F368689

General Info

Members Datasets Scaffolds Average Seq Length
259 164 518 336

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100022534|Ga0068860_1000225343
Length 311
Sequence MIHFLDFSNEKMVAKAADIAAKTDILLGNLEDAIPVDRKEAARKGLIRAAKESDFGQTALWTRINSLESPWVLDDLTTLVNEIGDKLEVVMVPKVEGAWDIHYVDRLLAQLEAKAGLERPILVHAILETAQGVVNLEEIAAASPRMQGMSFGPADLAASRRMKTTRVGGGHPGYRVMEDPADPENPEADRVSSQQDLWHYSIARMVDACASTGILPFYGPFGDIKDTAGCETQFRAAFLMGCVGAWSLHPVQIDIAKKVFSPPEAIPDGRGVHMIDGKMQDDATWKQCKVMVELAEMLAAKDAELAEAYGL

Samples

Sample ID Description Type Environment
1 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
54 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
79 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
80 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
81 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
82 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
85 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
86 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
87 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
88 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
89 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
90 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
91 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
94 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
95 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
100 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
101 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
102 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
103 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
104 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
112 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
113 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
114 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
115 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
116 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
119 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
130 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
131 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
132 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
138 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
150 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
160 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
161 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
164 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.07
Metatranscriptomes 1.93
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.09
Nodule 0
Rhizoplane 10.04
Rhizosphere 80.31
Stem 0
Stem Tuber 0
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068860_100022534 3300005843 Bacteria 6091
2 LJQas_1000989 3300000549 Bacteria 4380
3 Ga0070658_10017233 3300005327 Bacteria 5781
4 Ga0070683_100049471 3300005329 Bacteria 3888
5 Ga0070683_100068554 3300005329 Bacteria 3305
6 Ga0070683_100184632 3300005329 Bacteria 1980
7 Ga0070682_100228962 3300005337 Bacteria 1328
8 Ga0068868_100262903 3300005338 Bacteria 1456
9 Ga0070660_100022704 3300005339 Bacteria 4645
10 Ga0070668_100007914 3300005347 Bacteria 7892
11 Ga0070668_100055133 3300005347 Bacteria 3068
12 Ga0070659_100000765 3300005366 Bacteria 23348
13 Ga0070659_100023750 3300005366 Bacteria 4694
14 Ga0070710_10000009 3300005437 Bacteria 165863
15 Ga0070705_100023016 3300005440 Bacteria 3339
16 Ga0070663_100024857 3300005455 Bacteria 4037
17 Ga0070662_100006026 3300005457 Bacteria 7780
18 Ga0068867_100072577 3300005459 Bacteria 2577
19 Ga0070685_10160386 3300005466 Bacteria 1433
20 Ga0070684_100125626 3300005535 Bacteria 2310
21 Ga0070684_100211526 3300005535 Bacteria 1767
22 Ga0070696_100122903 3300005546 Bacteria 1880
23 Ga0068854_100021472 3300005578 Bacteria 4382
24 Ga0068856_100052765 3300005614 Bacteria 4010
25 Ga0068859_100460042 3300005617 Bacteria 1368
26 Ga0068861_100269800 3300005719 Bacteria 1461
27 Ga0068851_10003351 3300005834 Bacteria 7126
28 Ga0081455_10078140 3300005937 Bacteria 2720
29 Ga0081538_10000513 3300005981 Bacteria 43328
30 Ga0081538_10000855 3300005981 Bacteria 32847
31 Ga0081538_10001044 3300005981 Bacteria 29535
32 Ga0081538_10003262 3300005981 Bacteria 15408
33 Ga0081538_10008194 3300005981 Bacteria 8918
34 Ga0081538_10030326 3300005981 Bacteria 3675
35 Ga0081539_10006660 3300005985 Bacteria 10942
36 Ga0081539_10010069 3300005985 Bacteria 7768
37 Ga0081539_10027449 3300005985 Bacteria 3606
38 Ga0081539_10063370 3300005985 Bacteria 2017
39 Ga0070717_10000013 3300006028 Bacteria 228046
40 Ga0075365_10020898 3300006038 Bacteria 4071
41 Ga0075365_10023446 3300006038 Bacteria 3882
42 Ga0075365_10065101 3300006038 Bacteria 2443
43 Ga0075363_100007747 3300006048 Bacteria 4960
44 Ga0070715_10145815 3300006163 Bacteria 1155
45 Ga0075428_100007521 3300006844 Bacteria 12074
46 Ga0075430_100009050 3300006846 Bacteria 8417
47 Ga0075431_100012194 3300006847 Bacteria 8675
48 Ga0075433_10105669 3300006852 Bacteria 2495
49 Ga0075433_10180417 3300006852 Bacteria 1879
50 Ga0075434_100056024 3300006871 Bacteria 3917
51 Ga0075429_100006435 3300006880 Bacteria 10172
52 Ga0075429_100299547 3300006880 Bacteria 1408
53 Ga0097620_100460004 3300006931 Bacteria 1368
54 Ga0075435_100113842 3300007076 Bacteria 2252
55 Ga0105240_10043184 3300009093 Bacteria 5739
56 Ga0111539_10066110 3300009094 Bacteria 4270
57 Ga0105245_10005584 3300009098 Bacteria 11052
58 Ga0105247_10079049 3300009101 Bacteria 2069
59 Ga0105247_10097396 3300009101 Bacteria 1876
60 Ga0114129_10028901 3300009147 Bacteria 7854
61 Ga0114129_10030387 3300009147 Bacteria 7643
62 Ga0114129_10081240 3300009147 Bacteria 4505
63 Ga0114129_10539709 3300009147 Bacteria 1518
64 Ga0105243_10006684 3300009148 Bacteria 8904
65 Ga0105239_10034117 3300010375 Bacteria 5587
66 Ga0105246_10030404 3300011119 Bacteria 3566
67 Ga0157372_10043346 3300013307 Bacteria 4981
68 Ga0157380_10032583 3300014326 Bacteria 4010
69 Ga0157377_10015544 3300014745 Bacteria 3897
70 Ga0163161_10064535 3300017792 Bacteria 2671
71 Ga0206354_11206104 3300020081 Bacteria 1161
72 Ga0213874_10011724 3300021377 Bacteria 2229
73 Ga0213876_10013153 3300021384 Bacteria 4397
74 Ga0213875_10003733 3300021388 Bacteria 8574
75 Ga0207692_10000005 3300025898 Bacteria 370169
76 Ga0207710_10046141 3300025900 Bacteria 1945
77 Ga0207688_10007608 3300025901 Bacteria 5897
78 Ga0207647_10147520 3300025904 Bacteria 1376
79 Ga0207695_10055795 3300025913 Bacteria 4115
80 Ga0207657_10002526 3300025919 Bacteria 19797
81 Ga0207657_10048231 3300025919 Bacteria 3719
82 Ga0207681_10230166 3300025923 Bacteria 1438
83 Ga0207659_10112690 3300025926 Bacteria 2070
84 Ga0207687_10131098 3300025927 Bacteria 1890
85 Ga0207687_10139252 3300025927 Bacteria 1839
86 Ga0207664_10000046 3300025929 Bacteria 140749
87 Ga0207644_10066716 3300025931 Bacteria 2621
88 Ga0207690_10000460 3300025932 Bacteria 26175
89 Ga0207690_10101297 3300025932 Bacteria 2057
90 Ga0207706_10028385 3300025933 Bacteria 4998
91 Ga0207706_10090280 3300025933 Bacteria 2694
92 Ga0207709_10011056 3300025935 Bacteria 4978
93 Ga0207691_10029425 3300025940 Bacteria 5139
94 Ga0207661_10070417 3300025944 Bacteria 2855
95 Ga0207661_10091198 3300025944 Bacteria 2539
96 Ga0207661_10162828 3300025944 Bacteria 1936
97 Ga0207661_10249423 3300025944 Bacteria 1577
98 Ga0207668_10142264 3300025972 Bacteria 1846
99 Ga0207640_10016803 3300025981 Bacteria 4266
100 Ga0207677_10097409 3300026023 Bacteria 2155
101 Ga0207678_10008022 3300026067 Bacteria 9307
102 Ga0207708_10010956 3300026075 Bacteria 6745
103 Ga0207708_10211249 3300026075 Bacteria 1551
104 Ga0207674_10107311 3300026116 Bacteria 2769
105 Ga0207675_100002581 3300026118 Bacteria 17948
106 Ga0207698_10190173 3300026142 Bacteria 1827
107 Ga0207428_10031680 3300027907 Bacteria 4359
108 Ga0265330_10023643 3300031235 Bacteria 2789
109 Ga0265332_10000062 3300031238 Bacteria 95133
110 Ga0265331_10000036 3300031250 Bacteria 199058
111 Ga0265316_10000011 3300031344 Bacteria 227018
112 Ga0307408_100279358 3300031548 Bacteria 1390
113 Ga0265314_10000838 3300031711 Bacteria 36362
114 Ga0265342_10003698 3300031712 Bacteria 12401
115 Ga0307405_10040962 3300031731 Bacteria 2809
116 Ga0307410_10126848 3300031852 Bacteria 1869
117 Ga0307406_10034908 3300031901 Bacteria 3088
118 Ga0307406_10135238 3300031901 Bacteria 1736
119 Ga0307407_10258608 3300031903 Bacteria 1196
120 Ga0307412_10053560 3300031911 Bacteria 2675
121 Ga0307409_100018012 3300031995 Bacteria 4729
122 Ga0307409_100039293 3300031995 Bacteria 3510
123 Ga0307409_100040851 3300031995 Bacteria 3458
124 Ga0307409_100060485 3300031995 Bacteria 2954
125 Ga0307409_100066841 3300031995 Bacteria 2836
126 Ga0307409_100339937 3300031995 Bacteria 1412
127 Ga0307416_100010974 3300032002 Bacteria 6013
128 Ga0307416_100012581 3300032002 Bacteria 5710
129 Ga0307416_100026720 3300032002 Bacteria 4259
130 Ga0307416_100031282 3300032002 Bacteria 4004
131 Ga0307414_10074336 3300032004 Bacteria 2462
132 Ga0307414_10314857 3300032004 Bacteria 1330
133 Ga0307415_100004028 3300032126 Bacteria 7574
134 Ga0307415_100019421 3300032126 Bacteria 4126
135 Ga0307415_100056121 3300032126 Bacteria 2698
136 Ga0307415_100316995 3300032126 Bacteria 1298
137 Ga0316593_10018913 3300032168 Bacteria 2123
138 Ga0316592_1000646 3300033524 Bacteria 5069
139 Ga0316588_1003067 3300033528 Bacteria 2996
140 Ga0316596_1002632 3300033541 Bacteria 3849
141 Ga0373962_0006267 3300035242 Bacteria 2879
142 Ga0316574_0093973 3300035398 Unclassified 1915
143 Ga0373931_0012967 3300035691 Bacteria 4048
144 Ga0373937_0126995 3300036401 Bacteria 2380
145 Ga0316582_0121956 3300036647 Bacteria 1745
146 Ga0316584_0020738 3300036712 Bacteria 4770
147 Ga0316584_0140548 3300036712 Bacteria 1801
148 Ga0395899_0013692 3300037312 Bacteria 6201
149 Ga0395900_0083633 3300037418 Bacteria 3279
150 Ga0395900_0191676 3300037418 Bacteria 2073
151 Ga0395898_0085893 3300037466 Bacteria 3033
152 Ga0436364_0410968 3300037853 Bacteria 1478
153 Ga0436364_0854539 3300037853 Bacteria 8891
154 Ga0436364_1367462 3300037853 Bacteria 5682
155 Ga0436364_1433545 3300037853 Bacteria 8571
156 Ga0395901_0040800 3300038443 Bacteria 4807
157 Ga0395901_0208755 3300038443 Bacteria 2045
158 Ga0395901_0214710 3300038443 Bacteria 2012
159 Ga0436365_0054026 3300039437 Bacteria 3489
160 Ga0436365_0618768 3300039437 Bacteria 6664
161 Ga0436365_0861691 3300039437 Bacteria 19086
162 Ga0436365_1026576 3300039437 Bacteria 1570
163 Ga0436365_1123544 3300039437 Bacteria 6079
164 Ga0436365_1391394 3300039437 Bacteria 8914
165 Ga0436360_0946785 3300039438 Bacteria 1379
166 Ga0436363_0178938 3300039450 Bacteria 2058
167 Ga0436363_0624775 3300039450 Bacteria 22345
168 Ga0436363_1037295 3300039450 Bacteria 1574
169 Ga0436363_1053234 3300039450 Bacteria 2420
170 Ga0436362_0453141 3300039453 Bacteria 2180
171 Ga0439439_0039837 3300041406 Bacteria 1215
172 Ga0451793_1058947 3300041452 Bacteria 1983
173 Ga0466965_0086134 3300044683 Bacteria 1593
174 Ga0466961_0069822 3300044693 Bacteria 2230
175 Ga0466963_0013164 3300044694 Bacteria 5075
176 Ga0466963_0023969 3300044694 Bacteria 3881
177 Ga0466963_0097359 3300044694 Bacteria 2010
178 Ga0466963_0187934 3300044694 Bacteria 1443
179 Ga0466963_0214709 3300044694 Bacteria 1347
180 Ga0466971_0007113 3300044719 Bacteria 4871
181 Ga0466971_0080223 3300044719 Bacteria 1487
182 Ga0466970_0100893 3300044765 Bacteria 1572
183 Ga0466957_0009748 3300044842 Bacteria 5486
184 Ga0466957_0061450 3300044842 Bacteria 2306
185 Ga0466960_0005100 3300044901 Bacteria 5192
186 Ga0466960_0017644 3300044901 Bacteria 3116
187 Ga0466960_0158221 3300044901 Bacteria 1215
188 Ga0466959_0013597 3300045049 Bacteria 5902
189 Ga0466959_0043711 3300045049 Bacteria 3301
190 Ga0466959_0058792 3300045049 Bacteria 2800
191 Ga0466959_0081232 3300045049 Bacteria 2336
192 Ga0466958_0000631 3300045836 Bacteria 15115
193 Ga0466958_0004843 3300045836 Bacteria 7166
194 Ga0466958_0024931 3300045836 Bacteria 3522
195 Ga0466958_0038383 3300045836 Bacteria 2873
196 Ga0466958_0073692 3300045836 Bacteria 2091
197 Ga0466967_0150368 3300045976 Bacteria 2175
198 Ga0495629_0014992 3300046459 Bacteria 5569
199 Ga0495652_0000546 3300046529 Bacteria 44003
200 Ga0495640_0085955 3300046533 Bacteria 2083
201 Ga0495622_0000966 3300046557 Bacteria 15427
202 Ga0495674_0000064 3300047319 Bacteria 71275
203 Ga0495593_0152948 3300047673 Bacteria 1166
204 Ga0496100_0000118 3300048903 Bacteria 45414
205 Ga0496100_0000275 3300048903 Bacteria 26123
206 Ga0496101_0000062 3300048904 Bacteria 126595
207 Ga0496101_0001101 3300048904 Bacteria 16046
208 Ga0496102_0080438 3300048905 Bacteria 3002
209 Ga0496102_0278749 3300048905 Bacteria 1576
210 Ga0496104_0017080 3300048907 Bacteria 6604
211 Ga0496106_0000122 3300048909 Bacteria 59816
212 Ga0496106_0064672 3300048909 Bacteria 2783
213 Ga0496107_0000006 3300048910 Bacteria 258746
214 Ga0496108_0001486 3300048911 Bacteria 18524
215 Ga0496108_0038956 3300048911 Bacteria 3961
216 Ga0496108_0073835 3300048911 Bacteria 2879
217 Ga0496109_0001736 3300048912 Bacteria 18198
218 Ga0496109_0003317 3300048912 Bacteria 13453
219 Ga0496110_0010459 3300048913 Bacteria 7547
220 Ga0496110_0101962 3300048913 Bacteria 2573
221 Ga0496110_0160420 3300048913 Bacteria 2038
222 Ga0496111_0134859 3300048914 Bacteria 1828
223 Ga0496111_0237699 3300048914 Bacteria 1353
224 Ga0496112_0006664 3300048915 Bacteria 10165
225 Ga0496112_0175372 3300048915 Bacteria 2109
226 Ga0496113_0003624 3300048916 Bacteria 9282
227 Ga0496113_0037019 3300048916 Bacteria 3578
228 Ga0496115_0031089 3300048918 Bacteria 4204
229 Ga0501034_0012525 3300049571 Bacteria 8755
230 Ga0501036_0097514 3300049572 Bacteria 2485
231 Ga0501046_0179696 3300049580 Bacteria 1583
232 Ga0501047_0141614 3300049581 Bacteria 2283
233 Ga0501071_0245591 3300049587 Bacteria 1350
234 Ga0501075_0315551 3300049591 Bacteria 1191
235 Ga0501044_0156611 3300049823 Bacteria 2257
236 nmdc:mga0yw44_19422_c1 3300050492 Bacteria 3748
237 nmdc:mga0yw44_20497_c1 3300050492 Bacteria 3670
238 nmdc:mga05p37_10033_c1 3300050507 Bacteria 11239
239 nmdc:mga05p37_280762_c1 3300050507 Bacteria 1986
240 nmdc:mga05p37_352679_c1 3300050507 Bacteria 1732
241 nmdc:mga05p37_57963_c1 3300050507 Bacteria 4769
242 nmdc:mga05p37_9006_c1 3300050507 Bacteria 11805
243 nmdc:mga09592_5164_c1 3300050508 Bacteria 10606
244 nmdc:mga0qj67_239291_c1 3300050509 Bacteria 1473
245 nmdc:mga0qj67_55092_c1 3300050509 Bacteria 3150
246 nmdc:mga06r32_163939_c1 3300050510 Bacteria 2205
247 nmdc:mga06r32_48807_c1 3300050510 Bacteria 4048
248 nmdc:mga08y16_200869_c1 3300050511 Bacteria 2066
249 nmdc:mga08y16_99699_c1 3300050511 Bacteria 3025
250 nmdc:mga0n895_408144_c1 3300050512 Bacteria 1374
251 nmdc:mga0n895_6641_c1 3300050512 Bacteria 9854
252 nmdc:mga0a205_46851_c1 3300050515 Bacteria 4170
253 nmdc:mga0a205_72528_c1 3300050515 Bacteria 3326
254 Ga0500568_0000726 3300053139 Bacteria 23622
255 Ga0500573_0004309 3300053140 Bacteria 7469
256 Ga0501084_0056257 3300054114 Bacteria 3291
257 Ga0501084_0167573 3300054114 Bacteria 1854
258 Ga0501082_0118858 3300060353 Bacteria 2290
259 Ga0466962_0156154 3300061719 Bacteria 1108
260 Ga0068860_100022534
261 LJQas_1000989
262 Ga0070658_10017233
263 Ga0070683_100049471
264 Ga0070683_100068554
265 Ga0070683_100184632
266 Ga0070682_100228962
267 Ga0068868_100262903
268 Ga0070660_100022704
269 Ga0070668_100007914
270 Ga0070668_100055133
271 Ga0070659_100000765
272 Ga0070659_100023750
273 Ga0070710_10000009
274 Ga0070705_100023016
275 Ga0070663_100024857
276 Ga0070662_100006026
277 Ga0068867_100072577
278 Ga0070685_10160386
279 Ga0070684_100125626
280 Ga0070684_100211526
281 Ga0070696_100122903
282 Ga0068854_100021472
283 Ga0068856_100052765
284 Ga0068859_100460042
285 Ga0068861_100269800
286 Ga0068851_10003351
287 Ga0081455_10078140
288 Ga0081538_10000513
289 Ga0081538_10000855
290 Ga0081538_10001044
291 Ga0081538_10003262
292 Ga0081538_10008194
293 Ga0081538_10030326
294 Ga0081539_10006660
295 Ga0081539_10010069
296 Ga0081539_10027449
297 Ga0081539_10063370
298 Ga0070717_10000013
299 Ga0075365_10020898
300 Ga0075365_10023446
301 Ga0075365_10065101
302 Ga0075363_100007747
303 Ga0070715_10145815
304 Ga0075428_100007521
305 Ga0075430_100009050
306 Ga0075431_100012194
307 Ga0075433_10105669
308 Ga0075433_10180417
309 Ga0075434_100056024
310 Ga0075429_100006435
311 Ga0075429_100299547
312 Ga0097620_100460004
313 Ga0075435_100113842
314 Ga0105240_10043184
315 Ga0111539_10066110
316 Ga0105245_10005584
317 Ga0105247_10079049
318 Ga0105247_10097396
319 Ga0114129_10028901
320 Ga0114129_10030387
321 Ga0114129_10081240
322 Ga0114129_10539709
323 Ga0105243_10006684
324 Ga0105239_10034117
325 Ga0105246_10030404
326 Ga0157372_10043346
327 Ga0157380_10032583
328 Ga0157377_10015544
329 Ga0163161_10064535
330 Ga0206354_11206104
331 Ga0213874_10011724
332 Ga0213876_10013153
333 Ga0213875_10003733
334 Ga0207692_10000005
335 Ga0207710_10046141
336 Ga0207688_10007608
337 Ga0207647_10147520
338 Ga0207695_10055795
339 Ga0207657_10002526
340 Ga0207657_10048231
341 Ga0207681_10230166
342 Ga0207659_10112690
343 Ga0207687_10131098
344 Ga0207687_10139252
345 Ga0207664_10000046
346 Ga0207644_10066716
347 Ga0207690_10000460
348 Ga0207690_10101297
349 Ga0207706_10028385
350 Ga0207706_10090280
351 Ga0207709_10011056
352 Ga0207691_10029425
353 Ga0207661_10070417
354 Ga0207661_10091198
355 Ga0207661_10162828
356 Ga0207661_10249423
357 Ga0207668_10142264
358 Ga0207640_10016803
359 Ga0207677_10097409
360 Ga0207678_10008022
361 Ga0207708_10010956
362 Ga0207708_10211249
363 Ga0207674_10107311
364 Ga0207675_100002581
365 Ga0207698_10190173
366 Ga0207428_10031680
367 Ga0265330_10023643
368 Ga0265332_10000062
369 Ga0265331_10000036
370 Ga0265316_10000011
371 Ga0307408_100279358
372 Ga0265314_10000838
373 Ga0265342_10003698
374 Ga0307405_10040962
375 Ga0307410_10126848
376 Ga0307406_10034908
377 Ga0307406_10135238
378 Ga0307407_10258608
379 Ga0307412_10053560
380 Ga0307409_100018012
381 Ga0307409_100039293
382 Ga0307409_100040851
383 Ga0307409_100060485
384 Ga0307409_100066841
385 Ga0307409_100339937
386 Ga0307416_100010974
387 Ga0307416_100012581
388 Ga0307416_100026720
389 Ga0307416_100031282
390 Ga0307414_10074336
391 Ga0307414_10314857
392 Ga0307415_100004028
393 Ga0307415_100019421
394 Ga0307415_100056121
395 Ga0307415_100316995
396 Ga0316593_10018913
397 Ga0316592_1000646
398 Ga0316588_1003067
399 Ga0316596_1002632
400 Ga0373962_0006267
401 Ga0316574_0093973
402 Ga0373931_0012967
403 Ga0373937_0126995
404 Ga0316582_0121956
405 Ga0316584_0020738
406 Ga0316584_0140548
407 Ga0395899_0013692
408 Ga0395900_0083633
409 Ga0395900_0191676
410 Ga0395898_0085893
411 Ga0436364_0410968
412 Ga0436364_0854539
413 Ga0436364_1367462
414 Ga0436364_1433545
415 Ga0395901_0040800
416 Ga0395901_0208755
417 Ga0395901_0214710
418 Ga0436365_0054026
419 Ga0436365_0618768
420 Ga0436365_0861691
421 Ga0436365_1026576
422 Ga0436365_1123544
423 Ga0436365_1391394
424 Ga0436360_0946785
425 Ga0436363_0178938
426 Ga0436363_0624775
427 Ga0436363_1037295
428 Ga0436363_1053234
429 Ga0436362_0453141
430 Ga0439439_0039837
431 Ga0451793_1058947
432 Ga0466965_0086134
433 Ga0466961_0069822
434 Ga0466963_0013164
435 Ga0466963_0023969
436 Ga0466963_0097359
437 Ga0466963_0187934
438 Ga0466963_0214709
439 Ga0466971_0007113
440 Ga0466971_0080223
441 Ga0466970_0100893
442 Ga0466957_0009748
443 Ga0466957_0061450
444 Ga0466960_0005100
445 Ga0466960_0017644
446 Ga0466960_0158221
447 Ga0466959_0013597
448 Ga0466959_0043711
449 Ga0466959_0058792
450 Ga0466959_0081232
451 Ga0466958_0000631
452 Ga0466958_0004843
453 Ga0466958_0024931
454 Ga0466958_0038383
455 Ga0466958_0073692
456 Ga0466967_0150368
457 Ga0495629_0014992
458 Ga0495652_0000546
459 Ga0495640_0085955
460 Ga0495622_0000966
461 Ga0495674_0000064
462 Ga0495593_0152948
463 Ga0496100_0000118
464 Ga0496100_0000275
465 Ga0496101_0000062
466 Ga0496101_0001101
467 Ga0496102_0080438
468 Ga0496102_0278749
469 Ga0496104_0017080
470 Ga0496106_0000122
471 Ga0496106_0064672
472 Ga0496107_0000006
473 Ga0496108_0001486
474 Ga0496108_0038956
475 Ga0496108_0073835
476 Ga0496109_0001736
477 Ga0496109_0003317
478 Ga0496110_0010459
479 Ga0496110_0101962
480 Ga0496110_0160420
481 Ga0496111_0134859
482 Ga0496111_0237699
483 Ga0496112_0006664
484 Ga0496112_0175372
485 Ga0496113_0003624
486 Ga0496113_0037019
487 Ga0496115_0031089
488 Ga0501034_0012525
489 Ga0501036_0097514
490 Ga0501046_0179696
491 Ga0501047_0141614
492 Ga0501071_0245591
493 Ga0501075_0315551
494 Ga0501044_0156611
495 nmdc:mga0yw44_19422_c1
496 nmdc:mga0yw44_20497_c1
497 nmdc:mga05p37_10033_c1
498 nmdc:mga05p37_280762_c1
499 nmdc:mga05p37_352679_c1
500 nmdc:mga05p37_57963_c1
501 nmdc:mga05p37_9006_c1
502 nmdc:mga09592_5164_c1
503 nmdc:mga0qj67_239291_c1
504 nmdc:mga0qj67_55092_c1
505 nmdc:mga06r32_163939_c1
506 nmdc:mga06r32_48807_c1
507 nmdc:mga08y16_200869_c1
508 nmdc:mga08y16_99699_c1
509 nmdc:mga0n895_408144_c1
510 nmdc:mga0n895_6641_c1
511 nmdc:mga0a205_46851_c1
512 nmdc:mga0a205_72528_c1
513 Ga0500568_0000726
514 Ga0500573_0004309
515 Ga0501084_0056257
516 Ga0501084_0167573
517 Ga0501082_0118858
518 Ga0466962_0156154

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03328

HpcH_HpaI

HpcH/HpaI aldolase/citrate lyase family

1

250

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4l9y-assembly1.cif.gz_B crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, glyoxylate, and propionyl-coa 0.9376 21 288
3qll-assembly1.cif.gz_A crystal structure of ripc from yersinia pestis 0.9184 27 290
4l9y-assembly1.cif.gz_B crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, glyoxylate, and propionyl-coa 0.9102 21 288
1u5h-assembly1.cif.gz_A structure of citrate lyase beta subunit from mycobacterium tuberculosis 0.8792 26 289
3qll-assembly1.cif.gz_A crystal structure of ripc from yersinia pestis 0.8776 27 290
ID Description Score Start End Superfamily
4l9yB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9376 21 288 3.20.20.60
4l9yB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9102 21 288 3.20.20.60
3qllC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.91 27 288 3.20.20.60
3qllC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8608 27 288 3.20.20.60
1sgjA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8604 28 288 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A3C1FNW7-F1-model_v4 CoA ester lyase 0.9739 1 193 GO:0000287
GO:0006107
GO:0016829
AF-A0A529JPZ5-F1-model_v4 CoA ester lyase 0.9699 86 174 GO:0000287
GO:0006107
GO:0016829
AF-A0A3B9BFB8-F1-model_v4 CoA ester lyase 0.969 1 160 GO:0000287
GO:0006107
GO:0016829
AF-A0A3C1FNW7-F1-model_v4 CoA ester lyase 0.969 1 193 GO:0000287
GO:0006107
GO:0016829
AF-A0A2D8HSM5-F1-model_v4 CoA ester lyase 0.9654 1 163 GO:0000287
GO:0006107
GO:0016829

Map