F368538

General Info

Members Datasets Scaffolds Average Seq Length
259 138 518 121

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10013990|Ga0065712_100139903
Length 132
Sequence VTDIVTAVVWLAGSAFALLAAVGVLRMPDVFTRMQAATKASTLGLGCLLIGAALQMGDFASFIRAASIGAFVLLTTPVSGLVIARAAYFADVPLWEGTVLDERKRDSVRATRGGLSAQGNNNEGFDGDLKER

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
87 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
88 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
89 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
90 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
91 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
92 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
93 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
94 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
95 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
96 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
97 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
98 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
99 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
100 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
101 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
102 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
103 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
104 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
105 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
112 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
113 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
114 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
115 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
116 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
117 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
118 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
121 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
122 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
123 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
125 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
126 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
127 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
128 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
129 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
130 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
131 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
132 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
133 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
136 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
137 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
138 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.27
Nodule 0
Rhizoplane 0.39
Rhizosphere 89.58
Stem 0
Stem Tuber 0
Unclassified 25.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10013990 3300005290 Bacteria 2383
2 Ga0065712_10097112 3300005290 Bacteria 2161
3 Ga0065715_10181044 3300005293 Unclassified 1476
4 Ga0065707_10108452 3300005295 Unclassified 2510
5 Ga0070670_100017785 3300005331 Bacteria 6099
6 Ga0070666_10645801 3300005335 Unclassified 774
7 Ga0070689_101093902 3300005340 Bacteria 712
8 Ga0070668_100340541 3300005347 Bacteria 1267
9 Ga0070668_100685768 3300005347 Bacteria 902
10 Ga0070669_100008204 3300005353 Bacteria 7460
11 Ga0070669_100047353 3300005353 Bacteria 3136
12 Ga0070675_100035646 3300005354 Bacteria 4044
13 Ga0070675_100212347 3300005354 Bacteria 1682
14 Ga0070675_100865444 3300005354 Bacteria 827
15 Ga0070675_101652992 3300005354 Unclassified 591
16 Ga0070675_101691272 3300005354 Unclassified 584
17 Ga0070671_100509723 3300005355 Bacteria 1035
18 Ga0070674_100116760 3300005356 Unclassified 1969
19 Ga0070674_100142772 3300005356 Unclassified 1799
20 Ga0070673_100089506 3300005364 Bacteria 2512
21 Ga0070673_100499019 3300005364 Unclassified 1100
22 Ga0070688_100133962 3300005365 Unclassified 1675
23 Ga0070700_100123663 3300005441 Bacteria 1737
24 Ga0070700_100980221 3300005441 Unclassified 693
25 Ga0070678_100057526 3300005456 Bacteria 2849
26 Ga0070662_100447221 3300005457 Unclassified 1072
27 Ga0070662_100961330 3300005457 Bacteria 730
28 Ga0070672_100004565 3300005543 Bacteria 9064
29 Ga0070672_100164742 3300005543 Bacteria 1841
30 Ga0070696_100076767 3300005546 Bacteria 2359
31 Ga0070665_100047750 3300005548 Bacteria 4296
32 Ga0070665_100304957 3300005548 Bacteria 1595
33 Ga0070665_100378509 3300005548 Unclassified 1423
34 Ga0070665_100432732 3300005548 Unclassified 1325
35 Ga0070665_101527251 3300005548 Unclassified 676
36 Ga0068859_101652083 3300005617 Bacteria 707
37 Ga0068859_101807305 3300005617 Bacteria 675
38 Ga0068864_100620014 3300005618 Unclassified 1051
39 Ga0068861_100145606 3300005719 Archaea 1938
40 Ga0068861_100170115 3300005719 Bacteria 1805
41 Ga0068861_100772813 3300005719 Bacteria 899
42 Ga0068861_100984030 3300005719 Unclassified 804
43 Ga0068870_10101499 3300005840 Unclassified 1627
44 Ga0068858_101383648 3300005842 Bacteria 693
45 Ga0068858_101993374 3300005842 Bacteria 574
46 Ga0068860_101973739 3300005843 Unclassified 605
47 Ga0068862_100271555 3300005844 Bacteria 1551
48 Ga0068862_102647301 3300005844 Unclassified 513
49 Ga0075365_10400075 3300006038 Unclassified 969
50 Ga0075368_10063500 3300006042 Unclassified 1482
51 Ga0075368_10247038 3300006042 Bacteria 762
52 Ga0075363_100121016 3300006048 Bacteria 1462
53 Ga0075363_100915347 3300006048 Bacteria 537
54 Ga0075364_10029111 3300006051 Bacteria 3540
55 Ga0075364_10389828 3300006051 Unclassified 950
56 Ga0075367_10004938 3300006178 Bacteria 6574
57 Ga0075367_10015378 3300006178 Bacteria 4158
58 Ga0075427_10039287 3300006194 Bacteria 794
59 Ga0075366_10035713 3300006195 Bacteria 2931
60 Ga0075370_10161195 3300006353 Bacteria 1316
61 Ga0075428_100003380 3300006844 Bacteria 17454
62 Ga0075428_100057286 3300006844 Bacteria 4266
63 Ga0075428_100091460 3300006844 Bacteria 3318
64 Ga0075430_100013689 3300006846 Bacteria 6916
65 Ga0075430_100093666 3300006846 Bacteria 2511
66 Ga0075430_100387081 3300006846 Bacteria 1154
67 Ga0075431_100011684 3300006847 Bacteria 8860
68 Ga0075431_100053077 3300006847 Bacteria 4179
69 Ga0075431_100196188 3300006847 Bacteria 2067
70 Ga0075431_100201281 3300006847 Unclassified 2037
71 Ga0075431_100967451 3300006847 Unclassified 819
72 Ga0075429_100093405 3300006880 Bacteria 2624
73 Ga0068865_100581643 3300006881 Unclassified 944
74 Ga0097620_101652036 3300006931 Bacteria 707
75 Ga0097620_101807917 3300006931 Bacteria 675
76 Ga0111539_10000435 3300009094 Bacteria 52742
77 Ga0111539_10001942 3300009094 Bacteria 27552
78 Ga0111539_10005117 3300009094 Bacteria 17008
79 Ga0111539_10227988 3300009094 Bacteria 2170
80 Ga0111539_10945051 3300009094 Bacteria 1002
81 Ga0111539_11282291 3300009094 Bacteria 850
82 Ga0111539_11518518 3300009094 Unclassified 777
83 Ga0111539_11749897 3300009094 Bacteria 721
84 Ga0111539_12729293 3300009094 Bacteria 572
85 Ga0111539_13115782 3300009094 Bacteria 535
86 Ga0114129_10010365 3300009147 Bacteria 13292
87 Ga0114129_10236208 3300009147 Bacteria 2459
88 Ga0114129_10336051 3300009147 Bacteria 2005
89 Ga0105248_12081101 3300009177 Bacteria 645
90 Ga0105249_11307855 3300009553 Bacteria 796
91 Ga0157375_10072144 3300013308 Unclassified 3469
92 Ga0163163_10182315 3300014325 Bacteria 2147
93 Ga0163163_12617527 3300014325 Bacteria 562
94 Ga0157380_10353870 3300014326 Bacteria 1375
95 Ga0157380_11086340 3300014326 Bacteria 838
96 Ga0157380_11289925 3300014326 Unclassified 777
97 Ga0157380_11394989 3300014326 Bacteria 751
98 Ga0157377_10413105 3300014745 Unclassified 922
99 Ga0163161_10215473 3300017792 Unclassified 1485
100 Ga0207697_10194707 3300025315 Bacteria 890
101 Ga0207688_10043531 3300025901 Bacteria 2500
102 Ga0207688_10135200 3300025901 Bacteria 1448
103 Ga0207688_10850121 3300025901 Unclassified 578
104 Ga0207645_10151414 3300025907 Bacteria 1514
105 Ga0207643_10030867 3300025908 Bacteria 2985
106 Ga0207643_10794781 3300025908 Bacteria 613
107 Ga0207662_10829764 3300025918 Unclassified 653
108 Ga0207681_10014350 3300025923 Bacteria 4922
109 Ga0207681_10767380 3300025923 Unclassified 804
110 Ga0207650_10334118 3300025925 Unclassified 1243
111 Ga0207659_10044320 3300025926 Unclassified 3129
112 Ga0207659_10196646 3300025926 Bacteria 1607
113 Ga0207659_10544406 3300025926 Bacteria 986
114 Ga0207644_10192906 3300025931 Bacteria 1603
115 Ga0207706_10168952 3300025933 Bacteria 1922
116 Ga0207706_10211432 3300025933 Bacteria 1700
117 Ga0207670_10997982 3300025936 Bacteria 704
118 Ga0207669_10146687 3300025937 Bacteria 1646
119 Ga0207669_10245992 3300025937 Unclassified 1328
120 Ga0207669_10355125 3300025937 Bacteria 1134
121 Ga0207704_10109304 3300025938 Unclassified 1864
122 Ga0207691_10088289 3300025940 Bacteria 2781
123 Ga0207691_10175297 3300025940 Bacteria 1876
124 Ga0207691_10261710 3300025940 Unclassified 1491
125 Ga0207679_10476159 3300025945 Unclassified 1111
126 Ga0207651_10281912 3300025960 Unclassified 1374
127 Ga0207651_10444781 3300025960 Unclassified 1111
128 Ga0207712_11597011 3300025961 Unclassified 584
129 Ga0207668_10031238 3300025972 Bacteria 3506
130 Ga0207668_10049179 3300025972 Bacteria 2897
131 Ga0207668_10104131 3300025972 Bacteria 2115
132 Ga0207668_10845908 3300025972 Bacteria 812
133 Ga0207708_10108183 3300026075 Bacteria 2156
134 Ga0207648_10032511 3300026089 Bacteria 4605
135 Ga0207675_100049992 3300026118 Bacteria 3901
136 Ga0207675_100064653 3300026118 Bacteria 3419
137 Ga0207675_100178172 3300026118 Bacteria 2034
138 Ga0207683_10080354 3300026121 Bacteria 2892
139 Ga0207683_10495062 3300026121 Unclassified 1129
140 Ga0207683_11963955 3300026121 Unclassified 534
141 Ga0209967_1028874 3300027364 Bacteria 827
142 Ga0210002_1011463 3300027617 Bacteria 1369
143 Ga0210002_1031662 3300027617 Bacteria 880
144 Ga0209983_1057325 3300027665 Bacteria 857
145 Ga0209813_10309132 3300027866 Bacteria 616
146 Ga0209813_10436054 3300027866 Unclassified 534
147 Ga0207428_10002366 3300027907 Bacteria 18833
148 Ga0207428_10055090 3300027907 Bacteria 3164
149 Ga0268266_10060657 3300028379 Bacteria 3261
150 Ga0268266_10062023 3300028379 Bacteria 3225
151 Ga0268266_10369960 3300028379 Unclassified 1350
152 Ga0268265_10512304 3300028380 Bacteria 1132
153 Ga0268265_11934375 3300028380 Unclassified 597
154 Ga0307408_100000763 3300031548 Bacteria 25884
155 Ga0307408_100315210 3300031548 Bacteria 1316
156 Ga0307405_10517833 3300031731 Bacteria 959
157 Ga0307410_10465686 3300031852 Bacteria 1034
158 Ga0307407_10180962 3300031903 Bacteria 1397
159 Ga0307412_10219955 3300031911 Bacteria 1455
160 Ga0307409_100248826 3300031995 Bacteria 1624
161 Ga0307409_100319327 3300031995 Bacteria 1453
162 Ga0307416_100009122 3300032002 Bacteria 6466
163 Ga0307416_100193807 3300032002 Bacteria 1920
164 Ga0307416_100473270 3300032002 Bacteria 1311
165 Ga0307411_10038388 3300032005 Bacteria 3021
166 Ga0307411_10934911 3300032005 Unclassified 772
167 Ga0451802_0946640 3300041460 Bacteria 719
168 Ga0451853_0561426 3300041512 Bacteria 802
169 Ga0451853_1072509 3300041512 Bacteria 712
170 Ga0439433_0152310 3300041999 Unclassified 596
171 Ga0439441_007437 3300042001 Bacteria 1764
172 Ga0439450_014342 3300042008 Unclassified 1606
173 Ga0450921_015117 3300042123 Bacteria 691
174 Ga0450923_028825 3300042125 Bacteria 1123
175 Ga0450894_003851 3300042131 Bacteria 1963
176 Ga0450895_007522 3300042132 Bacteria 902
177 Ga0450908_011302 3300042184 Bacteria 1635
178 Ga0439435_0061207 3300042436 Unclassified 1097
179 Ga0439464_0016778 3300042439 Unclassified 1983
180 Ga0439464_0017849 3300042439 Bacteria 1927
181 Ga0450918_012863 3300042531 Bacteria 1456
182 Ga0439440_0103404 3300042993 Bacteria 777
183 Ga0439440_0105363 3300042993 Bacteria 771
184 Ga0495643_0013201 3300046522 Bacteria 4954
185 Ga0501291_020179 3300049514 Bacteria 1052
186 Ga0501298_035735 3300049521 Unclassified 992
187 Ga0501303_003949 3300049526 Bacteria 1209
188 Ga0501031_0148460 3300049568 Bacteria 1532
189 Ga0501036_0092167 3300049572 Bacteria 2560
190 Ga0501037_0984744 3300049573 Bacteria 550
191 Ga0501041_0193362 3300049577 Unclassified 1275
192 Ga0501041_0576162 3300049577 Bacteria 718
193 Ga0501042_0062610 3300049578 Bacteria 2658
194 Ga0501048_0129193 3300049582 Bacteria 1787
195 Ga0501048_0540228 3300049582 Bacteria 836
196 Ga0501068_0320108 3300049584 Bacteria 994
197 Ga0501068_0675516 3300049584 Unclassified 675
198 Ga0501069_0401025 3300049585 Bacteria 812
199 Ga0501072_0067576 3300049588 Bacteria 2820
200 Ga0501072_0612935 3300049588 Bacteria 858
201 Ga0501072_0721808 3300049588 Unclassified 783
202 Ga0501074_0076935 3300049590 Bacteria 2395
203 Ga0501074_0124067 3300049590 Unclassified 1847
204 Ga0501075_0210330 3300049591 Bacteria 1484
205 Ga0501075_0424571 3300049591 Bacteria 1014
206 Ga0501075_0568187 3300049591 Bacteria 865
207 Ga0501075_0575449 3300049591 Bacteria 859
208 Ga0501076_0324840 3300049592 Bacteria 1262
209 Ga0501076_0380187 3300049592 Bacteria 1161
210 Ga0501076_0415294 3300049592 Unclassified 1107
211 Ga0501076_0483168 3300049592 Bacteria 1021
212 Ga0501076_0553749 3300049592 Bacteria 948
213 Ga0501077_0923603 3300049593 Unclassified 561
214 Ga0501079_0045878 3300049741 Bacteria 3373
215 Ga0501079_0455495 3300049741 Bacteria 1005
216 Ga0501079_1562351 3300049741 Bacteria 519
217 Ga0501080_0409106 3300049742 Bacteria 1220
218 Ga0501081_0987464 3300049743 Bacteria 636
219 Ga0501081_1376565 3300049743 Unclassified 535
220 Ga0501083_0140409 3300049744 Bacteria 1582
221 Ga0501083_0930609 3300049744 Unclassified 566
222 Ga0501283_064326 3300049779 Bacteria 667
223 Ga0501035_1144709 3300049822 Bacteria 606
224 Ga0501045_0098537 3300049824 Bacteria 2163
225 Ga0501045_0436918 3300049824 Bacteria 973
226 Ga0501045_0482220 3300049824 Bacteria 921
227 nmdc:mga00v17_148446_c1 3300050491 Bacteria 1506
228 nmdc:mga00v17_150401_c1 3300050491 Bacteria 1496
229 nmdc:mga0yw44_343225_c1 3300050492 Bacteria 1004
230 nmdc:mga0yw44_745440_c1 3300050492 Bacteria 665
231 nmdc:mga06z11_12471_c1 3300050494 Bacteria 3698
232 nmdc:mga06z11_89782_c1 3300050494 Bacteria 1666
233 nmdc:mga06z11_960157_c1 3300050494 Bacteria 521
234 nmdc:mga04h51_286949_c1 3300050495 Bacteria 668
235 nmdc:mga04h51_33850_c1 3300050495 Bacteria 1629
236 nmdc:mga07m45_63648_c1 3300050496 Bacteria 2092
237 nmdc:mga07m45_9633_c1 3300050496 Bacteria 5020
238 nmdc:mga05p37_329455_c1 3300050507 Bacteria 1804
239 nmdc:mga05p37_520262_c1 3300050507 Bacteria 1361
240 nmdc:mga05p37_9592_c1 3300050507 Bacteria 11464
241 nmdc:mga09592_1420603_c1 3300050508 Unclassified 567
242 nmdc:mga09592_3651_c1 3300050508 Bacteria 12407
243 nmdc:mga0qj67_113221_c1 3300050509 Bacteria 2191
244 nmdc:mga0qj67_440927_c1 3300050509 Bacteria 1049
245 nmdc:mga0qj67_52460_c1 3300050509 Bacteria 3228
246 nmdc:mga06r32_1272656_c1 3300050510 Unclassified 680
247 nmdc:mga06r32_22502_c1 3300050510 Bacteria 5827
248 nmdc:mga06r32_74888_c1 3300050510 Bacteria 3283
249 nmdc:mga08y16_1639_c1 3300050511 Bacteria 22669
250 nmdc:mga08y16_195_c1 3300050511 Bacteria 54659
251 nmdc:mga08y16_209_c1 3300050511 Bacteria 52522
252 nmdc:mga08y16_254479_c1 3300050511 Bacteria 1814
253 Ga0501084_0028452 3300054114 Bacteria 4672
254 Ga0501084_0290467 3300054114 Bacteria 1381
255 Ga0590074_072903 3300059423 Unclassified 649
256 Ga0501082_0187856 3300060353 Bacteria 1798
257 Ga0501082_0907987 3300060353 Unclassified 770
258 Ga0501082_1074440 3300060353 Bacteria 704
259 Ga0530510_0664923 3300061734 Bacteria 793
260 Ga0065712_10013990
261 Ga0065712_10097112
262 Ga0065715_10181044
263 Ga0065707_10108452
264 Ga0070670_100017785
265 Ga0070666_10645801
266 Ga0070689_101093902
267 Ga0070668_100340541
268 Ga0070668_100685768
269 Ga0070669_100008204
270 Ga0070669_100047353
271 Ga0070675_100035646
272 Ga0070675_100212347
273 Ga0070675_100865444
274 Ga0070675_101652992
275 Ga0070675_101691272
276 Ga0070671_100509723
277 Ga0070674_100116760
278 Ga0070674_100142772
279 Ga0070673_100089506
280 Ga0070673_100499019
281 Ga0070688_100133962
282 Ga0070700_100123663
283 Ga0070700_100980221
284 Ga0070678_100057526
285 Ga0070662_100447221
286 Ga0070662_100961330
287 Ga0070672_100004565
288 Ga0070672_100164742
289 Ga0070696_100076767
290 Ga0070665_100047750
291 Ga0070665_100304957
292 Ga0070665_100378509
293 Ga0070665_100432732
294 Ga0070665_101527251
295 Ga0068859_101652083
296 Ga0068859_101807305
297 Ga0068864_100620014
298 Ga0068861_100145606
299 Ga0068861_100170115
300 Ga0068861_100772813
301 Ga0068861_100984030
302 Ga0068870_10101499
303 Ga0068858_101383648
304 Ga0068858_101993374
305 Ga0068860_101973739
306 Ga0068862_100271555
307 Ga0068862_102647301
308 Ga0075365_10400075
309 Ga0075368_10063500
310 Ga0075368_10247038
311 Ga0075363_100121016
312 Ga0075363_100915347
313 Ga0075364_10029111
314 Ga0075364_10389828
315 Ga0075367_10004938
316 Ga0075367_10015378
317 Ga0075427_10039287
318 Ga0075366_10035713
319 Ga0075370_10161195
320 Ga0075428_100003380
321 Ga0075428_100057286
322 Ga0075428_100091460
323 Ga0075430_100013689
324 Ga0075430_100093666
325 Ga0075430_100387081
326 Ga0075431_100011684
327 Ga0075431_100053077
328 Ga0075431_100196188
329 Ga0075431_100201281
330 Ga0075431_100967451
331 Ga0075429_100093405
332 Ga0068865_100581643
333 Ga0097620_101652036
334 Ga0097620_101807917
335 Ga0111539_10000435
336 Ga0111539_10001942
337 Ga0111539_10005117
338 Ga0111539_10227988
339 Ga0111539_10945051
340 Ga0111539_11282291
341 Ga0111539_11518518
342 Ga0111539_11749897
343 Ga0111539_12729293
344 Ga0111539_13115782
345 Ga0114129_10010365
346 Ga0114129_10236208
347 Ga0114129_10336051
348 Ga0105248_12081101
349 Ga0105249_11307855
350 Ga0157375_10072144
351 Ga0163163_10182315
352 Ga0163163_12617527
353 Ga0157380_10353870
354 Ga0157380_11086340
355 Ga0157380_11289925
356 Ga0157380_11394989
357 Ga0157377_10413105
358 Ga0163161_10215473
359 Ga0207697_10194707
360 Ga0207688_10043531
361 Ga0207688_10135200
362 Ga0207688_10850121
363 Ga0207645_10151414
364 Ga0207643_10030867
365 Ga0207643_10794781
366 Ga0207662_10829764
367 Ga0207681_10014350
368 Ga0207681_10767380
369 Ga0207650_10334118
370 Ga0207659_10044320
371 Ga0207659_10196646
372 Ga0207659_10544406
373 Ga0207644_10192906
374 Ga0207706_10168952
375 Ga0207706_10211432
376 Ga0207670_10997982
377 Ga0207669_10146687
378 Ga0207669_10245992
379 Ga0207669_10355125
380 Ga0207704_10109304
381 Ga0207691_10088289
382 Ga0207691_10175297
383 Ga0207691_10261710
384 Ga0207679_10476159
385 Ga0207651_10281912
386 Ga0207651_10444781
387 Ga0207712_11597011
388 Ga0207668_10031238
389 Ga0207668_10049179
390 Ga0207668_10104131
391 Ga0207668_10845908
392 Ga0207708_10108183
393 Ga0207648_10032511
394 Ga0207675_100049992
395 Ga0207675_100064653
396 Ga0207675_100178172
397 Ga0207683_10080354
398 Ga0207683_10495062
399 Ga0207683_11963955
400 Ga0209967_1028874
401 Ga0210002_1011463
402 Ga0210002_1031662
403 Ga0209983_1057325
404 Ga0209813_10309132
405 Ga0209813_10436054
406 Ga0207428_10002366
407 Ga0207428_10055090
408 Ga0268266_10060657
409 Ga0268266_10062023
410 Ga0268266_10369960
411 Ga0268265_10512304
412 Ga0268265_11934375
413 Ga0307408_100000763
414 Ga0307408_100315210
415 Ga0307405_10517833
416 Ga0307410_10465686
417 Ga0307407_10180962
418 Ga0307412_10219955
419 Ga0307409_100248826
420 Ga0307409_100319327
421 Ga0307416_100009122
422 Ga0307416_100193807
423 Ga0307416_100473270
424 Ga0307411_10038388
425 Ga0307411_10934911
426 Ga0451802_0946640
427 Ga0451853_0561426
428 Ga0451853_1072509
429 Ga0439433_0152310
430 Ga0439441_007437
431 Ga0439450_014342
432 Ga0450921_015117
433 Ga0450923_028825
434 Ga0450894_003851
435 Ga0450895_007522
436 Ga0450908_011302
437 Ga0439435_0061207
438 Ga0439464_0016778
439 Ga0439464_0017849
440 Ga0450918_012863
441 Ga0439440_0103404
442 Ga0439440_0105363
443 Ga0495643_0013201
444 Ga0501291_020179
445 Ga0501298_035735
446 Ga0501303_003949
447 Ga0501031_0148460
448 Ga0501036_0092167
449 Ga0501037_0984744
450 Ga0501041_0193362
451 Ga0501041_0576162
452 Ga0501042_0062610
453 Ga0501048_0129193
454 Ga0501048_0540228
455 Ga0501068_0320108
456 Ga0501068_0675516
457 Ga0501069_0401025
458 Ga0501072_0067576
459 Ga0501072_0612935
460 Ga0501072_0721808
461 Ga0501074_0076935
462 Ga0501074_0124067
463 Ga0501075_0210330
464 Ga0501075_0424571
465 Ga0501075_0568187
466 Ga0501075_0575449
467 Ga0501076_0324840
468 Ga0501076_0380187
469 Ga0501076_0415294
470 Ga0501076_0483168
471 Ga0501076_0553749
472 Ga0501077_0923603
473 Ga0501079_0045878
474 Ga0501079_0455495
475 Ga0501079_1562351
476 Ga0501080_0409106
477 Ga0501081_0987464
478 Ga0501081_1376565
479 Ga0501083_0140409
480 Ga0501083_0930609
481 Ga0501283_064326
482 Ga0501035_1144709
483 Ga0501045_0098537
484 Ga0501045_0436918
485 Ga0501045_0482220
486 nmdc:mga00v17_148446_c1
487 nmdc:mga00v17_150401_c1
488 nmdc:mga0yw44_343225_c1
489 nmdc:mga0yw44_745440_c1
490 nmdc:mga06z11_12471_c1
491 nmdc:mga06z11_89782_c1
492 nmdc:mga06z11_960157_c1
493 nmdc:mga04h51_286949_c1
494 nmdc:mga04h51_33850_c1
495 nmdc:mga07m45_63648_c1
496 nmdc:mga07m45_9633_c1
497 nmdc:mga05p37_329455_c1
498 nmdc:mga05p37_520262_c1
499 nmdc:mga05p37_9592_c1
500 nmdc:mga09592_1420603_c1
501 nmdc:mga09592_3651_c1
502 nmdc:mga0qj67_113221_c1
503 nmdc:mga0qj67_440927_c1
504 nmdc:mga0qj67_52460_c1
505 nmdc:mga06r32_1272656_c1
506 nmdc:mga06r32_22502_c1
507 nmdc:mga06r32_74888_c1
508 nmdc:mga08y16_1639_c1
509 nmdc:mga08y16_195_c1
510 nmdc:mga08y16_209_c1
511 nmdc:mga08y16_254479_c1
512 Ga0501084_0028452
513 Ga0501084_0290467
514 Ga0590074_072903
515 Ga0501082_0187856
516 Ga0501082_0907987
517 Ga0501082_1074440
518 Ga0530510_0664923

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03334

PhaG_MnhG_YufB

Na+/H+ antiporter subunit

9

88

0.99

Map