q mutant 0.8909 6 128
1ljl-assembly1.cif.gz_A wild type pi258 s. aureus arsenate reductase 0.8852 6 128
2myp-assembly1.cif.gz_A an arsenate reductase in the phosphate binding state 0.8817 6 131
ID Description Score Start End Superfamily
3cdiA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Polyribonucleotide nucleotidyltransferase, RNA-binding domain 0.8941 107 134 1.10.10.400
af_I6X4W4_364_495_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8934 6 132 3.40.50.2300
2myuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8759 6 131 3.40.50.2300
2mytA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8626 6 132 3.40.50.2300
af_Q4DJ17_6_259_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8584 6 90 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A6I6GZ29-F1-model_v4 deleted 0.9922 3 131
AF-A0A7C7PUP6-F1-model_v4 Arsenate reductase ArsC 0.9897 6 91 GO:0004725
GO:0046685
AF-A0A7X3Q697-F1-model_v4 deleted 0.9831 6 139
AF-A0A091B6C8-F1-model_v4 Phosphotyrosine protein phosphatase I domain-containing protein 0.9817 1 131 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A257WCG2-F1-model_v4 Low molecular weight phosphatase family protein 0.9817 6 132 GO:0046685

Feature Viewer

pLDDT pTM Quality
90.77 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map