F369464
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 260 | 159 | 255 | 226 |
Family's Representative Sequence
| Representative Sequence | 3300006844|Ga0075428_100178491|Ga0075428_1001784916 |
| Length | 257 |
| Sequence | MAASARVAYLARRASDYGVETGPVKVNLAQGGEAMARILSVNVGGVREFEYNGRPAKSAIWKSPVAGRIAARGVNLEGDDQADRKAHGGPDKSVYAYAMEDMQWWKEKLRRSLQFGEFGENLTTEGIAVNDALVGERWEIGSAVFEVSEPRIPCWRLGVRMNDQGFVRRFTEALRPGTYLRIIVEGAVAAGDEIRIVERPDHDLTVRDIFRIYTRDRGEAERLLAVPRISESWRGWAQHFLEEMKSRRAGSASPGCC |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 2 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 3 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 4 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 5 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 6 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 30 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 31 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 32 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 33 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 34 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 35 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 36 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 39 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 40 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 41 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 42 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 43 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 44 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 45 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 46 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 47 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 54 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 56 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 93 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 96 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 97 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 98 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 99 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 100 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 101 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 102 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 103 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 104 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 105 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 106 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 107 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 108 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 109 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 110 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 111 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 112 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 113 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 114 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 115 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 141 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 142 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 143 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 144 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 145 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 146 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 149 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 150 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 151 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 152 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 153 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 159 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.08 |
| Metatranscriptomes | 0 |
| Isolates | 1.92 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 1.15 |
| Rhizoplane | 1.92 |
| Rhizosphere | 95.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25407J50210_10057062 | 3300003373 | Bacteria | 983 |
| 2 | JGI25404J52841_10028437 | 3300003659 | Bacteria | 1200 |
| 3 | Ga0070690_100433110 | 3300005330 | Bacteria | 972 |
| 4 | Ga0070670_100343581 | 3300005331 | Unclassified | 1310 |
| 5 | Ga0070689_100014848 | 3300005340 | Bacteria | 5666 |
| 6 | Ga0070692_10303702 | 3300005345 | Viruses | 975 |
| 7 | Ga0070668_100472270 | 3300005347 | Unclassified | 1082 |
| 8 | Ga0070671_100544119 | 3300005355 | Bacteria | 1001 |
| 9 | Ga0070674_100111984 | 3300005356 | Bacteria | 2005 |
| 10 | Ga0070673_100456089 | 3300005364 | Bacteria | 1151 |
| 11 | Ga0070701_10452177 | 3300005438 | Unclassified | 825 |
| 12 | Ga0070708_100001150 | 3300005445 | Bacteria | 20331 |
| 13 | Ga0070708_100011877 | 3300005445 | Bacteria | 7090 |
| 14 | Ga0070708_100028131 | 3300005445 | Bacteria | 4834 |
| 15 | Ga0070708_100030208 | 3300005445 | Bacteria | 4683 |
| 16 | Ga0070708_100037687 | 3300005445 | Bacteria | 4220 |
| 17 | Ga0070708_100060381 | 3300005445 | Bacteria | 3383 |
| 18 | Ga0070708_100089782 | 3300005445 | Bacteria | 2796 |
| 19 | Ga0070708_100230165 | 3300005445 | Bacteria | 1739 |
| 20 | Ga0070678_100025389 | 3300005456 | Bacteria | 3985 |
| 21 | Ga0070662_100292592 | 3300005457 | Unclassified | 1321 |
| 22 | Ga0070706_100000280 | 3300005467 | Bacteria | 62151 |
| 23 | Ga0070706_100001634 | 3300005467 | Bacteria | 23369 |
| 24 | Ga0070706_100002831 | 3300005467 | Bacteria | 17331 |
| 25 | Ga0070706_100027900 | 3300005467 | Bacteria | 5192 |
| 26 | Ga0070706_100028418 | 3300005467 | Archaea | 5148 |
| 27 | Ga0070706_100097793 | 3300005467 | Bacteria | 2727 |
| 28 | Ga0070706_100358095 | 3300005467 | Bacteria | 1360 |
| 29 | Ga0070707_100079643 | 3300005468 | Bacteria | 3162 |
| 30 | Ga0070698_100008361 | 3300005471 | Bacteria | 11184 |
| 31 | Ga0070698_100334501 | 3300005471 | Bacteria | 1446 |
| 32 | Ga0070698_100441318 | 3300005471 | Unclassified | 1237 |
| 33 | Ga0070698_100546201 | 3300005471 | Unclassified | 1098 |
| 34 | Ga0070698_100751996 | 3300005471 | Unclassified | 918 |
| 35 | Ga0070699_100129561 | 3300005518 | Bacteria | 2224 |
| 36 | Ga0070699_100192439 | 3300005518 | Bacteria | 1812 |
| 37 | Ga0070699_100294787 | 3300005518 | Bacteria | 1455 |
| 38 | Ga0070697_100026262 | 3300005536 | Bacteria | 4650 |
| 39 | Ga0070697_100042939 | 3300005536 | Bacteria | 3659 |
| 40 | Ga0070697_100111785 | 3300005536 | Bacteria | 2277 |
| 41 | Ga0070672_100059330 | 3300005543 | Bacteria | 3010 |
| 42 | Ga0070672_100662519 | 3300005543 | Unclassified | 912 |
| 43 | Ga0070693_100320781 | 3300005547 | Bacteria | 1051 |
| 44 | Ga0070665_100127979 | 3300005548 | Bacteria | 2542 |
| 45 | Ga0070665_101362347 | 3300005548 | Bacteria | 719 |
| 46 | Ga0070704_100156129 | 3300005549 | Bacteria | 1800 |
| 47 | Ga0070702_100384574 | 3300005615 | Unclassified | 999 |
| 48 | Ga0068864_100151772 | 3300005618 | Bacteria | 2099 |
| 49 | Ga0068864_100422378 | 3300005618 | Bacteria | 1271 |
| 50 | Ga0068861_100226007 | 3300005719 | Bacteria | 1585 |
| 51 | Ga0068863_100002065 | 3300005841 | Bacteria | 19913 |
| 52 | Ga0068863_100027208 | 3300005841 | Bacteria | 5453 |
| 53 | Ga0068863_100211980 | 3300005841 | Bacteria | 1865 |
| 54 | Ga0068863_100221910 | 3300005841 | Unclassified | 1821 |
| 55 | Ga0068863_100601590 | 3300005841 | Bacteria | 1088 |
| 56 | Ga0068858_100111532 | 3300005842 | Bacteria | 2554 |
| 57 | Ga0081455_10017012 | 3300005937 | Bacteria | 6990 |
| 58 | Ga0081455_10290974 | 3300005937 | Unclassified | 1176 |
| 59 | Ga0081455_10327914 | 3300005937 | Bacteria | 1088 |
| 60 | Ga0081538_10014682 | 3300005981 | Bacteria | 6116 |
| 61 | Ga0081538_10094733 | 3300005981 | Bacteria | 1528 |
| 62 | Ga0081540_1000085 | 3300005983 | Bacteria | 99716 |
| 63 | Ga0070716_100329497 | 3300006173 | Unclassified | 1073 |
| 64 | Ga0070712_100187672 | 3300006175 | Bacteria | 1615 |
| 65 | Ga0075428_100023711 | 3300006844 | Bacteria | 6791 |
| 66 | Ga0075428_100162283 | 3300006844 | Bacteria | 2425 |
| 67 | Ga0075428_100178491 | 3300006844 | Bacteria | 2299 |
| 68 | Ga0075428_100217174 | 3300006844 | Unclassified | 2065 |
| 69 | Ga0075431_100287032 | 3300006847 | Unclassified | 1665 |
| 70 | Ga0075431_100392940 | 3300006847 | Bacteria | 1389 |
| 71 | Ga0075433_10000475 | 3300006852 | Bacteria | 26124 |
| 72 | Ga0075433_10029002 | 3300006852 | Bacteria | 4710 |
| 73 | Ga0075434_100001631 | 3300006871 | Bacteria | 19094 |
| 74 | Ga0075434_100045236 | 3300006871 | Bacteria | 4367 |
| 75 | Ga0075434_100113241 | 3300006871 | Unclassified | 2725 |
| 76 | Ga0075434_100245438 | 3300006871 | Bacteria | 1810 |
| 77 | Ga0075434_100555641 | 3300006871 | Bacteria | 1167 |
| 78 | Ga0068865_100290503 | 3300006881 | Unclassified | 1305 |
| 79 | Ga0075436_100002220 | 3300006914 | Bacteria | 13406 |
| 80 | Ga0075435_100032383 | 3300007076 | Bacteria | 4128 |
| 81 | Ga0075435_100042332 | 3300007076 | Bacteria | 3643 |
| 82 | Ga0075435_100124072 | 3300007076 | Bacteria | 2157 |
| 83 | Ga0075435_100750694 | 3300007076 | Bacteria | 849 |
| 84 | Ga0099794_10010478 | 3300007265 | Bacteria | 3937 |
| 85 | Ga0099794_10022446 | 3300007265 | Unclassified | 2877 |
| 86 | Ga0099795_10108875 | 3300007788 | Bacteria | 1096 |
| 87 | Ga0111539_10058257 | 3300009094 | Bacteria | 4583 |
| 88 | Ga0111539_10118681 | 3300009094 | Bacteria | 3100 |
| 89 | Ga0111539_10133450 | 3300009094 | Bacteria | 2907 |
| 90 | Ga0105247_10097719 | 3300009101 | Bacteria | 1873 |
| 91 | Ga0114129_10079123 | 3300009147 | Unclassified | 4571 |
| 92 | Ga0114129_10288981 | 3300009147 | Unclassified | 2188 |
| 93 | Ga0114129_10745948 | 3300009147 | Unclassified | 1254 |
| 94 | Ga0114129_10768793 | 3300009147 | Unclassified | 1232 |
| 95 | Ga0105241_10150612 | 3300009174 | Bacteria | 1903 |
| 96 | Ga0105248_10210707 | 3300009177 | Unclassified | 2189 |
| 97 | Ga0105248_10219138 | 3300009177 | Unclassified | 2143 |
| 98 | Ga0105248_10411995 | 3300009177 | Bacteria | 1522 |
| 99 | Ga0105248_11154553 | 3300009177 | Bacteria | 876 |
| 100 | Ga0105249_10152493 | 3300009553 | Bacteria | 2226 |
| 101 | Ga0099796_10158903 | 3300010159 | Unclassified | 895 |
| 102 | Ga0105246_10272060 | 3300011119 | Bacteria | 1355 |
| 103 | Ga0157316_1001889 | 3300012510 | Unclassified | 1363 |
| 104 | Ga0157374_10288846 | 3300013296 | Bacteria | 1620 |
| 105 | Ga0157378_10059835 | 3300013297 | Bacteria | 3399 |
| 106 | Ga0157378_10062279 | 3300013297 | Bacteria | 3331 |
| 107 | Ga0163162_10200644 | 3300013306 | Bacteria | 2123 |
| 108 | Ga0163162_10225204 | 3300013306 | Bacteria | 2005 |
| 109 | Ga0163162_10641103 | 3300013306 | Bacteria | 1186 |
| 110 | Ga0157375_10161103 | 3300013308 | Bacteria | 2385 |
| 111 | Ga0157375_10173027 | 3300013308 | Unclassified | 2308 |
| 112 | Ga0163163_10384787 | 3300014325 | Unclassified | 1460 |
| 113 | Ga0157380_10377787 | 3300014326 | Bacteria | 1336 |
| 114 | Ga0157379_10787296 | 3300014968 | Bacteria | 897 |
| 115 | Ga0163161_10220153 | 3300017792 | Unclassified | 1470 |
| 116 | Ga0207682_10009009 | 3300025893 | Bacteria | 3943 |
| 117 | Ga0207692_10152679 | 3300025898 | Bacteria | 1324 |
| 118 | Ga0207684_10000017 | 3300025910 | Bacteria | 385006 |
| 119 | Ga0207684_10000091 | 3300025910 | Bacteria | 170468 |
| 120 | Ga0207684_10002382 | 3300025910 | Bacteria | 19020 |
| 121 | Ga0207684_10026799 | 3300025910 | Bacteria | 4914 |
| 122 | Ga0207684_10118135 | 3300025910 | Bacteria | 2272 |
| 123 | Ga0207684_10118414 | 3300025910 | Bacteria | 2269 |
| 124 | Ga0207684_10159644 | 3300025910 | Unclassified | 1941 |
| 125 | Ga0207684_10576768 | 3300025910 | Bacteria | 962 |
| 126 | Ga0207654_10154268 | 3300025911 | Bacteria | 1477 |
| 127 | Ga0207707_10436829 | 3300025912 | Bacteria | 1121 |
| 128 | Ga0207646_10012998 | 3300025922 | Bacteria | 7978 |
| 129 | Ga0207646_10076593 | 3300025922 | Unclassified | 2989 |
| 130 | Ga0207646_10136322 | 3300025922 | Unclassified | 2210 |
| 131 | Ga0207650_10409434 | 3300025925 | Unclassified | 1124 |
| 132 | Ga0207659_10076346 | 3300025926 | Unclassified | 2462 |
| 133 | Ga0207659_10443549 | 3300025926 | Unclassified | 1092 |
| 134 | Ga0207670_10051415 | 3300025936 | Bacteria | 2766 |
| 135 | Ga0207669_10048412 | 3300025937 | Unclassified | 2525 |
| 136 | Ga0207704_10033408 | 3300025938 | Unclassified | 2925 |
| 137 | Ga0207704_10198296 | 3300025938 | Unclassified | 1467 |
| 138 | Ga0207665_10206113 | 3300025939 | Bacteria | 1434 |
| 139 | Ga0207691_10032512 | 3300025940 | Bacteria | 4863 |
| 140 | Ga0207711_10166151 | 3300025941 | Unclassified | 2000 |
| 141 | Ga0207651_10323043 | 3300025960 | Bacteria | 1291 |
| 142 | Ga0207668_10584987 | 3300025972 | Unclassified | 971 |
| 143 | Ga0207640_10207222 | 3300025981 | Unclassified | 1491 |
| 144 | Ga0207658_10472127 | 3300025986 | Bacteria | 1113 |
| 145 | Ga0207703_10354576 | 3300026035 | Unclassified | 1351 |
| 146 | Ga0207678_10098377 | 3300026067 | Bacteria | 2500 |
| 147 | Ga0207678_10108703 | 3300026067 | Bacteria | 2366 |
| 148 | Ga0207708_10057647 | 3300026075 | Bacteria | 2963 |
| 149 | Ga0207708_10102296 | 3300026075 | Bacteria | 2218 |
| 150 | Ga0207708_10191967 | 3300026075 | Unclassified | 1626 |
| 151 | Ga0207702_10054131 | 3300026078 | Bacteria | 3399 |
| 152 | Ga0207641_10014445 | 3300026088 | Bacteria | 6469 |
| 153 | Ga0207641_10022400 | 3300026088 | Bacteria | 5201 |
| 154 | Ga0207641_10104600 | 3300026088 | Bacteria | 2500 |
| 155 | Ga0207648_10033648 | 3300026089 | Bacteria | 4520 |
| 156 | Ga0207648_10176104 | 3300026089 | Bacteria | 1892 |
| 157 | Ga0207676_10438326 | 3300026095 | Bacteria | 1229 |
| 158 | Ga0207675_100042156 | 3300026118 | Unclassified | 4260 |
| 159 | Ga0209588_1005819 | 3300027671 | Bacteria | 3551 |
| 160 | Ga0209588_1028092 | 3300027671 | Bacteria | 1790 |
| 161 | Ga0209974_10000567 | 3300027876 | Bacteria | 12352 |
| 162 | Ga0207428_10121345 | 3300027907 | Bacteria | 2004 |
| 163 | Ga0268266_10380704 | 3300028379 | Unclassified | 1331 |
| 164 | Ga0268266_10385007 | 3300028379 | Unclassified | 1323 |
| 165 | Ga0268266_10828329 | 3300028379 | Unclassified | 894 |
| 166 | Ga0268264_10219825 | 3300028381 | Bacteria | 1748 |
| 167 | Ga0268264_10323191 | 3300028381 | Bacteria | 1460 |
| 168 | Ga0268264_10717859 | 3300028381 | Unclassified | 994 |
| 169 | Ga0265330_10018657 | 3300031235 | Bacteria | 3185 |
| 170 | Ga0265332_10021851 | 3300031238 | Bacteria | 2825 |
| 171 | Ga0265328_10007800 | 3300031239 | Bacteria | 4449 |
| 172 | Ga0265329_10036050 | 3300031242 | Bacteria | 1596 |
| 173 | Ga0265339_10246226 | 3300031249 | Unclassified | 866 |
| 174 | Ga0265316_10019835 | 3300031344 | Bacteria | 5740 |
| 175 | Ga0373939_0228028 | 3300035114 | Unclassified | 716 |
| 176 | Ga0373960_0179310 | 3300035121 | Unclassified | 739 |
| 177 | Ga0373943_0126760 | 3300035170 | Bacteria | 1362 |
| 178 | Ga0373927_0208452 | 3300035695 | Bacteria | 1284 |
| 179 | Ga0373947_0026525 | 3300035725 | Bacteria | 3388 |
| 180 | Ga0373947_0396060 | 3300035725 | Unclassified | 931 |
| 181 | Ga0373937_0288096 | 3300036401 | Bacteria | 1551 |
| 182 | Ga0373925_0029145 | 3300037068 | Bacteria | 4049 |
| 183 | Ga0373925_0667354 | 3300037068 | Unclassified | 857 |
| 184 | Ga0395899_0118134 | 3300037312 | Bacteria | 1902 |
| 185 | Ga0395901_0891631 | 3300038443 | Unclassified | 872 |
| 186 | Ga0439455_0021232 | 3300042012 | Bacteria | 1546 |
| 187 | Ga0451577_0016319 | 3300042876 | Bacteria | 6881 |
| 188 | Ga0453683_0002290 | 3300044673 | Bacteria | 15099 |
| 189 | Ga0453684_0158341 | 3300044712 | Bacteria | 2681 |
| 190 | Ga0451576_1141345 | 3300045051 | Unclassified | 815 |
| 191 | Ga0495603_0360633 | 3300046455 | Unclassified | 834 |
| 192 | Ga0495653_0123787 | 3300046463 | Bacteria | 1839 |
| 193 | Ga0495580_0004163 | 3300046472 | Bacteria | 12162 |
| 194 | Ga0495580_0007376 | 3300046472 | Bacteria | 8844 |
| 195 | Ga0495580_0173959 | 3300046472 | Bacteria | 1487 |
| 196 | Ga0495662_0097116 | 3300046476 | Bacteria | 1440 |
| 197 | Ga0495664_0002950 | 3300046477 | Bacteria | 9190 |
| 198 | Ga0495585_0108356 | 3300046492 | Bacteria | 1480 |
| 199 | Ga0495594_0147015 | 3300046499 | Bacteria | 1338 |
| 200 | Ga0495616_0251123 | 3300046513 | Unclassified | 760 |
| 201 | Ga0495618_0065587 | 3300046514 | Bacteria | 2308 |
| 202 | Ga0495628_0000545 | 3300046516 | Bacteria | 34592 |
| 203 | Ga0495663_0075101 | 3300046525 | Unclassified | 1081 |
| 204 | Ga0495640_0057987 | 3300046533 | Bacteria | 2642 |
| 205 | Ga0495587_0133858 | 3300046536 | Bacteria | 1416 |
| 206 | Ga0495598_0145576 | 3300046537 | Unclassified | 823 |
| 207 | Ga0495633_0273408 | 3300046558 | Unclassified | 769 |
| 208 | Ga0495635_0172903 | 3300046663 | Unclassified | 1469 |
| 209 | Ga0495635_0249779 | 3300046663 | Unclassified | 1196 |
| 210 | Ga0495659_0138638 | 3300046664 | Unclassified | 969 |
| 211 | Ga0495623_0140712 | 3300046679 | Unclassified | 1436 |
| 212 | Ga0495647_0069599 | 3300046681 | Unclassified | 1406 |
| 213 | Ga0495589_0092821 | 3300046794 | Bacteria | 1465 |
| 214 | Ga0495581_0085728 | 3300047315 | Bacteria | 1826 |
| 215 | Ga0495604_0055312 | 3300047317 | Bacteria | 3059 |
| 216 | Ga0495604_0105009 | 3300047317 | Bacteria | 2069 |
| 217 | Ga0495674_0660157 | 3300047319 | Unclassified | 824 |
| 218 | Ga0495684_0004596 | 3300047471 | Bacteria | 10783 |
| 219 | Ga0495684_0042911 | 3300047471 | Bacteria | 3463 |
| 220 | Ga0495602_0361970 | 3300048088 | Bacteria | 1044 |
| 221 | Ga0496100_0107436 | 3300048903 | Bacteria | 1933 |
| 222 | Ga0496102_0001241 | 3300048905 | Bacteria | 23069 |
| 223 | Ga0496103_0017906 | 3300048906 | Bacteria | 4245 |
| 224 | Ga0496106_0589771 | 3300048909 | Unclassified | 890 |
| 225 | Ga0496107_0014427 | 3300048910 | Bacteria | 5533 |
| 226 | Ga0496126_0746574 | 3300048929 | Bacteria | 756 |
| 227 | Ga0501076_0752757 | 3300049592 | Bacteria | 804 |
| 228 | Ga0501077_0135066 | 3300049593 | Bacteria | 1564 |
| 229 | nmdc:mga05p37_29404_c1 | 3300050507 | Bacteria | 6705 |
| 230 | nmdc:mga05p37_991734_c1 | 3300050507 | Bacteria | 894 |
| 231 | nmdc:mga09592_71742_c1 | 3300050508 | Bacteria | 2940 |
| 232 | nmdc:mga06r32_161903_c1 | 3300050510 | Bacteria | 1845 |
| 233 | nmdc:mga06r32_28067_c1 | 3300050510 | Bacteria | 5264 |
| 234 | nmdc:mga06r32_287659_c1 | 3300050510 | Bacteria | 1630 |
| 235 | nmdc:mga08y16_198905_c1 | 3300050511 | Bacteria | 2077 |
| 236 | nmdc:mga08y16_75248_c1 | 3300050511 | Bacteria | 3520 |
| 237 | nmdc:mga0n895_1057016_c1 | 3300050512 | Bacteria | 791 |
| 238 | nmdc:mga0n895_110362_c1 | 3300050512 | Unclassified | 2767 |
| 239 | nmdc:mga0n895_178335_c1 | 3300050512 | Bacteria | 2156 |
| 240 | nmdc:mga0n895_202545_c1 | 3300050512 | Unclassified | 2015 |
| 241 | nmdc:mga0n895_57069_c1 | 3300050512 | Bacteria | 3848 |
| 242 | nmdc:mga0n895_61631_c1 | 3300050512 | Bacteria | 3704 |
| 243 | nmdc:mga0rr50_22263_c1 | 3300050513 | Bacteria | 4346 |
| 244 | nmdc:mga0rr50_32606_c1 | 3300050513 | Bacteria | 3714 |
| 245 | nmdc:mga0rr50_34240_c1 | 3300050513 | Bacteria | 3636 |
| 246 | nmdc:mga0rr50_460608_c1 | 3300050513 | Unclassified | 1078 |
| 247 | nmdc:mga0a205_284801_c1 | 3300050515 | Bacteria | 1527 |
| 248 | nmdc:mga0a205_2997_c1 | 3300050515 | Bacteria | 14965 |
| 249 | nmdc:mga0a205_34238_c1 | 3300050515 | Bacteria | 4874 |
| 250 | nmdc:mga0a205_6416_c1 | 3300050515 | Bacteria | 10630 |
| 251 | Ga0495601_0029861 | 3300053077 | Bacteria | 3384 |
| 252 | Ga0495595_0008974 | 3300053084 | Bacteria | 4124 |
| 253 | Ga0495619_0064548 | 3300053085 | Bacteria | 2441 |
| 254 | Ga0530510_0448664 | 3300061734 | Bacteria | 975 |
| 255 | Ga0530510_0487298 | 3300061734 | Bacteria | 934 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048929 | Ga0496126_0746574 | Ga0496126_0746574_109_696 | 195 |
| 2 | 3300025910 | Ga0207684_10159644 | Ga0207684_101596442 | 200 |
| 3 | 3300005467 | Ga0070706_100358095 | Ga0070706_1003580952 | 204 |
| 4 | 3300009094 | Ga0111539_10058257 | Ga0111539_100582574 | 206 |
| 5 | 3300005937 | Ga0081455_10327914 | Ga0081455_103279142 | 210 |
| 6 | 3300025960 | Ga0207651_10323043 | Ga0207651_103230432 | 210 |
| 7 | 3300046513 | Ga0495616_0251123 | Ga0495616_0251123_41_682 | 210 |
| 8 | 3300046525 | Ga0495663_0075101 | Ga0495663_0075101_325_966 | 210 |
| 9 | 3300046794 | Ga0495589_0092821 | Ga0495589_0092821_786_1427 | 210 |
| 10 | 3300050510 | nmdc:mga06r32_287659_c1 | nmdc:mga06r32_287659_c1_971_1609 | 212 |
| 11 | 3300025912 | Ga0207707_10436829 | Ga0207707_104368291 | 213 |
| 12 | 3300046472 | Ga0495580_0004163 | Ga0495580_0004163_10638_11279 | 213 |
| 13 | 3300048905 | Ga0496102_0001241 | Ga0496102_0001241_17461_18120 | 213 |
| 14 | 3300048906 | Ga0496103_0017906 | Ga0496103_0017906_314_973 | 213 |
| 15 | 3300061734 | Ga0530510_0448664 | Ga0530510_0448664_71_712 | 213 |
| 16 | 3300009147 | Ga0114129_10768793 | Ga0114129_107687932 | 214 |
| 17 | 3300042012 | Ga0439455_0021232 | Ga0439455_0021232_766_1410 | 214 |
| 18 | 3300005445 | Ga0070708_100001150 | Ga0070708_10000115017 | 215 |
| 19 | 3300006852 | Ga0075433_10000475 | Ga0075433_1000047522 | 215 |
| 20 | 3300006871 | Ga0075434_100001631 | Ga0075434_10000163113 | 215 |
| 21 | 3300007265 | Ga0099794_10010478 | Ga0099794_100104782 | 215 |
| 22 | 3300009177 | Ga0105248_10411995 | Ga0105248_104119952 | 215 |
| 23 | 3300050512 | nmdc:mga0n895_110362_c1 | nmdc:mga0n895_110362_c1_1493_2143 | 215 |
| 24 | 3300050515 | nmdc:mga0a205_2997_c1 | nmdc:mga0a205_2997_c1_4152_4802 | 215 |
| 25 | 3300006844 | Ga0075428_100023711 | Ga0075428_1000237115 | 216 |
| 26 | 3300006847 | Ga0075431_100287032 | Ga0075431_1002870322 | 216 |
| 27 | 3300007265 | Ga0099794_10022446 | Ga0099794_100224464 | 216 |
| 28 | 3300027671 | Ga0209588_1005819 | Ga0209588_10058194 | 216 |
| 29 | 3300027671 | Ga0209588_1028092 | Ga0209588_10280922 | 216 |
| 30 | 3300050510 | nmdc:mga06r32_161903_c1 | nmdc:mga06r32_161903_c1_1182_1832 | 216 |
| 31 | 3300050511 | nmdc:mga08y16_198905_c1 | nmdc:mga08y16_198905_c1_83_733 | 216 |
| 32 | 3300006871 | Ga0075434_100045236 | Ga0075434_1000452365 | 217 |
| 33 | 3300007076 | Ga0075435_100042332 | Ga0075435_1000423322 | 217 |
| 34 | 3300042876 | Ga0451577_0016319 | Ga0451577_0016319_5689_6342 | 217 |
| 35 | 3300044712 | Ga0453684_0158341 | Ga0453684_0158341_955_1608 | 217 |
| 36 | 3300050512 | nmdc:mga0n895_57069_c1 | nmdc:mga0n895_57069_c1_457_1116 | 217 |
| 37 | 3300050513 | nmdc:mga0rr50_34240_c1 | nmdc:mga0rr50_34240_c1_249_908 | 217 |
| 38 | 3300005445 | Ga0070708_100011877 | Ga0070708_1000118772 | 219 |
| 39 | 3300005445 | Ga0070708_100028131 | Ga0070708_1000281313 | 219 |
| 40 | 3300005445 | Ga0070708_100060381 | Ga0070708_1000603812 | 219 |
| 41 | 3300005467 | Ga0070706_100000280 | Ga0070706_10000028017 | 219 |
| 42 | 3300005467 | Ga0070706_100097793 | Ga0070706_1000977933 | 219 |
| 43 | 3300005471 | Ga0070698_100546201 | Ga0070698_1005462012 | 219 |
| 44 | 3300005518 | Ga0070699_100129561 | Ga0070699_1001295612 | 219 |
| 45 | 3300006847 | Ga0075431_100392940 | Ga0075431_1003929402 | 219 |
| 46 | 3300007788 | Ga0099795_10108875 | Ga0099795_101088752 | 219 |
| 47 | 3300009147 | Ga0114129_10079123 | Ga0114129_100791235 | 219 |
| 48 | 3300009147 | Ga0114129_10288981 | Ga0114129_102889812 | 219 |
| 49 | 3300010159 | Ga0099796_10158903 | Ga0099796_101589032 | 219 |
| 50 | 3300025910 | Ga0207684_10000017 | Ga0207684_1000001753 | 219 |
| 51 | 3300025910 | Ga0207684_10576768 | Ga0207684_105767681 | 219 |
| 52 | 3300025922 | Ga0207646_10012998 | Ga0207646_100129987 | 219 |
| 53 | 3300050512 | nmdc:mga0n895_1057016_c1 | nmdc:mga0n895_1057016_c1_58_717 | 219 |
| 54 | 3300050515 | nmdc:mga0a205_284801_c1 | nmdc:mga0a205_284801_c1_358_1017 | 219 |
| 55 | iso_pu_bacteria | 2579778521 | 2579852528 | 219 |
| 56 | iso_pu_bacteria | 2619618881 | 2619856393 | 219 |
| 57 | iso_pu_bacteria | 2619619003 | 2620348000 | 219 |
| 58 | iso_pu_bacteria | 2626541554 | 2626638526 | 219 |
| 59 | iso_pu_bacteria | 8054913762 | 8054920598 | 219 |
| 60 | 3300028379 | Ga0268266_10380704 | Ga0268266_103807042 | 222 |
| 61 | 3300046477 | Ga0495664_0002950 | Ga0495664_0002950_326_1228 | 222 |
| 62 | 3300046492 | Ga0495585_0108356 | Ga0495585_0108356_52_735 | 222 |
| 63 | 3300005340 | Ga0070689_100014848 | Ga0070689_1000148485 | 223 |
| 64 | 3300005543 | Ga0070672_100059330 | Ga0070672_1000593301 | 223 |
| 65 | 3300005549 | Ga0070704_100156129 | Ga0070704_1001561291 | 223 |
| 66 | 3300005618 | Ga0068864_100422378 | Ga0068864_1004223781 | 223 |
| 67 | 3300005841 | Ga0068863_100211980 | Ga0068863_1002119802 | 223 |
| 68 | 3300005842 | Ga0068858_100111532 | Ga0068858_1001115322 | 223 |
| 69 | 3300005937 | Ga0081455_10017012 | Ga0081455_100170125 | 223 |
| 70 | 3300006852 | Ga0075433_10029002 | Ga0075433_100290025 | 223 |
| 71 | 3300007076 | Ga0075435_100124072 | Ga0075435_1001240722 | 223 |
| 72 | 3300009094 | Ga0111539_10118681 | Ga0111539_101186812 | 223 |
| 73 | 3300009094 | Ga0111539_10133450 | Ga0111539_101334502 | 223 |
| 74 | 3300009174 | Ga0105241_10150612 | Ga0105241_101506122 | 223 |
| 75 | 3300009177 | Ga0105248_11154553 | Ga0105248_111545531 | 223 |
| 76 | 3300014968 | Ga0157379_10787296 | Ga0157379_107872961 | 223 |
| 77 | 3300025911 | Ga0207654_10154268 | Ga0207654_101542682 | 223 |
| 78 | 3300025936 | Ga0207670_10051415 | Ga0207670_100514152 | 223 |
| 79 | 3300025986 | Ga0207658_10472127 | Ga0207658_104721271 | 223 |
| 80 | 3300026067 | Ga0207678_10108703 | Ga0207678_101087032 | 223 |
| 81 | 3300026078 | Ga0207702_10054131 | Ga0207702_100541312 | 223 |
| 82 | 3300026089 | Ga0207648_10176104 | Ga0207648_101761042 | 223 |
| 83 | 3300026095 | Ga0207676_10438326 | Ga0207676_104383261 | 223 |
| 84 | 3300028381 | Ga0268264_10323191 | Ga0268264_103231911 | 223 |
| 85 | 3300036401 | Ga0373937_0288096 | Ga0373937_0288096_224_898 | 223 |
| 86 | 3300044673 | Ga0453683_0002290 | Ga0453683_0002290_13134_13805 | 223 |
| 87 | 3300045051 | Ga0451576_1141345 | Ga0451576_1141345_56_727 | 223 |
| 88 | 3300048903 | Ga0496100_0107436 | Ga0496100_0107436_250_921 | 223 |
| 89 | 3300048909 | Ga0496106_0589771 | Ga0496106_0589771_138_809 | 223 |
| 90 | 3300048910 | Ga0496107_0014427 | Ga0496107_0014427_2602_3273 | 223 |
| 91 | 3300050513 | nmdc:mga0rr50_22263_c1 | nmdc:mga0rr50_22263_c1_2131_2802 | 223 |
| 92 | 3300050515 | nmdc:mga0a205_6416_c1 | nmdc:mga0a205_6416_c1_1736_2407 | 223 |
| 93 | 3300005548 | Ga0070665_101362347 | Ga0070665_1013623471 | 224 |
| 94 | 3300009177 | Ga0105248_10219138 | Ga0105248_102191382 | 224 |
| 95 | 3300028379 | Ga0268266_10828329 | Ga0268266_108283291 | 224 |
| 96 | 3300005364 | Ga0070673_100456089 | Ga0070673_1004560891 | 225 |
| 97 | 3300005547 | Ga0070693_100320781 | Ga0070693_1003207812 | 225 |
| 98 | 3300005618 | Ga0068864_100151772 | Ga0068864_1001517723 | 225 |
| 99 | 3300005841 | Ga0068863_100002065 | Ga0068863_1000020656 | 225 |
| 100 | 3300005841 | Ga0068863_100601590 | Ga0068863_1006015902 | 225 |
| 101 | 3300006173 | Ga0070716_100329497 | Ga0070716_1003294971 | 225 |
| 102 | 3300006175 | Ga0070712_100187672 | Ga0070712_1001876721 | 225 |
| 103 | 3300025898 | Ga0207692_10152679 | Ga0207692_101526792 | 225 |
| 104 | 3300026088 | Ga0207641_10014445 | Ga0207641_100144456 | 225 |
| 105 | 3300026088 | Ga0207641_10104600 | Ga0207641_101046002 | 225 |
| 106 | 3300031235 | Ga0265330_10018657 | Ga0265330_100186576 | 225 |
| 107 | 3300031238 | Ga0265332_10021851 | Ga0265332_100218513 | 225 |
| 108 | 3300031239 | Ga0265328_10007800 | Ga0265328_100078002 | 225 |
| 109 | 3300031242 | Ga0265329_10036050 | Ga0265329_100360502 | 225 |
| 110 | 3300031249 | Ga0265339_10246226 | Ga0265339_102462261 | 225 |
| 111 | 3300031344 | Ga0265316_10019835 | Ga0265316_100198353 | 225 |
| 112 | 3300046463 | Ga0495653_0123787 | Ga0495653_0123787_630_1307 | 225 |
| 113 | 3300046516 | Ga0495628_0000545 | Ga0495628_0000545_33001_33684 | 225 |
| 114 | 3300046663 | Ga0495635_0172903 | Ga0495635_0172903_743_1420 | 225 |
| 115 | 3300046679 | Ga0495623_0140712 | Ga0495623_0140712_141_818 | 225 |
| 116 | 3300047317 | Ga0495604_0105009 | Ga0495604_0105009_1162_1839 | 225 |
| 117 | 3300047471 | Ga0495684_0004596 | Ga0495684_0004596_9535_10218 | 225 |
| 118 | 3300005330 | Ga0070690_100433110 | Ga0070690_1004331102 | 226 |
| 119 | 3300005345 | Ga0070692_10303702 | Ga0070692_103037021 | 226 |
| 120 | 3300005356 | Ga0070674_100111984 | Ga0070674_1001119842 | 226 |
| 121 | 3300005445 | Ga0070708_100230165 | Ga0070708_1002301653 | 226 |
| 122 | 3300005456 | Ga0070678_100025389 | Ga0070678_1000253893 | 226 |
| 123 | 3300005457 | Ga0070662_100292592 | Ga0070662_1002925921 | 226 |
| 124 | 3300005471 | Ga0070698_100334501 | Ga0070698_1003345011 | 226 |
| 125 | 3300005471 | Ga0070698_100751996 | Ga0070698_1007519961 | 226 |
| 126 | 3300013306 | Ga0163162_10641103 | Ga0163162_106411032 | 226 |
| 127 | 3300013308 | Ga0157375_10173027 | Ga0157375_101730272 | 226 |
| 128 | 3300014325 | Ga0163163_10384787 | Ga0163163_103847872 | 226 |
| 129 | 3300017792 | Ga0163161_10220153 | Ga0163161_102201532 | 226 |
| 130 | 3300025893 | Ga0207682_10009009 | Ga0207682_100090092 | 226 |
| 131 | 3300025926 | Ga0207659_10076346 | Ga0207659_100763462 | 226 |
| 132 | 3300025937 | Ga0207669_10048412 | Ga0207669_100484123 | 226 |
| 133 | 3300025938 | Ga0207704_10033408 | Ga0207704_100334083 | 226 |
| 134 | 3300025940 | Ga0207691_10032512 | Ga0207691_100325122 | 226 |
| 135 | 3300025981 | Ga0207640_10207222 | Ga0207640_102072222 | 226 |
| 136 | 3300026067 | Ga0207678_10098377 | Ga0207678_100983773 | 226 |
| 137 | 3300026075 | Ga0207708_10191967 | Ga0207708_101919673 | 226 |
| 138 | 3300026089 | Ga0207648_10033648 | Ga0207648_100336485 | 226 |
| 139 | 3300026118 | Ga0207675_100042156 | Ga0207675_1000421562 | 226 |
| 140 | 3300046472 | Ga0495580_0007376 | Ga0495580_0007376_701_1381 | 226 |
| 141 | 3300003373 | JGI25407J50210_10057062 | JGI25407J50210_100570621 | 227 |
| 142 | 3300003659 | JGI25404J52841_10028437 | JGI25404J52841_100284372 | 227 |
| 143 | 3300005331 | Ga0070670_100343581 | Ga0070670_1003435812 | 227 |
| 144 | 3300005347 | Ga0070668_100472270 | Ga0070668_1004722702 | 227 |
| 145 | 3300005355 | Ga0070671_100544119 | Ga0070671_1005441192 | 227 |
| 146 | 3300005438 | Ga0070701_10452177 | Ga0070701_104521771 | 227 |
| 147 | 3300005445 | Ga0070708_100030208 | Ga0070708_1000302084 | 227 |
| 148 | 3300005445 | Ga0070708_100037687 | Ga0070708_1000376874 | 227 |
| 149 | 3300005445 | Ga0070708_100089782 | Ga0070708_1000897823 | 227 |
| 150 | 3300005467 | Ga0070706_100001634 | Ga0070706_10000163412 | 227 |
| 151 | 3300005467 | Ga0070706_100002831 | Ga0070706_10000283117 | 227 |
| 152 | 3300005467 | Ga0070706_100027900 | Ga0070706_1000279005 | 227 |
| 153 | 3300005467 | Ga0070706_100028418 | Ga0070706_1000284182 | 227 |
| 154 | 3300005468 | Ga0070707_100079643 | Ga0070707_1000796433 | 227 |
| 155 | 3300005471 | Ga0070698_100008361 | Ga0070698_1000083614 | 227 |
| 156 | 3300005471 | Ga0070698_100441318 | Ga0070698_1004413181 | 227 |
| 157 | 3300005518 | Ga0070699_100192439 | Ga0070699_1001924392 | 227 |
| 158 | 3300005518 | Ga0070699_100294787 | Ga0070699_1002947872 | 227 |
| 159 | 3300005536 | Ga0070697_100026262 | Ga0070697_1000262625 | 227 |
| 160 | 3300005536 | Ga0070697_100042939 | Ga0070697_1000429396 | 227 |
| 161 | 3300005536 | Ga0070697_100111785 | Ga0070697_1001117853 | 227 |
| 162 | 3300005543 | Ga0070672_100662519 | Ga0070672_1006625191 | 227 |
| 163 | 3300005548 | Ga0070665_100127979 | Ga0070665_1001279793 | 227 |
| 164 | 3300005615 | Ga0070702_100384574 | Ga0070702_1003845741 | 227 |
| 165 | 3300005719 | Ga0068861_100226007 | Ga0068861_1002260071 | 227 |
| 166 | 3300005841 | Ga0068863_100027208 | Ga0068863_1000272083 | 227 |
| 167 | 3300005841 | Ga0068863_100221910 | Ga0068863_1002219102 | 227 |
| 168 | 3300005937 | Ga0081455_10290974 | Ga0081455_102909742 | 227 |
| 169 | 3300005981 | Ga0081538_10014682 | Ga0081538_100146827 | 227 |
| 170 | 3300005981 | Ga0081538_10094733 | Ga0081538_100947331 | 227 |
| 171 | 3300005983 | Ga0081540_1000085 | Ga0081540_100008586 | 227 |
| 172 | 3300006844 | Ga0075428_100162283 | Ga0075428_1001622833 | 227 |
| 173 | 3300006844 | Ga0075428_100178491 | Ga0075428_1001784916 | 227 |
| 174 | 3300006844 | Ga0075428_100217174 | Ga0075428_1002171744 | 227 |
| 175 | 3300006871 | Ga0075434_100113241 | Ga0075434_1001132412 | 227 |
| 176 | 3300006871 | Ga0075434_100245438 | Ga0075434_1002454382 | 227 |
| 177 | 3300006871 | Ga0075434_100555641 | Ga0075434_1005556412 | 227 |
| 178 | 3300006881 | Ga0068865_100290503 | Ga0068865_1002905032 | 227 |
| 179 | 3300006914 | Ga0075436_100002220 | Ga0075436_10000222010 | 227 |
| 180 | 3300007076 | Ga0075435_100032383 | Ga0075435_1000323832 | 227 |
| 181 | 3300007076 | Ga0075435_100750694 | Ga0075435_1007506942 | 227 |
| 182 | 3300009101 | Ga0105247_10097719 | Ga0105247_100977191 | 227 |
| 183 | 3300009147 | Ga0114129_10745948 | Ga0114129_107459482 | 227 |
| 184 | 3300009177 | Ga0105248_10210707 | Ga0105248_102107072 | 227 |
| 185 | 3300009553 | Ga0105249_10152493 | Ga0105249_101524932 | 227 |
| 186 | 3300011119 | Ga0105246_10272060 | Ga0105246_102720601 | 227 |
| 187 | 3300012510 | Ga0157316_1001889 | Ga0157316_10018893 | 227 |
| 188 | 3300013296 | Ga0157374_10288846 | Ga0157374_102888462 | 227 |
| 189 | 3300013297 | Ga0157378_10059835 | Ga0157378_100598355 | 227 |
| 190 | 3300013297 | Ga0157378_10062279 | Ga0157378_100622793 | 227 |
| 191 | 3300013306 | Ga0163162_10200644 | Ga0163162_102006443 | 227 |
| 192 | 3300013306 | Ga0163162_10225204 | Ga0163162_102252042 | 227 |
| 193 | 3300013308 | Ga0157375_10161103 | Ga0157375_101611033 | 227 |
| 194 | 3300014326 | Ga0157380_10377787 | Ga0157380_103777872 | 227 |
| 195 | 3300025910 | Ga0207684_10000091 | Ga0207684_1000009126 | 227 |
| 196 | 3300025910 | Ga0207684_10002382 | Ga0207684_100023829 | 227 |
| 197 | 3300025910 | Ga0207684_10026799 | Ga0207684_100267994 | 227 |
| 198 | 3300025910 | Ga0207684_10118135 | Ga0207684_101181354 | 227 |
| 199 | 3300025910 | Ga0207684_10118414 | Ga0207684_101184142 | 227 |
| 200 | 3300025922 | Ga0207646_10076593 | Ga0207646_100765933 | 227 |
| 201 | 3300025922 | Ga0207646_10136322 | Ga0207646_101363223 | 227 |
| 202 | 3300025925 | Ga0207650_10409434 | Ga0207650_104094341 | 227 |
| 203 | 3300025926 | Ga0207659_10443549 | Ga0207659_104435492 | 227 |
| 204 | 3300025938 | Ga0207704_10198296 | Ga0207704_101982962 | 227 |
| 205 | 3300025939 | Ga0207665_10206113 | Ga0207665_102061131 | 227 |
| 206 | 3300025941 | Ga0207711_10166151 | Ga0207711_101661512 | 227 |
| 207 | 3300025972 | Ga0207668_10584987 | Ga0207668_105849872 | 227 |
| 208 | 3300026035 | Ga0207703_10354576 | Ga0207703_103545762 | 227 |
| 209 | 3300026075 | Ga0207708_10057647 | Ga0207708_100576473 | 227 |
| 210 | 3300026075 | Ga0207708_10102296 | Ga0207708_101022961 | 227 |
| 211 | 3300026088 | Ga0207641_10022400 | Ga0207641_100224005 | 227 |
| 212 | 3300027876 | Ga0209974_10000567 | Ga0209974_1000056712 | 227 |
| 213 | 3300027907 | Ga0207428_10121345 | Ga0207428_101213453 | 227 |
| 214 | 3300028379 | Ga0268266_10385007 | Ga0268266_103850072 | 227 |
| 215 | 3300028381 | Ga0268264_10219825 | Ga0268264_102198251 | 227 |
| 216 | 3300028381 | Ga0268264_10717859 | Ga0268264_107178591 | 227 |
| 217 | 3300035114 | Ga0373939_0228028 | Ga0373939_0228028_20_703 | 227 |
| 218 | 3300035121 | Ga0373960_0179310 | Ga0373960_0179310_26_709 | 227 |
| 219 | 3300035170 | Ga0373943_0126760 | Ga0373943_0126760_533_1216 | 227 |
| 220 | 3300035695 | Ga0373927_0208452 | Ga0373927_0208452_164_847 | 227 |
| 221 | 3300035725 | Ga0373947_0026525 | Ga0373947_0026525_355_1038 | 227 |
| 222 | 3300035725 | Ga0373947_0396060 | Ga0373947_0396060_178_861 | 227 |
| 223 | 3300037068 | Ga0373925_0029145 | Ga0373925_0029145_2060_2743 | 227 |
| 224 | 3300037068 | Ga0373925_0667354 | Ga0373925_0667354_138_821 | 227 |
| 225 | 3300037312 | Ga0395899_0118134 | Ga0395899_0118134_180_863 | 227 |
| 226 | 3300038443 | Ga0395901_0891631 | Ga0395901_0891631_157_840 | 227 |
| 227 | 3300046455 | Ga0495603_0360633 | Ga0495603_0360633_89_772 | 227 |
| 228 | 3300046472 | Ga0495580_0173959 | Ga0495580_0173959_289_972 | 227 |
| 229 | 3300046476 | Ga0495662_0097116 | Ga0495662_0097116_287_991 | 227 |
| 230 | 3300046499 | Ga0495594_0147015 | Ga0495594_0147015_607_1290 | 227 |
| 231 | 3300046514 | Ga0495618_0065587 | Ga0495618_0065587_943_1647 | 227 |
| 232 | 3300046533 | Ga0495640_0057987 | Ga0495640_0057987_1281_1985 | 227 |
| 233 | 3300046536 | Ga0495587_0133858 | Ga0495587_0133858_342_1046 | 227 |
| 234 | 3300046537 | Ga0495598_0145576 | Ga0495598_0145576_66_749 | 227 |
| 235 | 3300046558 | Ga0495633_0273408 | Ga0495633_0273408_65_748 | 227 |
| 236 | 3300046663 | Ga0495635_0249779 | Ga0495635_0249779_280_963 | 227 |
| 237 | 3300046664 | Ga0495659_0138638 | Ga0495659_0138638_130_900 | 227 |
| 238 | 3300046681 | Ga0495647_0069599 | Ga0495647_0069599_193_897 | 227 |
| 239 | 3300047315 | Ga0495581_0085728 | Ga0495581_0085728_32_715 | 227 |
| 240 | 3300047317 | Ga0495604_0055312 | Ga0495604_0055312_1411_2115 | 227 |
| 241 | 3300047319 | Ga0495674_0660157 | Ga0495674_0660157_108_791 | 227 |
| 242 | 3300047471 | Ga0495684_0042911 | Ga0495684_0042911_1711_2415 | 227 |
| 243 | 3300048088 | Ga0495602_0361970 | Ga0495602_0361970_23_766 | 227 |
| 244 | 3300049592 | Ga0501076_0752757 | Ga0501076_0752757_29_712 | 227 |
| 245 | 3300049593 | Ga0501077_0135066 | Ga0501077_0135066_835_1518 | 227 |
| 246 | 3300050507 | nmdc:mga05p37_29404_c1 | nmdc:mga05p37_29404_c1_4577_5296 | 227 |
| 247 | 3300050507 | nmdc:mga05p37_991734_c1 | nmdc:mga05p37_991734_c1_39_722 | 227 |
| 248 | 3300050508 | nmdc:mga09592_71742_c1 | nmdc:mga09592_71742_c1_288_971 | 227 |
| 249 | 3300050510 | nmdc:mga06r32_28067_c1 | nmdc:mga06r32_28067_c1_4215_4898 | 227 |
| 250 | 3300050511 | nmdc:mga08y16_75248_c1 | nmdc:mga08y16_75248_c1_1735_2505 | 227 |
| 251 | 3300050512 | nmdc:mga0n895_178335_c1 | nmdc:mga0n895_178335_c1_232_915 | 227 |
| 252 | 3300050512 | nmdc:mga0n895_202545_c1 | nmdc:mga0n895_202545_c1_1239_1952 | 227 |
| 253 | 3300050512 | nmdc:mga0n895_61631_c1 | nmdc:mga0n895_61631_c1_1558_2241 | 227 |
| 254 | 3300050513 | nmdc:mga0rr50_32606_c1 | nmdc:mga0rr50_32606_c1_2398_3081 | 227 |
| 255 | 3300050513 | nmdc:mga0rr50_460608_c1 | nmdc:mga0rr50_460608_c1_274_957 | 227 |
| 256 | 3300050515 | nmdc:mga0a205_34238_c1 | nmdc:mga0a205_34238_c1_1055_1738 | 227 |
| 257 | 3300053077 | Ga0495601_0029861 | Ga0495601_0029861_1277_1981 | 227 |
| 258 | 3300053084 | Ga0495595_0008974 | Ga0495595_0008974_1012_1716 | 227 |
| 259 | 3300053085 | Ga0495619_0064548 | Ga0495619_0064548_662_1366 | 227 |
| 260 | 3300061734 | Ga0530510_0487298 | Ga0530510_0487298_92_775 | 227 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5yhh-assembly1.cif.gz_A | crystal structure of yiim from geobacillus stearothermophilus | 0.8784 | 6 | 208 |
| 5yhh-assembly1.cif.gz_A | crystal structure of yiim from geobacillus stearothermophilus | 0.8568 | 6 | 208 |
| 1o65-assembly1.cif.gz_A | crystal structure of an hypothetical protein | 0.8548 | 2 | 213 |
| 1o65-assembly3.cif.gz_C | crystal structure of an hypothetical protein | 0.8522 | 5 | 213 |
| 1o67-assembly2.cif.gz_B | crystal structure of an hypothetical protein | 0.85 | 5 | 213 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P95151_15_247_2.40.33.20 | Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like | 0.936 | 1 | 208 | 2.40.33.20 |
| af_Q2FVS9_1_216_2.40.33.20 | Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like | 0.9087 | 7 | 212 | 2.40.33.20 |
| af_Q2FVS9_1_216_2.40.33.20 | Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like | 0.8653 | 7 | 212 | 2.40.33.20 |
| af_P95151_15_247_2.40.33.20 | Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like | 0.8605 | 1 | 208 | 2.40.33.20 |
| 5yhiA00 | Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like | 0.843 | 7 | 213 | 2.40.33.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534QJ83-F1-model_v4 | MOSC domain-containing protein | 0.9864 | 100 | 226 |
GO:0003824
GO:0030151 GO:0030170 |
| AF-A0A7J9WQH3-F1-model_v4 | MOSC domain-containing protein | 0.9827 | 6 | 208 |
GO:0003824
GO:0030151 GO:0030170 |
| AF-A0A534QJ83-F1-model_v4 | MOSC domain-containing protein | 0.9787 | 100 | 226 |
GO:0003824
GO:0030151 GO:0030170 |
| AF-A0A535A8T3-F1-model_v4 | MOSC domain-containing protein | 0.976 | 1 | 121 |
GO:0003824
GO:0030151 GO:0030170 |
| AF-A0A522Z4G9-F1-model_v4 | MOSC domain-containing protein | 0.9711 | 7 | 152 |
GO:0003824
GO:0030151 GO:0030170 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar