F369509
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 260 | 159 | 260 | 133 |
Family's Representative Sequence
| Representative Sequence | 3300009101|Ga0105247_10210422|Ga0105247_102104222 |
| Length | 153 |
| Sequence | LRAREKLLLSCRGALFVSDAIKRVLFVCVENSNRSQMAEAFARMLGGTQVEAYSAGSNPSGDINPKAIAAMRELGYDLSAHGSKSLDDLPDMSFDLVATMGCGDKCLFIKARKRTDWALPDPKHMSEEEYRGVRDEIRERVRIMLEELGVTTL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 43 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 44 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 52 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 53 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 54 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 122 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 123 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 124 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 125 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 126 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 127 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 128 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 129 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 130 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 131 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 132 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 133 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 134 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 135 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 136 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 137 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 138 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 139 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 140 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 141 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 142 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 143 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 152 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 153 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 154 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 155 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 156 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 157 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 158 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 159 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.15 |
| Nodule | 0 |
| Rhizoplane | 1.15 |
| Rhizosphere | 95.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_2585836 | 2162886006 | Bacteria | 823 |
| 2 | Ga0065714_10008835 | 3300005288 | Bacteria | 3635 |
| 3 | Ga0065715_10126480 | 3300005293 | Unclassified | 2108 |
| 4 | Ga0065707_10082691 | 3300005295 | Bacteria | 12694 |
| 5 | Ga0065707_10212635 | 3300005295 | Bacteria | 1249 |
| 6 | Ga0070658_10088189 | 3300005327 | Bacteria | 2555 |
| 7 | Ga0070658_10914302 | 3300005327 | Bacteria | 763 |
| 8 | Ga0070658_11689762 | 3300005327 | Bacteria | 548 |
| 9 | Ga0070676_11006142 | 3300005328 | Bacteria | 626 |
| 10 | Ga0070683_100805651 | 3300005329 | Bacteria | 900 |
| 11 | Ga0070690_100031369 | 3300005330 | Bacteria | 3310 |
| 12 | Ga0070670_100125200 | 3300005331 | Bacteria | 2218 |
| 13 | Ga0070670_100163889 | 3300005331 | Unclassified | 1927 |
| 14 | Ga0070677_10092038 | 3300005333 | Unclassified | 1321 |
| 15 | Ga0068869_100029524 | 3300005334 | Bacteria | 3843 |
| 16 | Ga0068869_100209955 | 3300005334 | Unclassified | 1539 |
| 17 | Ga0070666_10000128 | 3300005335 | Bacteria | 53252 |
| 18 | Ga0070666_10023521 | 3300005335 | Bacteria | 4011 |
| 19 | Ga0070666_10259758 | 3300005335 | Bacteria | 1231 |
| 20 | Ga0068868_100025008 | 3300005338 | Bacteria | 4536 |
| 21 | Ga0070660_100782119 | 3300005339 | Bacteria | 802 |
| 22 | Ga0070689_100435320 | 3300005340 | Bacteria | 1114 |
| 23 | Ga0070689_101056533 | 3300005340 | Bacteria | 724 |
| 24 | Ga0070668_100082097 | 3300005347 | Bacteria | 2528 |
| 25 | Ga0070669_100636283 | 3300005353 | Bacteria | 896 |
| 26 | Ga0070669_101095808 | 3300005353 | Bacteria | 686 |
| 27 | Ga0070675_100531945 | 3300005354 | Bacteria | 1061 |
| 28 | Ga0070671_100007334 | 3300005355 | Bacteria | 8806 |
| 29 | Ga0070671_100094557 | 3300005355 | Bacteria | 2505 |
| 30 | Ga0070674_100061018 | 3300005356 | Bacteria | 2630 |
| 31 | Ga0070673_100026234 | 3300005364 | Bacteria | 4301 |
| 32 | Ga0070673_100041861 | 3300005364 | Bacteria | 3527 |
| 33 | Ga0070688_100141391 | 3300005365 | Unclassified | 1635 |
| 34 | Ga0070659_100002987 | 3300005366 | Bacteria | 12044 |
| 35 | Ga0070659_100104478 | 3300005366 | Unclassified | 2282 |
| 36 | Ga0070667_100011690 | 3300005367 | Bacteria | 7256 |
| 37 | Ga0070667_100021120 | 3300005367 | Bacteria | 5408 |
| 38 | Ga0070667_101495432 | 3300005367 | Bacteria | 634 |
| 39 | Ga0070700_100111175 | 3300005441 | Unclassified | 1822 |
| 40 | Ga0068867_100379606 | 3300005459 | Bacteria | 1187 |
| 41 | Ga0070685_10034339 | 3300005466 | Bacteria | 2856 |
| 42 | Ga0070706_100002218 | 3300005467 | Bacteria | 19735 |
| 43 | Ga0070698_100000282 | 3300005471 | Bacteria | 51827 |
| 44 | Ga0070698_100100309 | 3300005471 | Bacteria | 2868 |
| 45 | Ga0070699_100066375 | 3300005518 | Bacteria | 3132 |
| 46 | Ga0070697_100001766 | 3300005536 | Bacteria | 16508 |
| 47 | Ga0070697_101008407 | 3300005536 | Unclassified | 740 |
| 48 | Ga0068853_100075221 | 3300005539 | Bacteria | 2947 |
| 49 | Ga0068853_100327026 | 3300005539 | Bacteria | 1422 |
| 50 | Ga0068853_100430065 | 3300005539 | Bacteria | 1239 |
| 51 | Ga0068853_100488220 | 3300005539 | Unclassified | 1162 |
| 52 | Ga0068853_100846414 | 3300005539 | Bacteria | 877 |
| 53 | Ga0070672_100277597 | 3300005543 | Bacteria | 1416 |
| 54 | Ga0070672_100925554 | 3300005543 | Bacteria | 771 |
| 55 | Ga0070695_100615518 | 3300005545 | Bacteria | 854 |
| 56 | Ga0070665_100005850 | 3300005548 | Bacteria | 12614 |
| 57 | Ga0070704_100095572 | 3300005549 | Bacteria | 2226 |
| 58 | Ga0068855_101412105 | 3300005563 | Bacteria | 717 |
| 59 | Ga0070664_100167407 | 3300005564 | Bacteria | 1948 |
| 60 | Ga0070664_101179177 | 3300005564 | Bacteria | 722 |
| 61 | Ga0068852_100003313 | 3300005616 | Bacteria | 11246 |
| 62 | Ga0068852_100265884 | 3300005616 | Bacteria | 1649 |
| 63 | Ga0068852_100485025 | 3300005616 | Bacteria | 1229 |
| 64 | Ga0068859_100000018 | 3300005617 | Bacteria | 248813 |
| 65 | Ga0068859_100000408 | 3300005617 | Bacteria | 42690 |
| 66 | Ga0068859_100002592 | 3300005617 | Bacteria | 18396 |
| 67 | Ga0068859_100003579 | 3300005617 | Bacteria | 15826 |
| 68 | Ga0068859_101587322 | 3300005617 | Bacteria | 722 |
| 69 | Ga0068864_100038833 | 3300005618 | Bacteria | 4067 |
| 70 | Ga0068864_100088963 | 3300005618 | Bacteria | 2720 |
| 71 | Ga0068861_100955285 | 3300005719 | Bacteria | 815 |
| 72 | Ga0068861_101812573 | 3300005719 | Bacteria | 605 |
| 73 | Ga0068851_10024249 | 3300005834 | Unclassified | 2970 |
| 74 | Ga0068851_10058622 | 3300005834 | Bacteria | 1968 |
| 75 | Ga0068870_10042670 | 3300005840 | Unclassified | 2362 |
| 76 | Ga0068863_100008502 | 3300005841 | Bacteria | 10024 |
| 77 | Ga0068863_100013341 | 3300005841 | Bacteria | 7923 |
| 78 | Ga0068863_100022967 | 3300005841 | Bacteria | 5961 |
| 79 | Ga0068858_100019306 | 3300005842 | Bacteria | 6373 |
| 80 | Ga0068858_100695742 | 3300005842 | Bacteria | 989 |
| 81 | Ga0068860_100003974 | 3300005843 | Bacteria | 15174 |
| 82 | Ga0068860_100004018 | 3300005843 | Bacteria | 15106 |
| 83 | Ga0068862_100001079 | 3300005844 | Bacteria | 26085 |
| 84 | Ga0068862_100846779 | 3300005844 | Bacteria | 896 |
| 85 | Ga0070716_100080018 | 3300006173 | Bacteria | 1947 |
| 86 | Ga0097621_100020731 | 3300006237 | Bacteria | 5070 |
| 87 | Ga0097621_100036870 | 3300006237 | Bacteria | 3914 |
| 88 | Ga0097621_100090189 | 3300006237 | Bacteria | 2564 |
| 89 | Ga0097621_101105013 | 3300006237 | Bacteria | 744 |
| 90 | Ga0068871_100067479 | 3300006358 | Bacteria | 2934 |
| 91 | Ga0068871_100306578 | 3300006358 | Bacteria | 1395 |
| 92 | Ga0068871_101344969 | 3300006358 | Unclassified | 672 |
| 93 | Ga0075434_100243513 | 3300006871 | Bacteria | 1818 |
| 94 | Ga0068865_100135611 | 3300006881 | Bacteria | 1849 |
| 95 | Ga0068865_101199003 | 3300006881 | Bacteria | 672 |
| 96 | Ga0097620_100000018 | 3300006931 | Bacteria | 248813 |
| 97 | Ga0097620_100000408 | 3300006931 | Bacteria | 42690 |
| 98 | Ga0097620_100002592 | 3300006931 | Bacteria | 18396 |
| 99 | Ga0097620_100003579 | 3300006931 | Bacteria | 15826 |
| 100 | Ga0097620_101587410 | 3300006931 | Bacteria | 722 |
| 101 | Ga0105250_10000005 | 3300009092 | Bacteria | 422580 |
| 102 | Ga0105240_10058436 | 3300009093 | Bacteria | 4815 |
| 103 | Ga0111539_11260416 | 3300009094 | Bacteria | 858 |
| 104 | Ga0105245_10369628 | 3300009098 | Bacteria | 1425 |
| 105 | Ga0105247_10006710 | 3300009101 | Bacteria | 7106 |
| 106 | Ga0105247_10210422 | 3300009101 | Bacteria | 1311 |
| 107 | Ga0105241_10000510 | 3300009174 | Bacteria | 29254 |
| 108 | Ga0105242_10032332 | 3300009176 | Unclassified | 4183 |
| 109 | Ga0105242_10461620 | 3300009176 | Bacteria | 1199 |
| 110 | Ga0105242_10894068 | 3300009176 | Bacteria | 887 |
| 111 | Ga0105248_10034267 | 3300009177 | Bacteria | 5676 |
| 112 | Ga0105248_11286370 | 3300009177 | Bacteria | 827 |
| 113 | Ga0105237_10001030 | 3300009545 | Bacteria | 37560 |
| 114 | Ga0105249_10005809 | 3300009553 | Bacteria | 10672 |
| 115 | Ga0105239_10105500 | 3300010375 | Bacteria | 3121 |
| 116 | Ga0105246_10095375 | 3300011119 | Bacteria | 2154 |
| 117 | Ga0105246_10248622 | 3300011119 | Unclassified | 1410 |
| 118 | Ga0105246_11378566 | 3300011119 | Bacteria | 657 |
| 119 | Ga0157373_10141952 | 3300013100 | Bacteria | 1689 |
| 120 | Ga0157371_10022195 | 3300013102 | Bacteria | 4654 |
| 121 | Ga0157371_10085808 | 3300013102 | Bacteria | 2230 |
| 122 | Ga0157371_11405342 | 3300013102 | Bacteria | 542 |
| 123 | Ga0157369_10501853 | 3300013105 | Unclassified | 1255 |
| 124 | Ga0157374_11397416 | 3300013296 | Bacteria | 723 |
| 125 | Ga0157378_10022348 | 3300013297 | Bacteria | 5567 |
| 126 | Ga0157378_10174443 | 3300013297 | Bacteria | 2018 |
| 127 | Ga0157378_10924843 | 3300013297 | Bacteria | 904 |
| 128 | Ga0157378_13238612 | 3300013297 | Unclassified | 506 |
| 129 | Ga0163162_10000599 | 3300013306 | Bacteria | 33336 |
| 130 | Ga0163162_10072271 | 3300013306 | Bacteria | 3505 |
| 131 | Ga0163162_10836519 | 3300013306 | Bacteria | 1036 |
| 132 | Ga0163162_11622332 | 3300013306 | Unclassified | 738 |
| 133 | Ga0163162_12928649 | 3300013306 | Bacteria | 549 |
| 134 | Ga0157372_10025914 | 3300013307 | Bacteria | 6377 |
| 135 | Ga0157372_10074428 | 3300013307 | Bacteria | 3830 |
| 136 | Ga0157372_10466086 | 3300013307 | Bacteria | 1472 |
| 137 | Ga0157372_11252398 | 3300013307 | Unclassified | 857 |
| 138 | Ga0157375_10071695 | 3300013308 | Bacteria | 3479 |
| 139 | Ga0157375_10536118 | 3300013308 | Bacteria | 1333 |
| 140 | Ga0157375_11563735 | 3300013308 | Bacteria | 779 |
| 141 | Ga0157375_12877052 | 3300013308 | Bacteria | 575 |
| 142 | Ga0163163_10173711 | 3300014325 | Bacteria | 2201 |
| 143 | Ga0157380_10047291 | 3300014326 | Bacteria | 3383 |
| 144 | Ga0157380_10063352 | 3300014326 | Bacteria | 2964 |
| 145 | Ga0157380_10121693 | 3300014326 | Bacteria | 2212 |
| 146 | Ga0157380_10317825 | 3300014326 | Bacteria | 1442 |
| 147 | Ga0157380_10952196 | 3300014326 | Bacteria | 889 |
| 148 | Ga0157379_10001712 | 3300014968 | Bacteria | 18152 |
| 149 | Ga0157379_10026426 | 3300014968 | Bacteria | 5167 |
| 150 | Ga0157379_10533238 | 3300014968 | Bacteria | 1091 |
| 151 | Ga0157376_10024514 | 3300014969 | Bacteria | 4738 |
| 152 | Ga0157376_10078796 | 3300014969 | Bacteria | 2822 |
| 153 | Ga0157376_10681579 | 3300014969 | Bacteria | 1031 |
| 154 | Ga0163161_10037684 | 3300017792 | Bacteria | 3467 |
| 155 | Ga0207656_10015768 | 3300025321 | Bacteria | 2931 |
| 156 | Ga0207656_10026442 | 3300025321 | Bacteria | 2366 |
| 157 | Ga0207696_1000346 | 3300025711 | Bacteria | 47982 |
| 158 | Ga0207710_10024666 | 3300025900 | Bacteria | 2591 |
| 159 | Ga0207680_10000193 | 3300025903 | Bacteria | 29312 |
| 160 | Ga0207680_10063815 | 3300025903 | Bacteria | 2256 |
| 161 | Ga0207647_10000210 | 3300025904 | Bacteria | 47384 |
| 162 | Ga0207645_10332113 | 3300025907 | Bacteria | 1015 |
| 163 | Ga0207643_10011240 | 3300025908 | Unclassified | 4835 |
| 164 | Ga0207705_10650571 | 3300025909 | Bacteria | 820 |
| 165 | Ga0207684_10000810 | 3300025910 | Bacteria | 36160 |
| 166 | Ga0207695_10348756 | 3300025913 | Bacteria | 1368 |
| 167 | Ga0207671_10001806 | 3300025914 | Bacteria | 23915 |
| 168 | Ga0207657_10161327 | 3300025919 | Unclassified | 1821 |
| 169 | Ga0207650_10030946 | 3300025925 | Bacteria | 3861 |
| 170 | Ga0207650_10335503 | 3300025925 | Bacteria | 1241 |
| 171 | Ga0207650_10499834 | 3300025925 | Bacteria | 1016 |
| 172 | Ga0207650_11093772 | 3300025925 | Bacteria | 678 |
| 173 | Ga0207659_10054389 | 3300025926 | Bacteria | 2859 |
| 174 | Ga0207687_11052787 | 3300025927 | Unclassified | 698 |
| 175 | Ga0207644_10099002 | 3300025931 | Bacteria | 2187 |
| 176 | Ga0207644_10134318 | 3300025931 | Bacteria | 1898 |
| 177 | Ga0207690_10510338 | 3300025932 | Unclassified | 973 |
| 178 | Ga0207686_10481100 | 3300025934 | Bacteria | 960 |
| 179 | Ga0207686_10875990 | 3300025934 | Bacteria | 723 |
| 180 | Ga0207704_10119432 | 3300025938 | Bacteria | 1800 |
| 181 | Ga0207704_10182892 | 3300025938 | Unclassified | 1516 |
| 182 | Ga0207704_11785066 | 3300025938 | Bacteria | 529 |
| 183 | Ga0207665_10132551 | 3300025939 | Bacteria | 1771 |
| 184 | Ga0207691_10141976 | 3300025940 | Bacteria | 2116 |
| 185 | Ga0207711_10001721 | 3300025941 | Bacteria | 20121 |
| 186 | Ga0207689_10000602 | 3300025942 | Bacteria | 34433 |
| 187 | Ga0207689_10110937 | 3300025942 | Unclassified | 2254 |
| 188 | Ga0207661_10347352 | 3300025944 | Bacteria | 1338 |
| 189 | Ga0207651_10033823 | 3300025960 | Bacteria | 3302 |
| 190 | Ga0207712_10011576 | 3300025961 | Bacteria | 5623 |
| 191 | Ga0207640_10886860 | 3300025981 | Bacteria | 778 |
| 192 | Ga0207658_10017395 | 3300025986 | Bacteria | 4952 |
| 193 | Ga0207658_10056397 | 3300025986 | Bacteria | 2915 |
| 194 | Ga0207703_10013242 | 3300026035 | Bacteria | 6423 |
| 195 | Ga0207703_11059794 | 3300026035 | Bacteria | 778 |
| 196 | Ga0207639_10544771 | 3300026041 | Bacteria | 1065 |
| 197 | Ga0207639_11420612 | 3300026041 | Bacteria | 651 |
| 198 | Ga0207708_10824312 | 3300026075 | Bacteria | 800 |
| 199 | Ga0207641_10000015 | 3300026088 | Bacteria | 321332 |
| 200 | Ga0207641_10021211 | 3300026088 | Bacteria | 5340 |
| 201 | Ga0207641_10263910 | 3300026088 | Bacteria | 1613 |
| 202 | Ga0207648_10071807 | 3300026089 | Unclassified | 3017 |
| 203 | Ga0207676_10011487 | 3300026095 | Bacteria | 6332 |
| 204 | Ga0207676_10937454 | 3300026095 | Bacteria | 851 |
| 205 | Ga0207683_10172587 | 3300026121 | Bacteria | 1959 |
| 206 | Ga0207683_10220320 | 3300026121 | Bacteria | 1729 |
| 207 | Ga0207683_10628201 | 3300026121 | Unclassified | 995 |
| 208 | Ga0207683_11230780 | 3300026121 | Bacteria | 694 |
| 209 | Ga0207698_10007897 | 3300026142 | Bacteria | 6701 |
| 210 | Ga0209969_1041014 | 3300027360 | Bacteria | 718 |
| 211 | Ga0209984_1018632 | 3300027424 | Bacteria | 939 |
| 212 | Ga0268266_10002609 | 3300028379 | Bacteria | 19094 |
| 213 | Ga0268265_10001053 | 3300028380 | Bacteria | 24777 |
| 214 | Ga0268265_11497549 | 3300028380 | Bacteria | 678 |
| 215 | Ga0268264_10000844 | 3300028381 | Bacteria | 32786 |
| 216 | Ga0268264_10002838 | 3300028381 | Bacteria | 15116 |
| 217 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 218 | Ga0265324_10043423 | 3300029957 | Bacteria | 1551 |
| 219 | Ga0265327_10000452 | 3300031251 | Bacteria | 73846 |
| 220 | Ga0265327_10019754 | 3300031251 | Bacteria | 4130 |
| 221 | Ga0265316_10051565 | 3300031344 | Bacteria | 3232 |
| 222 | Ga0307513_10338198 | 3300031456 | Bacteria | 1257 |
| 223 | Ga0307509_10288234 | 3300031507 | Bacteria | 1398 |
| 224 | Ga0307508_10000926 | 3300031616 | Bacteria | 34077 |
| 225 | Ga0265314_10071867 | 3300031711 | Bacteria | 2313 |
| 226 | Ga0307413_10926452 | 3300031824 | Bacteria | 742 |
| 227 | Ga0307410_10134968 | 3300031852 | Bacteria | 1818 |
| 228 | Ga0307410_10580464 | 3300031852 | Bacteria | 933 |
| 229 | Ga0307414_12251590 | 3300032004 | Unclassified | 509 |
| 230 | Ga0307411_10335412 | 3300032005 | Unclassified | 1227 |
| 231 | Ga0307415_100429950 | 3300032126 | Unclassified | 1136 |
| 232 | Ga0307415_101432347 | 3300032126 | Bacteria | 659 |
| 233 | Ga0395900_0036264 | 3300037418 | Bacteria | 5083 |
| 234 | Ga0395905_0003668 | 3300037471 | Bacteria | 16282 |
| 235 | Ga0436365_1266867 | 3300039437 | Bacteria | 1349 |
| 236 | Ga0451793_0450912 | 3300041452 | Unclassified | 580 |
| 237 | Ga0451802_0839530 | 3300041460 | Bacteria | 508 |
| 238 | Ga0450923_005495 | 3300042125 | Unclassified | 2050 |
| 239 | Ga0451577_0002492 | 3300042876 | Bacteria | 21860 |
| 240 | Ga0453684_0188771 | 3300044712 | Bacteria | 2412 |
| 241 | Ga0453684_2383060 | 3300044712 | Bacteria | 525 |
| 242 | Ga0451576_0715212 | 3300045051 | Bacteria | 1052 |
| 243 | Ga0495638_0141462 | 3300046460 | Bacteria | 1404 |
| 244 | Ga0495650_0231827 | 3300046471 | Bacteria | 633 |
| 245 | Ga0495594_0575617 | 3300046499 | Bacteria | 639 |
| 246 | Ga0495621_0018607 | 3300046539 | Bacteria | 2258 |
| 247 | Ga0495635_0200179 | 3300046663 | Bacteria | 1355 |
| 248 | Ga0495670_0615743 | 3300046691 | Bacteria | 592 |
| 249 | Ga0495672_0012233 | 3300047320 | Bacteria | 6001 |
| 250 | Ga0496108_0710675 | 3300048911 | Bacteria | 871 |
| 251 | Ga0496125_0666975 | 3300048928 | Unclassified | 557 |
| 252 | Ga0501290_008537 | 3300049513 | Bacteria | 1297 |
| 253 | Ga0501300_022008 | 3300049523 | Unclassified | 932 |
| 254 | Ga0501251_089677 | 3300049681 | Unclassified | 550 |
| 255 | nmdc:mga0k408_578744_c1 | 3300050493 | Bacteria | 663 |
| 256 | nmdc:mga08y16_583702_c1 | 3300050511 | Bacteria | 1128 |
| 257 | nmdc:mga08y16_713742_c1 | 3300050511 | Bacteria | 1001 |
| 258 | nmdc:mga0n895_258805_c1 | 3300050512 | Bacteria | 1766 |
| 259 | Ga0500616_0043301 | 3300053153 | Bacteria | 2406 |
| 260 | Ga0500611_000003 | 3300053727 | Bacteria | 333431 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041452 | Ga0451793_0450912 | Ga0451793_0450912_243_563 | 105 |
| 2 | 3300005333 | Ga0070677_10092038 | Ga0070677_100920382 | 112 |
| 3 | 3300005539 | Ga0068853_100846414 | Ga0068853_1008464142 | 112 |
| 4 | 3300005719 | Ga0068861_101812573 | Ga0068861_1018125731 | 112 |
| 5 | 3300006237 | Ga0097621_100090189 | Ga0097621_1000901893 | 112 |
| 6 | 3300006358 | Ga0068871_101344969 | Ga0068871_1013449691 | 112 |
| 7 | 3300025913 | Ga0207695_10348756 | Ga0207695_103487563 | 112 |
| 8 | 3300046663 | Ga0495635_0200179 | Ga0495635_0200179_13_354 | 112 |
| 9 | 3300031852 | Ga0307410_10134968 | Ga0307410_101349682 | 113 |
| 10 | 3300032004 | Ga0307414_12251590 | Ga0307414_122515901 | 113 |
| 11 | 3300032005 | Ga0307411_10335412 | Ga0307411_103354122 | 113 |
| 12 | 3300044712 | Ga0453684_2383060 | Ga0453684_2383060_34_378 | 113 |
| 13 | 3300032126 | Ga0307415_100429950 | Ga0307415_1004299502 | 115 |
| 14 | 3300005564 | Ga0070664_101179177 | Ga0070664_1011791772 | 116 |
| 15 | 3300026121 | Ga0207683_11230780 | Ga0207683_112307802 | 116 |
| 16 | 3300032126 | Ga0307415_101432347 | Ga0307415_1014323471 | 117 |
| 17 | 3300005340 | Ga0070689_100435320 | Ga0070689_1004353202 | 119 |
| 18 | 3300005616 | Ga0068852_100265884 | Ga0068852_1002658843 | 119 |
| 19 | 3300006881 | Ga0068865_101199003 | Ga0068865_1011990031 | 119 |
| 20 | 3300031711 | Ga0265314_10071867 | Ga0265314_100718673 | 128 |
| 21 | 3300049681 | Ga0501251_089677 | Ga0501251_089677_100_489 | 128 |
| 22 | 3300005293 | Ga0065715_10126480 | Ga0065715_101264803 | 129 |
| 23 | 3300005295 | Ga0065707_10212635 | Ga0065707_102126352 | 129 |
| 24 | 3300005328 | Ga0070676_11006142 | Ga0070676_110061422 | 129 |
| 25 | 3300005331 | Ga0070670_100125200 | Ga0070670_1001252003 | 129 |
| 26 | 3300005334 | Ga0068869_100209955 | Ga0068869_1002099552 | 129 |
| 27 | 3300005353 | Ga0070669_101095808 | Ga0070669_1010958081 | 129 |
| 28 | 3300005354 | Ga0070675_100531945 | Ga0070675_1005319452 | 129 |
| 29 | 3300005441 | Ga0070700_100111175 | Ga0070700_1001111752 | 129 |
| 30 | 3300005459 | Ga0068867_100379606 | Ga0068867_1003796062 | 129 |
| 31 | 3300005471 | Ga0070698_100000282 | Ga0070698_10000028235 | 129 |
| 32 | 3300005471 | Ga0070698_100100309 | Ga0070698_1001003092 | 129 |
| 33 | 3300005518 | Ga0070699_100066375 | Ga0070699_1000663752 | 129 |
| 34 | 3300005536 | Ga0070697_101008407 | Ga0070697_1010084072 | 129 |
| 35 | 3300005539 | Ga0068853_100488220 | Ga0068853_1004882202 | 129 |
| 36 | 3300005543 | Ga0070672_100277597 | Ga0070672_1002775973 | 129 |
| 37 | 3300005545 | Ga0070695_100615518 | Ga0070695_1006155182 | 129 |
| 38 | 3300005549 | Ga0070704_100095572 | Ga0070704_1000955723 | 129 |
| 39 | 3300005564 | Ga0070664_100167407 | Ga0070664_1001674074 | 129 |
| 40 | 3300005617 | Ga0068859_101587322 | Ga0068859_1015873222 | 129 |
| 41 | 3300005840 | Ga0068870_10042670 | Ga0068870_100426703 | 129 |
| 42 | 3300005844 | Ga0068862_100846779 | Ga0068862_1008467791 | 129 |
| 43 | 3300006173 | Ga0070716_100080018 | Ga0070716_1000800182 | 129 |
| 44 | 3300006871 | Ga0075434_100243513 | Ga0075434_1002435133 | 129 |
| 45 | 3300006931 | Ga0097620_101587410 | Ga0097620_1015874101 | 129 |
| 46 | 3300009094 | Ga0111539_11260416 | Ga0111539_112604162 | 129 |
| 47 | 3300009176 | Ga0105242_10032332 | Ga0105242_100323324 | 129 |
| 48 | 3300009177 | Ga0105248_11286370 | Ga0105248_112863702 | 129 |
| 49 | 3300011119 | Ga0105246_11378566 | Ga0105246_113785661 | 129 |
| 50 | 3300014326 | Ga0157380_10047291 | Ga0157380_100472913 | 129 |
| 51 | 3300014326 | Ga0157380_10063352 | Ga0157380_100633526 | 129 |
| 52 | 3300014326 | Ga0157380_10121693 | Ga0157380_101216934 | 129 |
| 53 | 3300014326 | Ga0157380_10952196 | Ga0157380_109521961 | 129 |
| 54 | 3300014968 | Ga0157379_10533238 | Ga0157379_105332382 | 129 |
| 55 | 3300014969 | Ga0157376_10681579 | Ga0157376_106815791 | 129 |
| 56 | 3300025907 | Ga0207645_10332113 | Ga0207645_103321131 | 129 |
| 57 | 3300025908 | Ga0207643_10011240 | Ga0207643_100112403 | 129 |
| 58 | 3300025925 | Ga0207650_10335503 | Ga0207650_103355032 | 129 |
| 59 | 3300025926 | Ga0207659_10054389 | Ga0207659_100543895 | 129 |
| 60 | 3300025938 | Ga0207704_10182892 | Ga0207704_101828923 | 129 |
| 61 | 3300025938 | Ga0207704_11785066 | Ga0207704_117850661 | 129 |
| 62 | 3300025939 | Ga0207665_10132551 | Ga0207665_101325513 | 129 |
| 63 | 3300025942 | Ga0207689_10110937 | Ga0207689_101109372 | 129 |
| 64 | 3300025981 | Ga0207640_10886860 | Ga0207640_108868602 | 129 |
| 65 | 3300026041 | Ga0207639_10544771 | Ga0207639_105447712 | 129 |
| 66 | 3300026075 | Ga0207708_10824312 | Ga0207708_108243121 | 129 |
| 67 | 3300026089 | Ga0207648_10071807 | Ga0207648_100718073 | 129 |
| 68 | 3300026121 | Ga0207683_10172587 | Ga0207683_101725873 | 129 |
| 69 | 3300031251 | Ga0265327_10000452 | Ga0265327_1000045239 | 129 |
| 70 | 3300042125 | Ga0450923_005495 | Ga0450923_005495_323_715 | 129 |
| 71 | 3300046460 | Ga0495638_0141462 | Ga0495638_0141462_138_530 | 129 |
| 72 | 3300046471 | Ga0495650_0231827 | Ga0495650_0231827_68_460 | 129 |
| 73 | 3300046499 | Ga0495594_0575617 | Ga0495594_0575617_134_526 | 129 |
| 74 | 3300046539 | Ga0495621_0018607 | Ga0495621_0018607_1466_1858 | 129 |
| 75 | 3300046691 | Ga0495670_0615743 | Ga0495670_0615743_165_557 | 129 |
| 76 | 3300049513 | Ga0501290_008537 | Ga0501290_008537_16_408 | 129 |
| 77 | 3300049523 | Ga0501300_022008 | Ga0501300_022008_272_664 | 129 |
| 78 | 3300050511 | nmdc:mga08y16_583702_c1 | nmdc:mga08y16_583702_c1_169_561 | 129 |
| 79 | 3300050511 | nmdc:mga08y16_713742_c1 | nmdc:mga08y16_713742_c1_464_856 | 129 |
| 80 | 3300050512 | nmdc:mga0n895_258805_c1 | nmdc:mga0n895_258805_c1_649_1041 | 129 |
| 81 | 3300053727 | Ga0500611_000003 | Ga0500611_000003_101004_101396 | 129 |
| 82 | 3300005330 | Ga0070690_100031369 | Ga0070690_1000313692 | 130 |
| 83 | 3300005353 | Ga0070669_100636283 | Ga0070669_1006362832 | 130 |
| 84 | 3300005719 | Ga0068861_100955285 | Ga0068861_1009552851 | 130 |
| 85 | 3300006237 | Ga0097621_101105013 | Ga0097621_1011050132 | 130 |
| 86 | 3300009093 | Ga0105240_10058436 | Ga0105240_100584365 | 130 |
| 87 | 3300013306 | Ga0163162_11622332 | Ga0163162_116223322 | 130 |
| 88 | 3300013306 | Ga0163162_12928649 | Ga0163162_129286491 | 130 |
| 89 | 3300014326 | Ga0157380_10317825 | Ga0157380_103178251 | 130 |
| 90 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000012330 | 130 |
| 91 | 3300031251 | Ga0265327_10019754 | Ga0265327_100197542 | 130 |
| 92 | 3300031616 | Ga0307508_10000926 | Ga0307508_1000092612 | 130 |
| 93 | 3300039437 | Ga0436365_1266867 | Ga0436365_1266867_909_1307 | 130 |
| 94 | 3300047320 | Ga0495672_0012233 | Ga0495672_0012233_3665_4063 | 130 |
| 95 | 3300053153 | Ga0500616_0043301 | Ga0500616_0043301_578_973 | 130 |
| 96 | 3300005329 | Ga0070683_100805651 | Ga0070683_1008056512 | 131 |
| 97 | 3300005335 | Ga0070666_10259758 | Ga0070666_102597582 | 131 |
| 98 | 3300005366 | Ga0070659_100104478 | Ga0070659_1001044782 | 131 |
| 99 | 3300005563 | Ga0068855_101412105 | Ga0068855_1014121052 | 131 |
| 100 | 3300005616 | Ga0068852_100485025 | Ga0068852_1004850252 | 131 |
| 101 | 3300005617 | Ga0068859_100000408 | Ga0068859_10000040819 | 131 |
| 102 | 3300005841 | Ga0068863_100013341 | Ga0068863_1000133418 | 131 |
| 103 | 3300006237 | Ga0097621_100020731 | Ga0097621_1000207315 | 131 |
| 104 | 3300006931 | Ga0097620_100000408 | Ga0097620_10000040823 | 131 |
| 105 | 3300009176 | Ga0105242_10461620 | Ga0105242_104616202 | 131 |
| 106 | 3300009176 | Ga0105242_10894068 | Ga0105242_108940682 | 131 |
| 107 | 3300013100 | Ga0157373_10141952 | Ga0157373_101419522 | 131 |
| 108 | 3300013102 | Ga0157371_10022195 | Ga0157371_100221952 | 131 |
| 109 | 3300013102 | Ga0157371_10085808 | Ga0157371_100858083 | 131 |
| 110 | 3300013102 | Ga0157371_11405342 | Ga0157371_114053422 | 131 |
| 111 | 3300013297 | Ga0157378_10022348 | Ga0157378_100223484 | 131 |
| 112 | 3300013306 | Ga0163162_10836519 | Ga0163162_108365192 | 131 |
| 113 | 3300013307 | Ga0157372_10025914 | Ga0157372_100259145 | 131 |
| 114 | 3300013307 | Ga0157372_10074428 | Ga0157372_100744283 | 131 |
| 115 | 3300013307 | Ga0157372_10466086 | Ga0157372_104660862 | 131 |
| 116 | 3300013308 | Ga0157375_10536118 | Ga0157375_105361182 | 131 |
| 117 | 3300014968 | Ga0157379_10026426 | Ga0157379_100264266 | 131 |
| 118 | 3300017792 | Ga0163161_10037684 | Ga0163161_100376843 | 131 |
| 119 | 3300025934 | Ga0207686_10875990 | Ga0207686_108759902 | 131 |
| 120 | 3300026088 | Ga0207641_10021211 | Ga0207641_100212113 | 131 |
| 121 | 3300026121 | Ga0207683_10220320 | Ga0207683_102203202 | 131 |
| 122 | 3300026121 | Ga0207683_10628201 | Ga0207683_106282012 | 131 |
| 123 | 3300027424 | Ga0209984_1018632 | Ga0209984_10186322 | 131 |
| 124 | 3300048911 | Ga0496108_0710675 | Ga0496108_0710675_441_839 | 131 |
| 125 | 3300005288 | Ga0065714_10008835 | Ga0065714_100088351 | 132 |
| 126 | 3300005356 | Ga0070674_100061018 | Ga0070674_1000610182 | 132 |
| 127 | 3300005366 | Ga0070659_100002987 | Ga0070659_1000029876 | 132 |
| 128 | 3300005367 | Ga0070667_101495432 | Ga0070667_1014954322 | 132 |
| 129 | 3300005539 | Ga0068853_100430065 | Ga0068853_1004300651 | 132 |
| 130 | 3300005616 | Ga0068852_100003313 | Ga0068852_10000331311 | 132 |
| 131 | 3300013105 | Ga0157369_10501853 | Ga0157369_105018532 | 132 |
| 132 | 3300025904 | Ga0207647_10000210 | Ga0207647_1000021036 | 132 |
| 133 | 3300025919 | Ga0207657_10161327 | Ga0207657_101613272 | 132 |
| 134 | 3300025932 | Ga0207690_10510338 | Ga0207690_105103381 | 132 |
| 135 | 3300026142 | Ga0207698_10007897 | Ga0207698_100078972 | 132 |
| 136 | 3300031456 | Ga0307513_10338198 | Ga0307513_103381981 | 132 |
| 137 | 3300031824 | Ga0307413_10926452 | Ga0307413_109264522 | 132 |
| 138 | 3300031852 | Ga0307410_10580464 | Ga0307410_105804642 | 132 |
| 139 | 3300037418 | Ga0395900_0036264 | Ga0395900_0036264_1724_2125 | 132 |
| 140 | 3300037471 | Ga0395905_0003668 | Ga0395905_0003668_9971_10372 | 132 |
| 141 | 3300041460 | Ga0451802_0839530 | Ga0451802_0839530_79_477 | 132 |
| 142 | 3300042876 | Ga0451577_0002492 | Ga0451577_0002492_13853_14254 | 132 |
| 143 | 3300044712 | Ga0453684_0188771 | Ga0453684_0188771_374_778 | 132 |
| 144 | 3300045051 | Ga0451576_0715212 | Ga0451576_0715212_328_732 | 132 |
| 145 | 3300005331 | Ga0070670_100163889 | Ga0070670_1001638892 | 133 |
| 146 | 3300005539 | Ga0068853_100075221 | Ga0068853_1000752212 | 133 |
| 147 | 3300013297 | Ga0157378_13238612 | Ga0157378_132386121 | 133 |
| 148 | 3300025925 | Ga0207650_10499834 | Ga0207650_104998342 | 133 |
| 149 | 3300005327 | Ga0070658_11689762 | Ga0070658_116897621 | 134 |
| 150 | 3300005338 | Ga0068868_100025008 | Ga0068868_1000250082 | 134 |
| 151 | 3300005339 | Ga0070660_100782119 | Ga0070660_1007821192 | 134 |
| 152 | 3300005355 | Ga0070671_100007334 | Ga0070671_1000073348 | 134 |
| 153 | 3300005364 | Ga0070673_100026234 | Ga0070673_1000262344 | 134 |
| 154 | 3300005365 | Ga0070688_100141391 | Ga0070688_1001413912 | 134 |
| 155 | 3300005367 | Ga0070667_100011690 | Ga0070667_1000116906 | 134 |
| 156 | 3300005466 | Ga0070685_10034339 | Ga0070685_100343394 | 134 |
| 157 | 3300005467 | Ga0070706_100002218 | Ga0070706_1000022186 | 134 |
| 158 | 3300005536 | Ga0070697_100001766 | Ga0070697_1000017666 | 134 |
| 159 | 3300005617 | Ga0068859_100002592 | Ga0068859_10000259214 | 134 |
| 160 | 3300005618 | Ga0068864_100088963 | Ga0068864_1000889632 | 134 |
| 161 | 3300005834 | Ga0068851_10024249 | Ga0068851_100242493 | 134 |
| 162 | 3300005841 | Ga0068863_100022967 | Ga0068863_1000229676 | 134 |
| 163 | 3300005842 | Ga0068858_100695742 | Ga0068858_1006957422 | 134 |
| 164 | 3300005843 | Ga0068860_100004018 | Ga0068860_10000401813 | 134 |
| 165 | 3300006931 | Ga0097620_100002592 | Ga0097620_10000259214 | 134 |
| 166 | 3300013296 | Ga0157374_11397416 | Ga0157374_113974162 | 134 |
| 167 | 3300013307 | Ga0157372_11252398 | Ga0157372_112523981 | 134 |
| 168 | 3300013308 | Ga0157375_12877052 | Ga0157375_128770521 | 134 |
| 169 | 3300025321 | Ga0207656_10026442 | Ga0207656_100264424 | 134 |
| 170 | 3300025910 | Ga0207684_10000810 | Ga0207684_1000081017 | 134 |
| 171 | 3300025925 | Ga0207650_10030946 | Ga0207650_100309463 | 134 |
| 172 | 3300025925 | Ga0207650_11093772 | Ga0207650_110937722 | 134 |
| 173 | 3300025931 | Ga0207644_10099002 | Ga0207644_100990024 | 134 |
| 174 | 3300025960 | Ga0207651_10033823 | Ga0207651_100338232 | 134 |
| 175 | 3300025986 | Ga0207658_10017395 | Ga0207658_100173955 | 134 |
| 176 | 3300026035 | Ga0207703_11059794 | Ga0207703_110597942 | 134 |
| 177 | 3300026041 | Ga0207639_11420612 | Ga0207639_114206122 | 134 |
| 178 | 3300026088 | Ga0207641_10263910 | Ga0207641_102639102 | 134 |
| 179 | 3300026095 | Ga0207676_10937454 | Ga0207676_109374542 | 134 |
| 180 | 3300028381 | Ga0268264_10002838 | Ga0268264_100028385 | 134 |
| 181 | 3300005334 | Ga0068869_100029524 | Ga0068869_1000295242 | 135 |
| 182 | 3300005335 | Ga0070666_10000128 | Ga0070666_1000012837 | 135 |
| 183 | 3300005340 | Ga0070689_101056533 | Ga0070689_1010565331 | 135 |
| 184 | 3300005347 | Ga0070668_100082097 | Ga0070668_1000820973 | 135 |
| 185 | 3300005355 | Ga0070671_100094557 | Ga0070671_1000945572 | 135 |
| 186 | 3300005364 | Ga0070673_100041861 | Ga0070673_1000418613 | 135 |
| 187 | 3300005367 | Ga0070667_100021120 | Ga0070667_1000211204 | 135 |
| 188 | 3300005539 | Ga0068853_100327026 | Ga0068853_1003270263 | 135 |
| 189 | 3300005543 | Ga0070672_100925554 | Ga0070672_1009255542 | 135 |
| 190 | 3300005617 | Ga0068859_100000018 | Ga0068859_10000001880 | 135 |
| 191 | 3300005618 | Ga0068864_100038833 | Ga0068864_1000388336 | 135 |
| 192 | 3300005834 | Ga0068851_10058622 | Ga0068851_100586224 | 135 |
| 193 | 3300005841 | Ga0068863_100008502 | Ga0068863_1000085027 | 135 |
| 194 | 3300005842 | Ga0068858_100019306 | Ga0068858_1000193066 | 135 |
| 195 | 3300005843 | Ga0068860_100003974 | Ga0068860_1000039743 | 135 |
| 196 | 3300006237 | Ga0097621_100036870 | Ga0097621_1000368704 | 135 |
| 197 | 3300006358 | Ga0068871_100306578 | Ga0068871_1003065782 | 135 |
| 198 | 3300006881 | Ga0068865_100135611 | Ga0068865_1001356113 | 135 |
| 199 | 3300006931 | Ga0097620_100000018 | Ga0097620_10000001880 | 135 |
| 200 | 3300009098 | Ga0105245_10369628 | Ga0105245_103696283 | 135 |
| 201 | 3300009101 | Ga0105247_10006710 | Ga0105247_100067103 | 135 |
| 202 | 3300009174 | Ga0105241_10000510 | Ga0105241_1000051012 | 135 |
| 203 | 3300009545 | Ga0105237_10001030 | Ga0105237_1000103010 | 135 |
| 204 | 3300009553 | Ga0105249_10005809 | Ga0105249_1000580910 | 135 |
| 205 | 3300010375 | Ga0105239_10105500 | Ga0105239_101055002 | 135 |
| 206 | 3300011119 | Ga0105246_10095375 | Ga0105246_100953753 | 135 |
| 207 | 3300011119 | Ga0105246_10248622 | Ga0105246_102486222 | 135 |
| 208 | 3300013297 | Ga0157378_10174443 | Ga0157378_101744432 | 135 |
| 209 | 3300013297 | Ga0157378_10924843 | Ga0157378_109248432 | 135 |
| 210 | 3300013306 | Ga0163162_10000599 | Ga0163162_1000059911 | 135 |
| 211 | 3300013308 | Ga0157375_11563735 | Ga0157375_115637351 | 135 |
| 212 | 3300014325 | Ga0163163_10173711 | Ga0163163_101737112 | 135 |
| 213 | 3300014969 | Ga0157376_10024514 | Ga0157376_100245144 | 135 |
| 214 | 3300025321 | Ga0207656_10015768 | Ga0207656_100157684 | 135 |
| 215 | 3300025900 | Ga0207710_10024666 | Ga0207710_100246663 | 135 |
| 216 | 3300025903 | Ga0207680_10000193 | Ga0207680_1000019327 | 135 |
| 217 | 3300025914 | Ga0207671_10001806 | Ga0207671_1000180622 | 135 |
| 218 | 3300025927 | Ga0207687_11052787 | Ga0207687_110527872 | 135 |
| 219 | 3300025931 | Ga0207644_10134318 | Ga0207644_101343183 | 135 |
| 220 | 3300025934 | Ga0207686_10481100 | Ga0207686_104811002 | 135 |
| 221 | 3300025938 | Ga0207704_10119432 | Ga0207704_101194322 | 135 |
| 222 | 3300025940 | Ga0207691_10141976 | Ga0207691_101419764 | 135 |
| 223 | 3300025942 | Ga0207689_10000602 | Ga0207689_1000060212 | 135 |
| 224 | 3300025944 | Ga0207661_10347352 | Ga0207661_103473521 | 135 |
| 225 | 3300025961 | Ga0207712_10011576 | Ga0207712_100115763 | 135 |
| 226 | 3300025986 | Ga0207658_10056397 | Ga0207658_100563972 | 135 |
| 227 | 3300026035 | Ga0207703_10013242 | Ga0207703_100132424 | 135 |
| 228 | 3300026088 | Ga0207641_10000015 | Ga0207641_1000001526 | 135 |
| 229 | 3300026095 | Ga0207676_10011487 | Ga0207676_100114873 | 135 |
| 230 | 3300027360 | Ga0209969_1041014 | Ga0209969_10410142 | 135 |
| 231 | 3300028380 | Ga0268265_11497549 | Ga0268265_114975491 | 135 |
| 232 | 3300028381 | Ga0268264_10000844 | Ga0268264_1000084420 | 135 |
| 233 | 3300031507 | Ga0307509_10288234 | Ga0307509_102882342 | 135 |
| 234 | 3300005327 | Ga0070658_10914302 | Ga0070658_109143021 | 136 |
| 235 | 3300006358 | Ga0068871_100067479 | Ga0068871_1000674793 | 136 |
| 236 | 3300013306 | Ga0163162_10072271 | Ga0163162_100722713 | 136 |
| 237 | 3300013308 | Ga0157375_10071695 | Ga0157375_100716954 | 136 |
| 238 | 3300014969 | Ga0157376_10078796 | Ga0157376_100787963 | 136 |
| 239 | 3300025909 | Ga0207705_10650571 | Ga0207705_106505711 | 136 |
| 240 | 3300029957 | Ga0265324_10043423 | Ga0265324_100434232 | 136 |
| 241 | 3300031344 | Ga0265316_10051565 | Ga0265316_100515655 | 136 |
| 242 | 3300050493 | nmdc:mga0k408_578744_c1 | nmdc:mga0k408_578744_c1_168_587 | 136 |
| 243 | 3300005327 | Ga0070658_10088189 | Ga0070658_100881894 | 137 |
| 244 | 3300005335 | Ga0070666_10023521 | Ga0070666_100235214 | 137 |
| 245 | 3300005548 | Ga0070665_100005850 | Ga0070665_1000058503 | 137 |
| 246 | 3300005617 | Ga0068859_100003579 | Ga0068859_10000357913 | 137 |
| 247 | 3300005844 | Ga0068862_100001079 | Ga0068862_10000107920 | 137 |
| 248 | 3300006931 | Ga0097620_100003579 | Ga0097620_10000357913 | 137 |
| 249 | 3300009101 | Ga0105247_10210422 | Ga0105247_102104222 | 137 |
| 250 | 3300009177 | Ga0105248_10034267 | Ga0105248_100342674 | 137 |
| 251 | 3300025903 | Ga0207680_10063815 | Ga0207680_100638153 | 137 |
| 252 | 3300025941 | Ga0207711_10001721 | Ga0207711_1000172115 | 137 |
| 253 | 3300028379 | Ga0268266_10002609 | Ga0268266_1000260917 | 137 |
| 254 | 3300028380 | Ga0268265_10001053 | Ga0268265_1000105316 | 137 |
| 255 | 2162886006 | SwRhRL3b_contig_2585836 | SwRhRL3b_0360.00001190 | 139 |
| 256 | 3300005295 | Ga0065707_10082691 | Ga0065707_100826917 | 139 |
| 257 | 3300009092 | Ga0105250_10000005 | Ga0105250_10000005319 | 139 |
| 258 | 3300014968 | Ga0157379_10001712 | Ga0157379_100017129 | 139 |
| 259 | 3300025711 | Ga0207696_1000346 | Ga0207696_100034622 | 139 |
| 260 | 3300048928 | Ga0496125_0666975 | Ga0496125_0666975_38_457 | 139 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2myp-assembly1.cif.gz_A | an arsenate reductase in the phosphate binding state | 0.9216 | 6 | 131 |
| 1rxi-assembly1.cif.gz_A | pi258 arsenate reductase (arsc) triple mutant c10s/c15a/c82s | 0.8918 | 6 | 128 |
| 2cd7-assembly1.cif.gz_A | staphylococcus aureus pi258 arsenate reductase (arsc) h62q mutant | 0.8909 | 6 | 128 |
| 1ljl-assembly1.cif.gz_A | wild type pi258 s. aureus arsenate reductase | 0.8852 | 6 | 128 |
| 2myp-assembly1.cif.gz_A | an arsenate reductase in the phosphate binding state | 0.8817 | 6 | 131 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3cdiA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Polyribonucleotide nucleotidyltransferase, RNA-binding domain | 0.8941 | 107 | 134 | 1.10.10.400 |
| af_I6X4W4_364_495_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8934 | 6 | 132 | 3.40.50.2300 |
| 2myuA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8759 | 6 | 131 | 3.40.50.2300 |
| 2mytA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8626 | 6 | 132 | 3.40.50.2300 |
| af_Q4DJ17_6_259_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8584 | 6 | 90 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I6GZ29-F1-model_v4 | deleted | 0.9922 | 3 | 131 |
|
| AF-A0A7C7PUP6-F1-model_v4 | Arsenate reductase ArsC | 0.9897 | 6 | 91 |
GO:0004725
GO:0046685 |
| AF-A0A7X3Q697-F1-model_v4 | deleted | 0.9831 | 6 | 139 |
|
| AF-A0A091B6C8-F1-model_v4 | Phosphotyrosine protein phosphatase I domain-containing protein | 0.9817 | 1 | 131 |
GO:0004726
GO:0030946 GO:0046685 GO:0140793 |
| AF-A0A257WCG2-F1-model_v4 | Low molecular weight phosphatase family protein | 0.9817 | 6 | 132 |
GO:0046685
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar