F369137

General Info

Members Datasets Scaffolds Average Seq Length
259 160 518 408

Family's Representative Sequence

Representative Sequence 3300049668|Ga0501233_005132|Ga0501233_005132_615_1874
Length 419
Sequence LIEFLNTKEIRMKFRLLFVATVLLFSVAPAALAQSAGNWPQWRGPNRDGISKETGLLKQWPAEGPPLAWKATGAGRGYSSFAVTNGKLYTMGLRGDREFVVAFDVATGKEAWATAHGSAFRNDRGDGPRGTPTVDGDRVYALGGNGDLSALDARTGKIVWSKNILEEFGGSNIVWGISESPLVLGNKLLVNAGGPGASIVALNKANGSVIWKSQSDRAGYSSAIPVELNGITQVVFFTGQRAVGLDSKDGRLLWDYERPSNRTANAATPIVRANRIFISSDYGTGGGVVEIKPDNKAEEIYFTKDMKNHHSSSVLIGDYLYGFSASILTAMKFDTGELAWRDRSVGKGSLVYADGHLYLLSENGVVGLVEATPTGYKEKGRFRIQQDSLPTWAHPVVAGGRLYLRDQDTIYAYDVREKK

Samples

Sample ID Description Type Environment
1 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
111 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
124 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
125 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
126 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
130 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
131 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
132 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
133 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
134 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
135 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
139 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
140 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
141 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
142 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
143 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
144 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
145 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
146 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
147 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
148 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
149 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
160 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.93
Rhizosphere 97.3
Stem 0
Stem Tuber 0
Unclassified 17.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501233_005132 3300049668 Unclassified 2424
2 SwRhRL2b_contig_1554348 2162886007 Unclassified 3100
3 CNAas_1000023 3300000532 Bacteria 9747
4 JGI24751J29686_10000017 3300002459 Bacteria 109415
5 JGI25406J46586_10038296 3300003203 Bacteria 1720
6 rootL2_10099611 3300003322 Bacteria 1802
7 Ga0065714_10064714 3300005288 Bacteria 21913
8 Ga0065704_10001652 3300005289 Bacteria 12218
9 Ga0065712_10016623 3300005290 Unclassified 2664
10 Ga0065712_10067902 3300005290 Bacteria 21942
11 Ga0065715_10001745 3300005293 Bacteria 6812
12 Ga0065715_10093075 3300005293 Bacteria 4802
13 Ga0070690_100055513 3300005330 Bacteria 2537
14 Ga0070690_100072060 3300005330 Unclassified 2246
15 Ga0070690_100072741 3300005330 Bacteria 2235
16 Ga0070670_100000232 3300005331 Bacteria 51314
17 Ga0070670_100027484 3300005331 Unclassified 4893
18 Ga0070670_100050744 3300005331 Bacteria 3564
19 Ga0070670_100070553 3300005331 Unclassified 2999
20 Ga0070670_100138886 3300005331 Bacteria 2101
21 Ga0070666_10007445 3300005335 Bacteria 6750
22 Ga0070680_100021093 3300005336 Bacteria 5175
23 Ga0070689_100000487 3300005340 Bacteria 23451
24 Ga0070689_100040365 3300005340 Bacteria 3578
25 Ga0070687_100016259 3300005343 Bacteria 3388
26 Ga0070692_10017615 3300005345 Bacteria 3419
27 Ga0070675_100007319 3300005354 Bacteria 8519
28 Ga0070675_100214043 3300005354 Bacteria 1676
29 Ga0070671_100007773 3300005355 Bacteria 8564
30 Ga0070673_100012025 3300005364 Bacteria 5929
31 Ga0070673_100080518 3300005364 Bacteria 2639
32 Ga0070673_100255512 3300005364 Bacteria 1529
33 Ga0070688_100212059 3300005365 Unclassified 1360
34 Ga0070659_100058838 3300005366 Bacteria 3034
35 Ga0070667_100005026 3300005367 Bacteria 11070
36 Ga0070703_10001048 3300005406 Bacteria 8631
37 Ga0070701_10094882 3300005438 Bacteria 1642
38 Ga0070705_100037478 3300005440 Bacteria 2735
39 Ga0070705_100048100 3300005440 Bacteria 2469
40 Ga0070700_100000106 3300005441 Bacteria 53028
41 Ga0070700_100007255 3300005441 Bacteria 5973
42 Ga0070700_100012374 3300005441 Unclassified 4758
43 Ga0070700_100039883 3300005441 Bacteria 2871
44 Ga0070700_100073760 3300005441 Bacteria 2185
45 Ga0070694_100002833 3300005444 Bacteria 10302
46 Ga0070694_100138890 3300005444 Bacteria 1763
47 Ga0070681_10010560 3300005458 Bacteria 9120
48 Ga0068867_100085131 3300005459 Bacteria 2390
49 Ga0070706_100000088 3300005467 Bacteria 107818
50 Ga0070707_100019145 3300005468 Bacteria 6447
51 Ga0070698_100007723 3300005471 Bacteria 11633
52 Ga0070699_100000616 3300005518 Bacteria 33616
53 Ga0070699_100025624 3300005518 Bacteria 5083
54 Ga0070699_100032843 3300005518 Bacteria 4483
55 Ga0070697_100102548 3300005536 Bacteria 2377
56 Ga0070695_100015114 3300005545 Bacteria 4659
57 Ga0070695_100051482 3300005545 Bacteria 2643
58 Ga0070696_100013594 3300005546 Bacteria 5463
59 Ga0070696_100048233 3300005546 Bacteria 2956
60 Ga0070696_100068947 3300005546 Unclassified 2484
61 Ga0070693_100009994 3300005547 Bacteria 4735
62 Ga0070704_100046416 3300005549 Bacteria 3029
63 Ga0070704_100144422 3300005549 Unclassified 1862
64 Ga0070704_100208044 3300005549 Bacteria 1584
65 Ga0070664_100020723 3300005564 Bacteria 5415
66 Ga0070664_100187866 3300005564 Unclassified 1840
67 Ga0070664_100249580 3300005564 Bacteria 1595
68 Ga0070702_100005493 3300005615 Bacteria 5912
69 Ga0068859_100000546 3300005617 Bacteria 37260
70 Ga0068859_100031897 3300005617 Bacteria 5292
71 Ga0068859_100033854 3300005617 Bacteria 5130
72 Ga0068859_100035883 3300005617 Bacteria 4975
73 Ga0068859_100046321 3300005617 Unclassified 4367
74 Ga0068859_100068979 3300005617 Bacteria 3570
75 Ga0068859_100073028 3300005617 Bacteria 3468
76 Ga0068859_100170661 3300005617 Unclassified 2256
77 Ga0068859_100293009 3300005617 Unclassified 1720
78 Ga0068864_100021009 3300005618 Bacteria 5466
79 Ga0068864_100293639 3300005618 Bacteria 1520
80 Ga0068861_100005267 3300005719 Bacteria 8722
81 Ga0068851_10001636 3300005834 Bacteria 9828
82 Ga0068863_100001047 3300005841 Bacteria 27679
83 Ga0068863_100088346 3300005841 Unclassified 2937
84 Ga0068863_100099447 3300005841 Bacteria 2764
85 Ga0068858_100024235 3300005842 Bacteria 5654
86 Ga0068858_100024874 3300005842 Bacteria 5575
87 Ga0068858_100038772 3300005842 Bacteria 4419
88 Ga0068858_100205814 3300005842 Bacteria 1862
89 Ga0068860_100003082 3300005843 Bacteria 17240
90 Ga0068860_100021549 3300005843 Bacteria 6240
91 Ga0068860_100116004 3300005843 Unclassified 2562
92 Ga0081539_10000043 3300005985 Bacteria 288108
93 Ga0081539_10002299 3300005985 Bacteria 27621
94 Ga0070716_100011633 3300006173 Bacteria 4435
95 Ga0097621_100004585 3300006237 Bacteria 9643
96 Ga0097621_100051572 3300006237 Bacteria 3349
97 Ga0068871_100000781 3300006358 Bacteria 21419
98 Ga0068871_100009191 3300006358 Bacteria 7148
99 Ga0075433_10004200 3300006852 Bacteria 11176
100 Ga0075434_100362365 3300006871 Unclassified 1471
101 Ga0075429_100133670 3300006880 Unclassified 2170
102 Ga0068865_100260766 3300006881 Bacteria 1372
103 Ga0097620_100000546 3300006931 Bacteria 37260
104 Ga0097620_100031897 3300006931 Bacteria 5292
105 Ga0097620_100033848 3300006931 Bacteria 5130
106 Ga0097620_100035882 3300006931 Bacteria 4975
107 Ga0097620_100046320 3300006931 Unclassified 4367
108 Ga0097620_100068979 3300006931 Bacteria 3570
109 Ga0097620_100073032 3300006931 Bacteria 3468
110 Ga0097620_100170654 3300006931 Unclassified 2256
111 Ga0097620_100293014 3300006931 Unclassified 1720
112 Ga0075435_100026714 3300007076 Bacteria 4508
113 Ga0105240_10000018 3300009093 Bacteria 434461
114 Ga0111539_10000627 3300009094 Bacteria 45686
115 Ga0111539_10013361 3300009094 Bacteria 10261
116 Ga0111539_10015325 3300009094 Bacteria 9548
117 Ga0111539_10050058 3300009094 Bacteria 4978
118 Ga0105247_10001177 3300009101 Bacteria 19463
119 Ga0105247_10046228 3300009101 Bacteria 2672
120 Ga0114129_10007874 3300009147 Bacteria 15161
121 Ga0114129_10013406 3300009147 Bacteria 11681
122 Ga0114129_10185178 3300009147 Bacteria 2830
123 Ga0114129_10579149 3300009147 Unclassified 1457
124 Ga0105243_10063192 3300009148 Bacteria 2967
125 Ga0105241_10017979 3300009174 Bacteria 5198
126 Ga0105241_10104368 3300009174 Bacteria 2258
127 Ga0105241_10265032 3300009174 Unclassified 1461
128 Ga0105248_10001257 3300009177 Bacteria 28330
129 Ga0105248_10039602 3300009177 Bacteria 5280
130 Ga0105248_10125357 3300009177 Bacteria 2897
131 Ga0105237_10009719 3300009545 Bacteria 10290
132 Ga0105238_10009992 3300009551 Bacteria 9517
133 Ga0105238_10010180 3300009551 Bacteria 9431
134 Ga0105246_10038369 3300011119 Unclassified 3220
135 Ga0157373_10026530 3300013100 Bacteria 4183
136 Ga0157374_10058745 3300013296 Bacteria 3595
137 Ga0157378_10048861 3300013297 Unclassified 3762
138 Ga0157378_10098636 3300013297 Unclassified 2664
139 Ga0157378_10349200 3300013297 Unclassified 1445
140 Ga0163162_10003140 3300013306 Bacteria 15781
141 Ga0163162_10078265 3300013306 Bacteria 3372
142 Ga0157372_10056009 3300013307 Unclassified 4405
143 Ga0163163_10001201 3300014325 Bacteria 21909
144 Ga0163163_10165018 3300014325 Bacteria 2261
145 Ga0163163_10227289 3300014325 Bacteria 1915
146 Ga0157380_10070348 3300014326 Bacteria 2827
147 Ga0157379_10002035 3300014968 Bacteria 16777
148 Ga0163161_10073667 3300017792 Bacteria 2502
149 Ga0207656_10001600 3300025321 Bacteria 7532
150 Ga0207653_10001255 3300025885 Bacteria 8271
151 Ga0207710_10003364 3300025900 Bacteria 7148
152 Ga0207647_10000385 3300025904 Bacteria 35983
153 Ga0207643_10000804 3300025908 Bacteria 19099
154 Ga0207684_10000170 3300025910 Bacteria 107800
155 Ga0207684_10097820 3300025910 Bacteria 2506
156 Ga0207654_10066270 3300025911 Bacteria 2129
157 Ga0207695_10000221 3300025913 Bacteria 152342
158 Ga0207671_10002718 3300025914 Bacteria 18529
159 Ga0207652_10059815 3300025921 Bacteria 3285
160 Ga0207646_10203912 3300025922 Unclassified 1786
161 Ga0207681_10003869 3300025923 Bacteria 9299
162 Ga0207694_10004838 3300025924 Bacteria 10452
163 Ga0207650_10000005 3300025925 Bacteria 663190
164 Ga0207650_10053369 3300025925 Unclassified 2996
165 Ga0207659_10000954 3300025926 Bacteria 17286
166 Ga0207709_10002404 3300025935 Bacteria 11779
167 Ga0207670_10001088 3300025936 Bacteria 14326
168 Ga0207665_10018969 3300025939 Bacteria 4519
169 Ga0207691_10126721 3300025940 Bacteria 2259
170 Ga0207711_10113279 3300025941 Unclassified 2414
171 Ga0207689_10105474 3300025942 Bacteria 2315
172 Ga0207689_10113612 3300025942 Bacteria 2226
173 Ga0207679_10024031 3300025945 Bacteria 4175
174 Ga0207679_10109410 3300025945 Unclassified 2178
175 Ga0207651_10010167 3300025960 Bacteria 5199
176 Ga0207703_10067037 3300026035 Bacteria 2953
177 Ga0207703_10255653 3300026035 Unclassified 1581
178 Ga0207708_10000043 3300026075 Bacteria 121725
179 Ga0207708_10022944 3300026075 Bacteria 4714
180 Ga0207708_10046926 3300026075 Bacteria 3290
181 Ga0207708_10077026 3300026075 Bacteria 2559
182 Ga0207641_10022023 3300026088 Bacteria 5241
183 Ga0207641_10146874 3300026088 Bacteria 2133
184 Ga0207676_10014138 3300026095 Bacteria 5734
185 Ga0207676_10175036 3300026095 Bacteria 1873
186 Ga0207676_10236551 3300026095 Unclassified 1636
187 Ga0207674_10220388 3300026116 Bacteria 1845
188 Ga0207674_10328833 3300026116 Unclassified 1478
189 Ga0207674_10359968 3300026116 Bacteria 1406
190 Ga0207675_100002827 3300026118 Bacteria 17076
191 Ga0207675_100090278 3300026118 Bacteria 2881
192 Ga0207428_10027991 3300027907 Unclassified 4686
193 Ga0207428_10035084 3300027907 Bacteria 4103
194 Ga0268265_10034384 3300028380 Bacteria 3694
195 Ga0268264_10325310 3300028381 Bacteria 1455
196 Ga0314311_1081612 3300030733 Bacteria 2351
197 Ga0307513_10005943 3300031456 Bacteria 16018
198 Ga0307408_100061730 3300031548 Bacteria 2736
199 Ga0307410_10009681 3300031852 Bacteria 5420
200 Ga0307410_10071343 3300031852 Bacteria 2409
201 Ga0307406_10008409 3300031901 Bacteria 5753
202 Ga0307407_10060458 3300031903 Bacteria 2211
203 Ga0307412_10183130 3300031911 Bacteria 1577
204 Ga0307409_100248867 3300031995 Bacteria 1623
205 Ga0307416_100046404 3300032002 Unclassified 3428
206 Ga0307414_10029653 3300032004 Bacteria 3563
207 Ga0307414_10354865 3300032004 Bacteria 1260
208 Ga0307411_10022839 3300032005 Bacteria 3693
209 Ga0307411_10217367 3300032005 Bacteria 1480
210 Ga0307415_100089503 3300032126 Bacteria 2223
211 Ga0395901_0128834 3300038443 Bacteria 2660
212 Ga0439435_0000772 3300042436 Bacteria 5377
213 Ga0495592_0046189 3300046454 Unclassified 3247
214 Ga0495663_0000150 3300046525 Bacteria 28417
215 Ga0495621_0000571 3300046539 Bacteria 9179
216 Ga0496102_0127506 3300048905 Bacteria 2380
217 Ga0496104_0107461 3300048907 Unclassified 2674
218 Ga0496106_0057417 3300048909 Bacteria 2943
219 Ga0496107_0057963 3300048910 Bacteria 2800
220 Ga0496108_0077967 3300048911 Bacteria 2804
221 Ga0501291_001042 3300049514 Bacteria 3207
222 Ga0501298_003075 3300049521 Bacteria 2571
223 Ga0501299_002358 3300049522 Unclassified 2607
224 Ga0501038_0003850 3300049574 Bacteria 13948
225 Ga0501039_0113408 3300049575 Unclassified 2120
226 Ga0501048_0028089 3300049582 Bacteria 4085
227 Ga0501075_0054032 3300049591 Bacteria 3021
228 Ga0501075_0067358 3300049591 Bacteria 2704
229 Ga0501076_0065447 3300049592 Bacteria 2899
230 Ga0501198_000932 3300049649 Bacteria 3690
231 Ga0501202_012773 3300049652 Bacteria 1590
232 Ga0501202_015570 3300049652 Bacteria 1466
233 Ga0501217_002584 3300049661 Bacteria 3583
234 Ga0501217_005168 3300049661 Bacteria 2717
235 Ga0501223_001543 3300049663 Bacteria 5308
236 Ga0501227_006432 3300049665 Bacteria 2526
237 Ga0501233_000902 3300049668 Bacteria 5025
238 Ga0501233_006307 3300049668 Bacteria 2225
239 Ga0501235_000779 3300049669 Bacteria 6491
240 Ga0501249_009359 3300049679 Unclassified 2039
241 Ga0501257_004260 3300049686 Bacteria 3117
242 Ga0501225_0007662 3300049705 Bacteria 3127
243 Ga0501225_0040822 3300049705 Unclassified 1279
244 Ga0501079_0006533 3300049741 Bacteria 8763
245 Ga0501080_0107580 3300049742 Bacteria 2585
246 Ga0501081_0028954 3300049743 Bacteria 3740
247 nmdc:mga05p37_150793_c1 3300050507 Bacteria 2843
248 nmdc:mga05p37_54761_c1 3300050507 Bacteria 4907
249 nmdc:mga09592_136541_c1 3300050508 Unclassified 2112
250 nmdc:mga09592_75524_c1 3300050508 Bacteria 2865
251 nmdc:mga0qj67_22125_c1 3300050509 Bacteria 4880
252 nmdc:mga08y16_121004_c1 3300050511 Bacteria 2724
253 nmdc:mga08y16_5878_c1 3300050511 Bacteria 12856
254 nmdc:mga0n895_101111_c1 3300050512 Bacteria 2892
255 nmdc:mga0rr50_29679_c1 3300050513 Bacteria 3861
256 nmdc:mga0a205_22115_c1 3300050515 Bacteria 6019
257 nmdc:mga0a205_4096_c1 3300050515 Bacteria 13043
258 Ga0501084_0246549 3300054114 Unclassified 1508
259 Ga0530510_0117693 3300061734 Bacteria 1949
260 Ga0501233_005132
261 SwRhRL2b_contig_1554348
262 CNAas_1000023
263 JGI24751J29686_10000017
264 JGI25406J46586_10038296
265 rootL2_10099611
266 Ga0065714_10064714
267 Ga0065704_10001652
268 Ga0065712_10016623
269 Ga0065712_10067902
270 Ga0065715_10001745
271 Ga0065715_10093075
272 Ga0070690_100055513
273 Ga0070690_100072060
274 Ga0070690_100072741
275 Ga0070670_100000232
276 Ga0070670_100027484
277 Ga0070670_100050744
278 Ga0070670_100070553
279 Ga0070670_100138886
280 Ga0070666_10007445
281 Ga0070680_100021093
282 Ga0070689_100000487
283 Ga0070689_100040365
284 Ga0070687_100016259
285 Ga0070692_10017615
286 Ga0070675_100007319
287 Ga0070675_100214043
288 Ga0070671_100007773
289 Ga0070673_100012025
290 Ga0070673_100080518
291 Ga0070673_100255512
292 Ga0070688_100212059
293 Ga0070659_100058838
294 Ga0070667_100005026
295 Ga0070703_10001048
296 Ga0070701_10094882
297 Ga0070705_100037478
298 Ga0070705_100048100
299 Ga0070700_100000106
300 Ga0070700_100007255
301 Ga0070700_100012374
302 Ga0070700_100039883
303 Ga0070700_100073760
304 Ga0070694_100002833
305 Ga0070694_100138890
306 Ga0070681_10010560
307 Ga0068867_100085131
308 Ga0070706_100000088
309 Ga0070707_100019145
310 Ga0070698_100007723
311 Ga0070699_100000616
312 Ga0070699_100025624
313 Ga0070699_100032843
314 Ga0070697_100102548
315 Ga0070695_100015114
316 Ga0070695_100051482
317 Ga0070696_100013594
318 Ga0070696_100048233
319 Ga0070696_100068947
320 Ga0070693_100009994
321 Ga0070704_100046416
322 Ga0070704_100144422
323 Ga0070704_100208044
324 Ga0070664_100020723
325 Ga0070664_100187866
326 Ga0070664_100249580
327 Ga0070702_100005493
328 Ga0068859_100000546
329 Ga0068859_100031897
330 Ga0068859_100033854
331 Ga0068859_100035883
332 Ga0068859_100046321
333 Ga0068859_100068979
334 Ga0068859_100073028
335 Ga0068859_100170661
336 Ga0068859_100293009
337 Ga0068864_100021009
338 Ga0068864_100293639
339 Ga0068861_100005267
340 Ga0068851_10001636
341 Ga0068863_100001047
342 Ga0068863_100088346
343 Ga0068863_100099447
344 Ga0068858_100024235
345 Ga0068858_100024874
346 Ga0068858_100038772
347 Ga0068858_100205814
348 Ga0068860_100003082
349 Ga0068860_100021549
350 Ga0068860_100116004
351 Ga0081539_10000043
352 Ga0081539_10002299
353 Ga0070716_100011633
354 Ga0097621_100004585
355 Ga0097621_100051572
356 Ga0068871_100000781
357 Ga0068871_100009191
358 Ga0075433_10004200
359 Ga0075434_100362365
360 Ga0075429_100133670
361 Ga0068865_100260766
362 Ga0097620_100000546
363 Ga0097620_100031897
364 Ga0097620_100033848
365 Ga0097620_100035882
366 Ga0097620_100046320
367 Ga0097620_100068979
368 Ga0097620_100073032
369 Ga0097620_100170654
370 Ga0097620_100293014
371 Ga0075435_100026714
372 Ga0105240_10000018
373 Ga0111539_10000627
374 Ga0111539_10013361
375 Ga0111539_10015325
376 Ga0111539_10050058
377 Ga0105247_10001177
378 Ga0105247_10046228
379 Ga0114129_10007874
380 Ga0114129_10013406
381 Ga0114129_10185178
382 Ga0114129_10579149
383 Ga0105243_10063192
384 Ga0105241_10017979
385 Ga0105241_10104368
386 Ga0105241_10265032
387 Ga0105248_10001257
388 Ga0105248_10039602
389 Ga0105248_10125357
390 Ga0105237_10009719
391 Ga0105238_10009992
392 Ga0105238_10010180
393 Ga0105246_10038369
394 Ga0157373_10026530
395 Ga0157374_10058745
396 Ga0157378_10048861
397 Ga0157378_10098636
398 Ga0157378_10349200
399 Ga0163162_10003140
400 Ga0163162_10078265
401 Ga0157372_10056009
402 Ga0163163_10001201
403 Ga0163163_10165018
404 Ga0163163_10227289
405 Ga0157380_10070348
406 Ga0157379_10002035
407 Ga0163161_10073667
408 Ga0207656_10001600
409 Ga0207653_10001255
410 Ga0207710_10003364
411 Ga0207647_10000385
412 Ga0207643_10000804
413 Ga0207684_10000170
414 Ga0207684_10097820
415 Ga0207654_10066270
416 Ga0207695_10000221
417 Ga0207671_10002718
418 Ga0207652_10059815
419 Ga0207646_10203912
420 Ga0207681_10003869
421 Ga0207694_10004838
422 Ga0207650_10000005
423 Ga0207650_10053369
424 Ga0207659_10000954
425 Ga0207709_10002404
426 Ga0207670_10001088
427 Ga0207665_10018969
428 Ga0207691_10126721
429 Ga0207711_10113279
430 Ga0207689_10105474
431 Ga0207689_10113612
432 Ga0207679_10024031
433 Ga0207679_10109410
434 Ga0207651_10010167
435 Ga0207703_10067037
436 Ga0207703_10255653
437 Ga0207708_10000043
438 Ga0207708_10022944
439 Ga0207708_10046926
440 Ga0207708_10077026
441 Ga0207641_10022023
442 Ga0207641_10146874
443 Ga0207676_10014138
444 Ga0207676_10175036
445 Ga0207676_10236551
446 Ga0207674_10220388
447 Ga0207674_10328833
448 Ga0207674_10359968
449 Ga0207675_100002827
450 Ga0207675_100090278
451 Ga0207428_10027991
452 Ga0207428_10035084
453 Ga0268265_10034384
454 Ga0268264_10325310
455 Ga0314311_1081612
456 Ga0307513_10005943
457 Ga0307408_100061730
458 Ga0307410_10009681
459 Ga0307410_10071343
460 Ga0307406_10008409
461 Ga0307407_10060458
462 Ga0307412_10183130
463 Ga0307409_100248867
464 Ga0307416_100046404
465 Ga0307414_10029653
466 Ga0307414_10354865
467 Ga0307411_10022839
468 Ga0307411_10217367
469 Ga0307415_100089503
470 Ga0395901_0128834
471 Ga0439435_0000772
472 Ga0495592_0046189
473 Ga0495663_0000150
474 Ga0495621_0000571
475 Ga0496102_0127506
476 Ga0496104_0107461
477 Ga0496106_0057417
478 Ga0496107_0057963
479 Ga0496108_0077967
480 Ga0501291_001042
481 Ga0501298_003075
482 Ga0501299_002358
483 Ga0501038_0003850
484 Ga0501039_0113408
485 Ga0501048_0028089
486 Ga0501075_0054032
487 Ga0501075_0067358
488 Ga0501076_0065447
489 Ga0501198_000932
490 Ga0501202_012773
491 Ga0501202_015570
492 Ga0501217_002584
493 Ga0501217_005168
494 Ga0501223_001543
495 Ga0501227_006432
496 Ga0501233_000902
497 Ga0501233_006307
498 Ga0501235_000779
499 Ga0501249_009359
500 Ga0501257_004260
501 Ga0501225_0007662
502 Ga0501225_0040822
503 Ga0501079_0006533
504 Ga0501080_0107580
505 Ga0501081_0028954
506 nmdc:mga05p37_150793_c1
507 nmdc:mga05p37_54761_c1
508 nmdc:mga09592_136541_c1
509 nmdc:mga09592_75524_c1
510 nmdc:mga0qj67_22125_c1
511 nmdc:mga08y16_121004_c1
512 nmdc:mga08y16_5878_c1
513 nmdc:mga0n895_101111_c1
514 nmdc:mga0rr50_29679_c1
515 nmdc:mga0a205_22115_c1
516 nmdc:mga0a205_4096_c1
517 Ga0501084_0246549
518 Ga0530510_0117693

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13360

PQQ_2

PQQ-like domain

96

342

0.87

PF01011

PQQ

PQQ enzyme repeat

137

174

0.86

PF13570

PQQ_3

PQQ-like domain

108

155

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yms-assembly1.cif.gz_B structure and assembly of a b-propeller with nine blades and a new conserved repetitive sequence motif 0.8303 121 203
2yms-assembly1.cif.gz_B structure and assembly of a b-propeller with nine blades and a new conserved repetitive sequence motif 0.7993 121 203
2yms-assembly1.cif.gz_D structure and assembly of a b-propeller with nine blades and a new conserved repetitive sequence motif 0.7788 68 151
5i4q-assembly1.cif.gz_A contact-dependent inhibition system from escherichia coli nc101 - ternary cdia/cdii/ef-tu complex (domains 2 and 3) 0.7651 292 319
2yms-assembly1.cif.gz_A structure and assembly of a b-propeller with nine blades and a new conserved repetitive sequence motif 0.7492 68 208
ID Description Score Start End Superfamily
af_K7LNA2_63_196_2.40.10.480 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8306 289 358 2.40.10.480
2ymsB00 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8303 121 203 2.40.10.480
af_Q9SZ03_110_222_2.40.10.480 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8293 289 358 2.40.10.480
af_A0A1D6NA74_293_423_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8232 289 362 2.130.10.10
af_Q0ISH6_1_91_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8149 246 283 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A2V9N3X0-F1-model_v4 Polyvinylalcohol dehydrogenase 0.9691 28 396
AF-A0A1Q8AVT2-F1-model_v4 Polyvinylalcohol dehydrogenase 0.9665 254 395
AF-A0A257X6I3-F1-model_v4 SLA1 homology domain-containing protein 0.964 28 152 GO:0008092
GO:0030674
GO:0042802
GO:0043130
AF-A0A257W6M8-F1-model_v4 Polyvinylalcohol dehydrogenase 0.96 32 394
AF-A0A7W1SGM5-F1-model_v4 PQQ-like beta-propeller repeat protein 0.9594 84 395

Map