F369464

General Info

Members Datasets Scaffolds Average Seq Length
260 159 255 226

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100178491|Ga0075428_1001784916
Length 257
Sequence MAASARVAYLARRASDYGVETGPVKVNLAQGGEAMARILSVNVGGVREFEYNGRPAKSAIWKSPVAGRIAARGVNLEGDDQADRKAHGGPDKSVYAYAMEDMQWWKEKLRRSLQFGEFGENLTTEGIAVNDALVGERWEIGSAVFEVSEPRIPCWRLGVRMNDQGFVRRFTEALRPGTYLRIIVEGAVAAGDEIRIVERPDHDLTVRDIFRIYTRDRGEAERLLAVPRISESWRGWAQHFLEEMKSRRAGSASPGCC

Samples

Sample ID Description Type Environment
1 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
2 2619618881 Frankia sp. ACN1ag Isolate Unclassified
3 2619619003 Frankia sp. CpI1-P Isolate Nodule
4 2626541554 Frankia sp. AvcI.1 Isolate Nodule
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
46 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
96 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
97 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
98 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
99 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
100 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
101 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
102 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
103 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
104 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
116 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
117 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
118 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
119 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
120 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
121 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
122 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
123 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
126 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
127 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
128 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
129 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
132 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
133 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
134 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
135 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
136 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
138 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
145 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
146 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
147 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
153 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
154 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
155 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
156 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
157 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
158 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
159 8054913762 Frankia gtarii Agncl-10 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.08
Metatranscriptomes 0
Isolates 1.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 1.15
Rhizoplane 1.92
Rhizosphere 95.77
Stem 0
Stem Tuber 0
Unclassified 1.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10057062 3300003373 Bacteria 983
2 JGI25404J52841_10028437 3300003659 Bacteria 1200
3 Ga0070690_100433110 3300005330 Bacteria 972
4 Ga0070670_100343581 3300005331 Unclassified 1310
5 Ga0070689_100014848 3300005340 Bacteria 5666
6 Ga0070692_10303702 3300005345 Viruses 975
7 Ga0070668_100472270 3300005347 Unclassified 1082
8 Ga0070671_100544119 3300005355 Bacteria 1001
9 Ga0070674_100111984 3300005356 Bacteria 2005
10 Ga0070673_100456089 3300005364 Bacteria 1151
11 Ga0070701_10452177 3300005438 Unclassified 825
12 Ga0070708_100001150 3300005445 Bacteria 20331
13 Ga0070708_100011877 3300005445 Bacteria 7090
14 Ga0070708_100028131 3300005445 Bacteria 4834
15 Ga0070708_100030208 3300005445 Bacteria 4683
16 Ga0070708_100037687 3300005445 Bacteria 4220
17 Ga0070708_100060381 3300005445 Bacteria 3383
18 Ga0070708_100089782 3300005445 Bacteria 2796
19 Ga0070708_100230165 3300005445 Bacteria 1739
20 Ga0070678_100025389 3300005456 Bacteria 3985
21 Ga0070662_100292592 3300005457 Unclassified 1321
22 Ga0070706_100000280 3300005467 Bacteria 62151
23 Ga0070706_100001634 3300005467 Bacteria 23369
24 Ga0070706_100002831 3300005467 Bacteria 17331
25 Ga0070706_100027900 3300005467 Bacteria 5192
26 Ga0070706_100028418 3300005467 Archaea 5148
27 Ga0070706_100097793 3300005467 Bacteria 2727
28 Ga0070706_100358095 3300005467 Bacteria 1360
29 Ga0070707_100079643 3300005468 Bacteria 3162
30 Ga0070698_100008361 3300005471 Bacteria 11184
31 Ga0070698_100334501 3300005471 Bacteria 1446
32 Ga0070698_100441318 3300005471 Unclassified 1237
33 Ga0070698_100546201 3300005471 Unclassified 1098
34 Ga0070698_100751996 3300005471 Unclassified 918
35 Ga0070699_100129561 3300005518 Bacteria 2224
36 Ga0070699_100192439 3300005518 Bacteria 1812
37 Ga0070699_100294787 3300005518 Bacteria 1455
38 Ga0070697_100026262 3300005536 Bacteria 4650
39 Ga0070697_100042939 3300005536 Bacteria 3659
40 Ga0070697_100111785 3300005536 Bacteria 2277
41 Ga0070672_100059330 3300005543 Bacteria 3010
42 Ga0070672_100662519 3300005543 Unclassified 912
43 Ga0070693_100320781 3300005547 Bacteria 1051
44 Ga0070665_100127979 3300005548 Bacteria 2542
45 Ga0070665_101362347 3300005548 Bacteria 719
46 Ga0070704_100156129 3300005549 Bacteria 1800
47 Ga0070702_100384574 3300005615 Unclassified 999
48 Ga0068864_100151772 3300005618 Bacteria 2099
49 Ga0068864_100422378 3300005618 Bacteria 1271
50 Ga0068861_100226007 3300005719 Bacteria 1585
51 Ga0068863_100002065 3300005841 Bacteria 19913
52 Ga0068863_100027208 3300005841 Bacteria 5453
53 Ga0068863_100211980 3300005841 Bacteria 1865
54 Ga0068863_100221910 3300005841 Unclassified 1821
55 Ga0068863_100601590 3300005841 Bacteria 1088
56 Ga0068858_100111532 3300005842 Bacteria 2554
57 Ga0081455_10017012 3300005937 Bacteria 6990
58 Ga0081455_10290974 3300005937 Unclassified 1176
59 Ga0081455_10327914 3300005937 Bacteria 1088
60 Ga0081538_10014682 3300005981 Bacteria 6116
61 Ga0081538_10094733 3300005981 Bacteria 1528
62 Ga0081540_1000085 3300005983 Bacteria 99716
63 Ga0070716_100329497 3300006173 Unclassified 1073
64 Ga0070712_100187672 3300006175 Bacteria 1615
65 Ga0075428_100023711 3300006844 Bacteria 6791
66 Ga0075428_100162283 3300006844 Bacteria 2425
67 Ga0075428_100178491 3300006844 Bacteria 2299
68 Ga0075428_100217174 3300006844 Unclassified 2065
69 Ga0075431_100287032 3300006847 Unclassified 1665
70 Ga0075431_100392940 3300006847 Bacteria 1389
71 Ga0075433_10000475 3300006852 Bacteria 26124
72 Ga0075433_10029002 3300006852 Bacteria 4710
73 Ga0075434_100001631 3300006871 Bacteria 19094
74 Ga0075434_100045236 3300006871 Bacteria 4367
75 Ga0075434_100113241 3300006871 Unclassified 2725
76 Ga0075434_100245438 3300006871 Bacteria 1810
77 Ga0075434_100555641 3300006871 Bacteria 1167
78 Ga0068865_100290503 3300006881 Unclassified 1305
79 Ga0075436_100002220 3300006914 Bacteria 13406
80 Ga0075435_100032383 3300007076 Bacteria 4128
81 Ga0075435_100042332 3300007076 Bacteria 3643
82 Ga0075435_100124072 3300007076 Bacteria 2157
83 Ga0075435_100750694 3300007076 Bacteria 849
84 Ga0099794_10010478 3300007265 Bacteria 3937
85 Ga0099794_10022446 3300007265 Unclassified 2877
86 Ga0099795_10108875 3300007788 Bacteria 1096
87 Ga0111539_10058257 3300009094 Bacteria 4583
88 Ga0111539_10118681 3300009094 Bacteria 3100
89 Ga0111539_10133450 3300009094 Bacteria 2907
90 Ga0105247_10097719 3300009101 Bacteria 1873
91 Ga0114129_10079123 3300009147 Unclassified 4571
92 Ga0114129_10288981 3300009147 Unclassified 2188
93 Ga0114129_10745948 3300009147 Unclassified 1254
94 Ga0114129_10768793 3300009147 Unclassified 1232
95 Ga0105241_10150612 3300009174 Bacteria 1903
96 Ga0105248_10210707 3300009177 Unclassified 2189
97 Ga0105248_10219138 3300009177 Unclassified 2143
98 Ga0105248_10411995 3300009177 Bacteria 1522
99 Ga0105248_11154553 3300009177 Bacteria 876
100 Ga0105249_10152493 3300009553 Bacteria 2226
101 Ga0099796_10158903 3300010159 Unclassified 895
102 Ga0105246_10272060 3300011119 Bacteria 1355
103 Ga0157316_1001889 3300012510 Unclassified 1363
104 Ga0157374_10288846 3300013296 Bacteria 1620
105 Ga0157378_10059835 3300013297 Bacteria 3399
106 Ga0157378_10062279 3300013297 Bacteria 3331
107 Ga0163162_10200644 3300013306 Bacteria 2123
108 Ga0163162_10225204 3300013306 Bacteria 2005
109 Ga0163162_10641103 3300013306 Bacteria 1186
110 Ga0157375_10161103 3300013308 Bacteria 2385
111 Ga0157375_10173027 3300013308 Unclassified 2308
112 Ga0163163_10384787 3300014325 Unclassified 1460
113 Ga0157380_10377787 3300014326 Bacteria 1336
114 Ga0157379_10787296 3300014968 Bacteria 897
115 Ga0163161_10220153 3300017792 Unclassified 1470
116 Ga0207682_10009009 3300025893 Bacteria 3943
117 Ga0207692_10152679 3300025898 Bacteria 1324
118 Ga0207684_10000017 3300025910 Bacteria 385006
119 Ga0207684_10000091 3300025910 Bacteria 170468
120 Ga0207684_10002382 3300025910 Bacteria 19020
121 Ga0207684_10026799 3300025910 Bacteria 4914
122 Ga0207684_10118135 3300025910 Bacteria 2272
123 Ga0207684_10118414 3300025910 Bacteria 2269
124 Ga0207684_10159644 3300025910 Unclassified 1941
125 Ga0207684_10576768 3300025910 Bacteria 962
126 Ga0207654_10154268 3300025911 Bacteria 1477
127 Ga0207707_10436829 3300025912 Bacteria 1121
128 Ga0207646_10012998 3300025922 Bacteria 7978
129 Ga0207646_10076593 3300025922 Unclassified 2989
130 Ga0207646_10136322 3300025922 Unclassified 2210
131 Ga0207650_10409434 3300025925 Unclassified 1124
132 Ga0207659_10076346 3300025926 Unclassified 2462
133 Ga0207659_10443549 3300025926 Unclassified 1092
134 Ga0207670_10051415 3300025936 Bacteria 2766
135 Ga0207669_10048412 3300025937 Unclassified 2525
136 Ga0207704_10033408 3300025938 Unclassified 2925
137 Ga0207704_10198296 3300025938 Unclassified 1467
138 Ga0207665_10206113 3300025939 Bacteria 1434
139 Ga0207691_10032512 3300025940 Bacteria 4863
140 Ga0207711_10166151 3300025941 Unclassified 2000
141 Ga0207651_10323043 3300025960 Bacteria 1291
142 Ga0207668_10584987 3300025972 Unclassified 971
143 Ga0207640_10207222 3300025981 Unclassified 1491
144 Ga0207658_10472127 3300025986 Bacteria 1113
145 Ga0207703_10354576 3300026035 Unclassified 1351
146 Ga0207678_10098377 3300026067 Bacteria 2500
147 Ga0207678_10108703 3300026067 Bacteria 2366
148 Ga0207708_10057647 3300026075 Bacteria 2963
149 Ga0207708_10102296 3300026075 Bacteria 2218
150 Ga0207708_10191967 3300026075 Unclassified 1626
151 Ga0207702_10054131 3300026078 Bacteria 3399
152 Ga0207641_10014445 3300026088 Bacteria 6469
153 Ga0207641_10022400 3300026088 Bacteria 5201
154 Ga0207641_10104600 3300026088 Bacteria 2500
155 Ga0207648_10033648 3300026089 Bacteria 4520
156 Ga0207648_10176104 3300026089 Bacteria 1892
157 Ga0207676_10438326 3300026095 Bacteria 1229
158 Ga0207675_100042156 3300026118 Unclassified 4260
159 Ga0209588_1005819 3300027671 Bacteria 3551
160 Ga0209588_1028092 3300027671 Bacteria 1790
161 Ga0209974_10000567 3300027876 Bacteria 12352
162 Ga0207428_10121345 3300027907 Bacteria 2004
163 Ga0268266_10380704 3300028379 Unclassified 1331
164 Ga0268266_10385007 3300028379 Unclassified 1323
165 Ga0268266_10828329 3300028379 Unclassified 894
166 Ga0268264_10219825 3300028381 Bacteria 1748
167 Ga0268264_10323191 3300028381 Bacteria 1460
168 Ga0268264_10717859 3300028381 Unclassified 994
169 Ga0265330_10018657 3300031235 Bacteria 3185
170 Ga0265332_10021851 3300031238 Bacteria 2825
171 Ga0265328_10007800 3300031239 Bacteria 4449
172 Ga0265329_10036050 3300031242 Bacteria 1596
173 Ga0265339_10246226 3300031249 Unclassified 866
174 Ga0265316_10019835 3300031344 Bacteria 5740
175 Ga0373939_0228028 3300035114 Unclassified 716
176 Ga0373960_0179310 3300035121 Unclassified 739
177 Ga0373943_0126760 3300035170 Bacteria 1362
178 Ga0373927_0208452 3300035695 Bacteria 1284
179 Ga0373947_0026525 3300035725 Bacteria 3388
180 Ga0373947_0396060 3300035725 Unclassified 931
181 Ga0373937_0288096 3300036401 Bacteria 1551
182 Ga0373925_0029145 3300037068 Bacteria 4049
183 Ga0373925_0667354 3300037068 Unclassified 857
184 Ga0395899_0118134 3300037312 Bacteria 1902
185 Ga0395901_0891631 3300038443 Unclassified 872
186 Ga0439455_0021232 3300042012 Bacteria 1546
187 Ga0451577_0016319 3300042876 Bacteria 6881
188 Ga0453683_0002290 3300044673 Bacteria 15099
189 Ga0453684_0158341 3300044712 Bacteria 2681
190 Ga0451576_1141345 3300045051 Unclassified 815
191 Ga0495603_0360633 3300046455 Unclassified 834
192 Ga0495653_0123787 3300046463 Bacteria 1839
193 Ga0495580_0004163 3300046472 Bacteria 12162
194 Ga0495580_0007376 3300046472 Bacteria 8844
195 Ga0495580_0173959 3300046472 Bacteria 1487
196 Ga0495662_0097116 3300046476 Bacteria 1440
197 Ga0495664_0002950 3300046477 Bacteria 9190
198 Ga0495585_0108356 3300046492 Bacteria 1480
199 Ga0495594_0147015 3300046499 Bacteria 1338
200 Ga0495616_0251123 3300046513 Unclassified 760
201 Ga0495618_0065587 3300046514 Bacteria 2308
202 Ga0495628_0000545 3300046516 Bacteria 34592
203 Ga0495663_0075101 3300046525 Unclassified 1081
204 Ga0495640_0057987 3300046533 Bacteria 2642
205 Ga0495587_0133858 3300046536 Bacteria 1416
206 Ga0495598_0145576 3300046537 Unclassified 823
207 Ga0495633_0273408 3300046558 Unclassified 769
208 Ga0495635_0172903 3300046663 Unclassified 1469
209 Ga0495635_0249779 3300046663 Unclassified 1196
210 Ga0495659_0138638 3300046664 Unclassified 969
211 Ga0495623_0140712 3300046679 Unclassified 1436
212 Ga0495647_0069599 3300046681 Unclassified 1406
213 Ga0495589_0092821 3300046794 Bacteria 1465
214 Ga0495581_0085728 3300047315 Bacteria 1826
215 Ga0495604_0055312 3300047317 Bacteria 3059
216 Ga0495604_0105009 3300047317 Bacteria 2069
217 Ga0495674_0660157 3300047319 Unclassified 824
218 Ga0495684_0004596 3300047471 Bacteria 10783
219 Ga0495684_0042911 3300047471 Bacteria 3463
220 Ga0495602_0361970 3300048088 Bacteria 1044
221 Ga0496100_0107436 3300048903 Bacteria 1933
222 Ga0496102_0001241 3300048905 Bacteria 23069
223 Ga0496103_0017906 3300048906 Bacteria 4245
224 Ga0496106_0589771 3300048909 Unclassified 890
225 Ga0496107_0014427 3300048910 Bacteria 5533
226 Ga0496126_0746574 3300048929 Bacteria 756
227 Ga0501076_0752757 3300049592 Bacteria 804
228 Ga0501077_0135066 3300049593 Bacteria 1564
229 nmdc:mga05p37_29404_c1 3300050507 Bacteria 6705
230 nmdc:mga05p37_991734_c1 3300050507 Bacteria 894
231 nmdc:mga09592_71742_c1 3300050508 Bacteria 2940
232 nmdc:mga06r32_161903_c1 3300050510 Bacteria 1845
233 nmdc:mga06r32_28067_c1 3300050510 Bacteria 5264
234 nmdc:mga06r32_287659_c1 3300050510 Bacteria 1630
235 nmdc:mga08y16_198905_c1 3300050511 Bacteria 2077
236 nmdc:mga08y16_75248_c1 3300050511 Bacteria 3520
237 nmdc:mga0n895_1057016_c1 3300050512 Bacteria 791
238 nmdc:mga0n895_110362_c1 3300050512 Unclassified 2767
239 nmdc:mga0n895_178335_c1 3300050512 Bacteria 2156
240 nmdc:mga0n895_202545_c1 3300050512 Unclassified 2015
241 nmdc:mga0n895_57069_c1 3300050512 Bacteria 3848
242 nmdc:mga0n895_61631_c1 3300050512 Bacteria 3704
243 nmdc:mga0rr50_22263_c1 3300050513 Bacteria 4346
244 nmdc:mga0rr50_32606_c1 3300050513 Bacteria 3714
245 nmdc:mga0rr50_34240_c1 3300050513 Bacteria 3636
246 nmdc:mga0rr50_460608_c1 3300050513 Unclassified 1078
247 nmdc:mga0a205_284801_c1 3300050515 Bacteria 1527
248 nmdc:mga0a205_2997_c1 3300050515 Bacteria 14965
249 nmdc:mga0a205_34238_c1 3300050515 Bacteria 4874
250 nmdc:mga0a205_6416_c1 3300050515 Bacteria 10630
251 Ga0495601_0029861 3300053077 Bacteria 3384
252 Ga0495595_0008974 3300053084 Bacteria 4124
253 Ga0495619_0064548 3300053085 Bacteria 2441
254 Ga0530510_0448664 3300061734 Bacteria 975
255 Ga0530510_0487298 3300061734 Bacteria 934

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048929 Ga0496126_0746574 Ga0496126_0746574_109_696 195
2 3300025910 Ga0207684_10159644 Ga0207684_101596442 200
3 3300005467 Ga0070706_100358095 Ga0070706_1003580952 204
4 3300009094 Ga0111539_10058257 Ga0111539_100582574 206
5 3300005937 Ga0081455_10327914 Ga0081455_103279142 210
6 3300025960 Ga0207651_10323043 Ga0207651_103230432 210
7 3300046513 Ga0495616_0251123 Ga0495616_0251123_41_682 210
8 3300046525 Ga0495663_0075101 Ga0495663_0075101_325_966 210
9 3300046794 Ga0495589_0092821 Ga0495589_0092821_786_1427 210
10 3300050510 nmdc:mga06r32_287659_c1 nmdc:mga06r32_287659_c1_971_1609 212
11 3300025912 Ga0207707_10436829 Ga0207707_104368291 213
12 3300046472 Ga0495580_0004163 Ga0495580_0004163_10638_11279 213
13 3300048905 Ga0496102_0001241 Ga0496102_0001241_17461_18120 213
14 3300048906 Ga0496103_0017906 Ga0496103_0017906_314_973 213
15 3300061734 Ga0530510_0448664 Ga0530510_0448664_71_712 213
16 3300009147 Ga0114129_10768793 Ga0114129_107687932 214
17 3300042012 Ga0439455_0021232 Ga0439455_0021232_766_1410 214
18 3300005445 Ga0070708_100001150 Ga0070708_10000115017 215
19 3300006852 Ga0075433_10000475 Ga0075433_1000047522 215
20 3300006871 Ga0075434_100001631 Ga0075434_10000163113 215
21 3300007265 Ga0099794_10010478 Ga0099794_100104782 215
22 3300009177 Ga0105248_10411995 Ga0105248_104119952 215
23 3300050512 nmdc:mga0n895_110362_c1 nmdc:mga0n895_110362_c1_1493_2143 215
24 3300050515 nmdc:mga0a205_2997_c1 nmdc:mga0a205_2997_c1_4152_4802 215
25 3300006844 Ga0075428_100023711 Ga0075428_1000237115 216
26 3300006847 Ga0075431_100287032 Ga0075431_1002870322 216
27 3300007265 Ga0099794_10022446 Ga0099794_100224464 216
28 3300027671 Ga0209588_1005819 Ga0209588_10058194 216
29 3300027671 Ga0209588_1028092 Ga0209588_10280922 216
30 3300050510 nmdc:mga06r32_161903_c1 nmdc:mga06r32_161903_c1_1182_1832 216
31 3300050511 nmdc:mga08y16_198905_c1 nmdc:mga08y16_198905_c1_83_733 216
32 3300006871 Ga0075434_100045236 Ga0075434_1000452365 217
33 3300007076 Ga0075435_100042332 Ga0075435_1000423322 217
34 3300042876 Ga0451577_0016319 Ga0451577_0016319_5689_6342 217
35 3300044712 Ga0453684_0158341 Ga0453684_0158341_955_1608 217
36 3300050512 nmdc:mga0n895_57069_c1 nmdc:mga0n895_57069_c1_457_1116 217
37 3300050513 nmdc:mga0rr50_34240_c1 nmdc:mga0rr50_34240_c1_249_908 217
38 3300005445 Ga0070708_100011877 Ga0070708_1000118772 219
39 3300005445 Ga0070708_100028131 Ga0070708_1000281313 219
40 3300005445 Ga0070708_100060381 Ga0070708_1000603812 219
41 3300005467 Ga0070706_100000280 Ga0070706_10000028017 219
42 3300005467 Ga0070706_100097793 Ga0070706_1000977933 219
43 3300005471 Ga0070698_100546201 Ga0070698_1005462012 219
44 3300005518 Ga0070699_100129561 Ga0070699_1001295612 219
45 3300006847 Ga0075431_100392940 Ga0075431_1003929402 219
46 3300007788 Ga0099795_10108875 Ga0099795_101088752 219
47 3300009147 Ga0114129_10079123 Ga0114129_100791235 219
48 3300009147 Ga0114129_10288981 Ga0114129_102889812 219
49 3300010159 Ga0099796_10158903 Ga0099796_101589032 219
50 3300025910 Ga0207684_10000017 Ga0207684_1000001753 219
51 3300025910 Ga0207684_10576768 Ga0207684_105767681 219
52 3300025922 Ga0207646_10012998 Ga0207646_100129987 219
53 3300050512 nmdc:mga0n895_1057016_c1 nmdc:mga0n895_1057016_c1_58_717 219
54 3300050515 nmdc:mga0a205_284801_c1 nmdc:mga0a205_284801_c1_358_1017 219
55 iso_pu_bacteria 2579778521 2579852528 219
56 iso_pu_bacteria 2619618881 2619856393 219
57 iso_pu_bacteria 2619619003 2620348000 219
58 iso_pu_bacteria 2626541554 2626638526 219
59 iso_pu_bacteria 8054913762 8054920598 219
60 3300028379 Ga0268266_10380704 Ga0268266_103807042 222
61 3300046477 Ga0495664_0002950 Ga0495664_0002950_326_1228 222
62 3300046492 Ga0495585_0108356 Ga0495585_0108356_52_735 222
63 3300005340 Ga0070689_100014848 Ga0070689_1000148485 223
64 3300005543 Ga0070672_100059330 Ga0070672_1000593301 223
65 3300005549 Ga0070704_100156129 Ga0070704_1001561291 223
66 3300005618 Ga0068864_100422378 Ga0068864_1004223781 223
67 3300005841 Ga0068863_100211980 Ga0068863_1002119802 223
68 3300005842 Ga0068858_100111532 Ga0068858_1001115322 223
69 3300005937 Ga0081455_10017012 Ga0081455_100170125 223
70 3300006852 Ga0075433_10029002 Ga0075433_100290025 223
71 3300007076 Ga0075435_100124072 Ga0075435_1001240722 223
72 3300009094 Ga0111539_10118681 Ga0111539_101186812 223
73 3300009094 Ga0111539_10133450 Ga0111539_101334502 223
74 3300009174 Ga0105241_10150612 Ga0105241_101506122 223
75 3300009177 Ga0105248_11154553 Ga0105248_111545531 223
76 3300014968 Ga0157379_10787296 Ga0157379_107872961 223
77 3300025911 Ga0207654_10154268 Ga0207654_101542682 223
78 3300025936 Ga0207670_10051415 Ga0207670_100514152 223
79 3300025986 Ga0207658_10472127 Ga0207658_104721271 223
80 3300026067 Ga0207678_10108703 Ga0207678_101087032 223
81 3300026078 Ga0207702_10054131 Ga0207702_100541312 223
82 3300026089 Ga0207648_10176104 Ga0207648_101761042 223
83 3300026095 Ga0207676_10438326 Ga0207676_104383261 223
84 3300028381 Ga0268264_10323191 Ga0268264_103231911 223
85 3300036401 Ga0373937_0288096 Ga0373937_0288096_224_898 223
86 3300044673 Ga0453683_0002290 Ga0453683_0002290_13134_13805 223
87 3300045051 Ga0451576_1141345 Ga0451576_1141345_56_727 223
88 3300048903 Ga0496100_0107436 Ga0496100_0107436_250_921 223
89 3300048909 Ga0496106_0589771 Ga0496106_0589771_138_809 223
90 3300048910 Ga0496107_0014427 Ga0496107_0014427_2602_3273 223
91 3300050513 nmdc:mga0rr50_22263_c1 nmdc:mga0rr50_22263_c1_2131_2802 223
92 3300050515 nmdc:mga0a205_6416_c1 nmdc:mga0a205_6416_c1_1736_2407 223
93 3300005548 Ga0070665_101362347 Ga0070665_1013623471 224
94 3300009177 Ga0105248_10219138 Ga0105248_102191382 224
95 3300028379 Ga0268266_10828329 Ga0268266_108283291 224
96 3300005364 Ga0070673_100456089 Ga0070673_1004560891 225
97 3300005547 Ga0070693_100320781 Ga0070693_1003207812 225
98 3300005618 Ga0068864_100151772 Ga0068864_1001517723 225
99 3300005841 Ga0068863_100002065 Ga0068863_1000020656 225
100 3300005841 Ga0068863_100601590 Ga0068863_1006015902 225
101 3300006173 Ga0070716_100329497 Ga0070716_1003294971 225
102 3300006175 Ga0070712_100187672 Ga0070712_1001876721 225
103 3300025898 Ga0207692_10152679 Ga0207692_101526792 225
104 3300026088 Ga0207641_10014445 Ga0207641_100144456 225
105 3300026088 Ga0207641_10104600 Ga0207641_101046002 225
106 3300031235 Ga0265330_10018657 Ga0265330_100186576 225
107 3300031238 Ga0265332_10021851 Ga0265332_100218513 225
108 3300031239 Ga0265328_10007800 Ga0265328_100078002 225
109 3300031242 Ga0265329_10036050 Ga0265329_100360502 225
110 3300031249 Ga0265339_10246226 Ga0265339_102462261 225
111 3300031344 Ga0265316_10019835 Ga0265316_100198353 225
112 3300046463 Ga0495653_0123787 Ga0495653_0123787_630_1307 225
113 3300046516 Ga0495628_0000545 Ga0495628_0000545_33001_33684 225
114 3300046663 Ga0495635_0172903 Ga0495635_0172903_743_1420 225
115 3300046679 Ga0495623_0140712 Ga0495623_0140712_141_818 225
116 3300047317 Ga0495604_0105009 Ga0495604_0105009_1162_1839 225
117 3300047471 Ga0495684_0004596 Ga0495684_0004596_9535_10218 225
118 3300005330 Ga0070690_100433110 Ga0070690_1004331102 226
119 3300005345 Ga0070692_10303702 Ga0070692_103037021 226
120 3300005356 Ga0070674_100111984 Ga0070674_1001119842 226
121 3300005445 Ga0070708_100230165 Ga0070708_1002301653 226
122 3300005456 Ga0070678_100025389 Ga0070678_1000253893 226
123 3300005457 Ga0070662_100292592 Ga0070662_1002925921 226
124 3300005471 Ga0070698_100334501 Ga0070698_1003345011 226
125 3300005471 Ga0070698_100751996 Ga0070698_1007519961 226
126 3300013306 Ga0163162_10641103 Ga0163162_106411032 226
127 3300013308 Ga0157375_10173027 Ga0157375_101730272 226
128 3300014325 Ga0163163_10384787 Ga0163163_103847872 226
129 3300017792 Ga0163161_10220153 Ga0163161_102201532 226
130 3300025893 Ga0207682_10009009 Ga0207682_100090092 226
131 3300025926 Ga0207659_10076346 Ga0207659_100763462 226
132 3300025937 Ga0207669_10048412 Ga0207669_100484123 226
133 3300025938 Ga0207704_10033408 Ga0207704_100334083 226
134 3300025940 Ga0207691_10032512 Ga0207691_100325122 226
135 3300025981 Ga0207640_10207222 Ga0207640_102072222 226
136 3300026067 Ga0207678_10098377 Ga0207678_100983773 226
137 3300026075 Ga0207708_10191967 Ga0207708_101919673 226
138 3300026089 Ga0207648_10033648 Ga0207648_100336485 226
139 3300026118 Ga0207675_100042156 Ga0207675_1000421562 226
140 3300046472 Ga0495580_0007376 Ga0495580_0007376_701_1381 226
141 3300003373 JGI25407J50210_10057062 JGI25407J50210_100570621 227
142 3300003659 JGI25404J52841_10028437 JGI25404J52841_100284372 227
143 3300005331 Ga0070670_100343581 Ga0070670_1003435812 227
144 3300005347 Ga0070668_100472270 Ga0070668_1004722702 227
145 3300005355 Ga0070671_100544119 Ga0070671_1005441192 227
146 3300005438 Ga0070701_10452177 Ga0070701_104521771 227
147 3300005445 Ga0070708_100030208 Ga0070708_1000302084 227
148 3300005445 Ga0070708_100037687 Ga0070708_1000376874 227
149 3300005445 Ga0070708_100089782 Ga0070708_1000897823 227
150 3300005467 Ga0070706_100001634 Ga0070706_10000163412 227
151 3300005467 Ga0070706_100002831 Ga0070706_10000283117 227
152 3300005467 Ga0070706_100027900 Ga0070706_1000279005 227
153 3300005467 Ga0070706_100028418 Ga0070706_1000284182 227
154 3300005468 Ga0070707_100079643 Ga0070707_1000796433 227
155 3300005471 Ga0070698_100008361 Ga0070698_1000083614 227
156 3300005471 Ga0070698_100441318 Ga0070698_1004413181 227
157 3300005518 Ga0070699_100192439 Ga0070699_1001924392 227
158 3300005518 Ga0070699_100294787 Ga0070699_1002947872 227
159 3300005536 Ga0070697_100026262 Ga0070697_1000262625 227
160 3300005536 Ga0070697_100042939 Ga0070697_1000429396 227
161 3300005536 Ga0070697_100111785 Ga0070697_1001117853 227
162 3300005543 Ga0070672_100662519 Ga0070672_1006625191 227
163 3300005548 Ga0070665_100127979 Ga0070665_1001279793 227
164 3300005615 Ga0070702_100384574 Ga0070702_1003845741 227
165 3300005719 Ga0068861_100226007 Ga0068861_1002260071 227
166 3300005841 Ga0068863_100027208 Ga0068863_1000272083 227
167 3300005841 Ga0068863_100221910 Ga0068863_1002219102 227
168 3300005937 Ga0081455_10290974 Ga0081455_102909742 227
169 3300005981 Ga0081538_10014682 Ga0081538_100146827 227
170 3300005981 Ga0081538_10094733 Ga0081538_100947331 227
171 3300005983 Ga0081540_1000085 Ga0081540_100008586 227
172 3300006844 Ga0075428_100162283 Ga0075428_1001622833 227
173 3300006844 Ga0075428_100178491 Ga0075428_1001784916 227
174 3300006844 Ga0075428_100217174 Ga0075428_1002171744 227
175 3300006871 Ga0075434_100113241 Ga0075434_1001132412 227
176 3300006871 Ga0075434_100245438 Ga0075434_1002454382 227
177 3300006871 Ga0075434_100555641 Ga0075434_1005556412 227
178 3300006881 Ga0068865_100290503 Ga0068865_1002905032 227
179 3300006914 Ga0075436_100002220 Ga0075436_10000222010 227
180 3300007076 Ga0075435_100032383 Ga0075435_1000323832 227
181 3300007076 Ga0075435_100750694 Ga0075435_1007506942 227
182 3300009101 Ga0105247_10097719 Ga0105247_100977191 227
183 3300009147 Ga0114129_10745948 Ga0114129_107459482 227
184 3300009177 Ga0105248_10210707 Ga0105248_102107072 227
185 3300009553 Ga0105249_10152493 Ga0105249_101524932 227
186 3300011119 Ga0105246_10272060 Ga0105246_102720601 227
187 3300012510 Ga0157316_1001889 Ga0157316_10018893 227
188 3300013296 Ga0157374_10288846 Ga0157374_102888462 227
189 3300013297 Ga0157378_10059835 Ga0157378_100598355 227
190 3300013297 Ga0157378_10062279 Ga0157378_100622793 227
191 3300013306 Ga0163162_10200644 Ga0163162_102006443 227
192 3300013306 Ga0163162_10225204 Ga0163162_102252042 227
193 3300013308 Ga0157375_10161103 Ga0157375_101611033 227
194 3300014326 Ga0157380_10377787 Ga0157380_103777872 227
195 3300025910 Ga0207684_10000091 Ga0207684_1000009126 227
196 3300025910 Ga0207684_10002382 Ga0207684_100023829 227
197 3300025910 Ga0207684_10026799 Ga0207684_100267994 227
198 3300025910 Ga0207684_10118135 Ga0207684_101181354 227
199 3300025910 Ga0207684_10118414 Ga0207684_101184142 227
200 3300025922 Ga0207646_10076593 Ga0207646_100765933 227
201 3300025922 Ga0207646_10136322 Ga0207646_101363223 227
202 3300025925 Ga0207650_10409434 Ga0207650_104094341 227
203 3300025926 Ga0207659_10443549 Ga0207659_104435492 227
204 3300025938 Ga0207704_10198296 Ga0207704_101982962 227
205 3300025939 Ga0207665_10206113 Ga0207665_102061131 227
206 3300025941 Ga0207711_10166151 Ga0207711_101661512 227
207 3300025972 Ga0207668_10584987 Ga0207668_105849872 227
208 3300026035 Ga0207703_10354576 Ga0207703_103545762 227
209 3300026075 Ga0207708_10057647 Ga0207708_100576473 227
210 3300026075 Ga0207708_10102296 Ga0207708_101022961 227
211 3300026088 Ga0207641_10022400 Ga0207641_100224005 227
212 3300027876 Ga0209974_10000567 Ga0209974_1000056712 227
213 3300027907 Ga0207428_10121345 Ga0207428_101213453 227
214 3300028379 Ga0268266_10385007 Ga0268266_103850072 227
215 3300028381 Ga0268264_10219825 Ga0268264_102198251 227
216 3300028381 Ga0268264_10717859 Ga0268264_107178591 227
217 3300035114 Ga0373939_0228028 Ga0373939_0228028_20_703 227
218 3300035121 Ga0373960_0179310 Ga0373960_0179310_26_709 227
219 3300035170 Ga0373943_0126760 Ga0373943_0126760_533_1216 227
220 3300035695 Ga0373927_0208452 Ga0373927_0208452_164_847 227
221 3300035725 Ga0373947_0026525 Ga0373947_0026525_355_1038 227
222 3300035725 Ga0373947_0396060 Ga0373947_0396060_178_861 227
223 3300037068 Ga0373925_0029145 Ga0373925_0029145_2060_2743 227
224 3300037068 Ga0373925_0667354 Ga0373925_0667354_138_821 227
225 3300037312 Ga0395899_0118134 Ga0395899_0118134_180_863 227
226 3300038443 Ga0395901_0891631 Ga0395901_0891631_157_840 227
227 3300046455 Ga0495603_0360633 Ga0495603_0360633_89_772 227
228 3300046472 Ga0495580_0173959 Ga0495580_0173959_289_972 227
229 3300046476 Ga0495662_0097116 Ga0495662_0097116_287_991 227
230 3300046499 Ga0495594_0147015 Ga0495594_0147015_607_1290 227
231 3300046514 Ga0495618_0065587 Ga0495618_0065587_943_1647 227
232 3300046533 Ga0495640_0057987 Ga0495640_0057987_1281_1985 227
233 3300046536 Ga0495587_0133858 Ga0495587_0133858_342_1046 227
234 3300046537 Ga0495598_0145576 Ga0495598_0145576_66_749 227
235 3300046558 Ga0495633_0273408 Ga0495633_0273408_65_748 227
236 3300046663 Ga0495635_0249779 Ga0495635_0249779_280_963 227
237 3300046664 Ga0495659_0138638 Ga0495659_0138638_130_900 227
238 3300046681 Ga0495647_0069599 Ga0495647_0069599_193_897 227
239 3300047315 Ga0495581_0085728 Ga0495581_0085728_32_715 227
240 3300047317 Ga0495604_0055312 Ga0495604_0055312_1411_2115 227
241 3300047319 Ga0495674_0660157 Ga0495674_0660157_108_791 227
242 3300047471 Ga0495684_0042911 Ga0495684_0042911_1711_2415 227
243 3300048088 Ga0495602_0361970 Ga0495602_0361970_23_766 227
244 3300049592 Ga0501076_0752757 Ga0501076_0752757_29_712 227
245 3300049593 Ga0501077_0135066 Ga0501077_0135066_835_1518 227
246 3300050507 nmdc:mga05p37_29404_c1 nmdc:mga05p37_29404_c1_4577_5296 227
247 3300050507 nmdc:mga05p37_991734_c1 nmdc:mga05p37_991734_c1_39_722 227
248 3300050508 nmdc:mga09592_71742_c1 nmdc:mga09592_71742_c1_288_971 227
249 3300050510 nmdc:mga06r32_28067_c1 nmdc:mga06r32_28067_c1_4215_4898 227
250 3300050511 nmdc:mga08y16_75248_c1 nmdc:mga08y16_75248_c1_1735_2505 227
251 3300050512 nmdc:mga0n895_178335_c1 nmdc:mga0n895_178335_c1_232_915 227
252 3300050512 nmdc:mga0n895_202545_c1 nmdc:mga0n895_202545_c1_1239_1952 227
253 3300050512 nmdc:mga0n895_61631_c1 nmdc:mga0n895_61631_c1_1558_2241 227
254 3300050513 nmdc:mga0rr50_32606_c1 nmdc:mga0rr50_32606_c1_2398_3081 227
255 3300050513 nmdc:mga0rr50_460608_c1 nmdc:mga0rr50_460608_c1_274_957 227
256 3300050515 nmdc:mga0a205_34238_c1 nmdc:mga0a205_34238_c1_1055_1738 227
257 3300053077 Ga0495601_0029861 Ga0495601_0029861_1277_1981 227
258 3300053084 Ga0495595_0008974 Ga0495595_0008974_1012_1716 227
259 3300053085 Ga0495619_0064548 Ga0495619_0064548_662_1366 227
260 3300061734 Ga0530510_0487298 Ga0530510_0487298_92_775 227

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03473

MOSC

MOSC domain

83

195

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yhh-assembly1.cif.gz_A crystal structure of yiim from geobacillus stearothermophilus 0.8784 6 208
5yhh-assembly1.cif.gz_A crystal structure of yiim from geobacillus stearothermophilus 0.8568 6 208
1o65-assembly1.cif.gz_A crystal structure of an hypothetical protein 0.8548 2 213
1o65-assembly3.cif.gz_C crystal structure of an hypothetical protein 0.8522 5 213
1o67-assembly2.cif.gz_B crystal structure of an hypothetical protein 0.85 5 213
ID Description Score Start End Superfamily
af_P95151_15_247_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.936 1 208 2.40.33.20
af_Q2FVS9_1_216_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.9087 7 212 2.40.33.20
af_Q2FVS9_1_216_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.8653 7 212 2.40.33.20
af_P95151_15_247_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.8605 1 208 2.40.33.20
5yhiA00 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.843 7 213 2.40.33.20
ID Description Score Start End GO Terms
AF-A0A534QJ83-F1-model_v4 MOSC domain-containing protein 0.9864 100 226 GO:0003824
GO:0030151
GO:0030170
AF-A0A7J9WQH3-F1-model_v4 MOSC domain-containing protein 0.9827 6 208 GO:0003824
GO:0030151
GO:0030170
AF-A0A534QJ83-F1-model_v4 MOSC domain-containing protein 0.9787 100 226 GO:0003824
GO:0030151
GO:0030170
AF-A0A535A8T3-F1-model_v4 MOSC domain-containing protein 0.976 1 121 GO:0003824
GO:0030151
GO:0030170
AF-A0A522Z4G9-F1-model_v4 MOSC domain-containing protein 0.9711 7 152 GO:0003824
GO:0030151
GO:0030170

Feature Viewer

pLDDT pTM Quality
93.58 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map