F368180

General Info

Members Datasets Scaffolds Average Seq Length
258 152 516 84

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10235023|Ga0307513_102350232
Length 94
Sequence MDFKFTPRAWEDYSFWQEHDIKILNRVNALIKDISRDPFKGIGKPEALKGILSGYWSRRITDEHRLVYRIETTIDAKTKRASQTLCILQARFHY

Samples

Sample ID Description Type Environment
1 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
39 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
85 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
86 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
87 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
88 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
89 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
90 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
91 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
92 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
93 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
96 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
97 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
98 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
101 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
102 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
103 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
106 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
107 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
108 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
109 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
111 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
112 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
113 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
116 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
119 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
120 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
121 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
122 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
123 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
124 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
128 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
129 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
130 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
131 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
132 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
133 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
134 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
135 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
136 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
137 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
138 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
139 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
140 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
144 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
145 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
148 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
149 2818991457 Xanthomonas translucens 569 Isolate Unclassified
150 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
151 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
152 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.67
Metatranscriptomes 0.39
Isolates 1.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.78
Nodule 0.39
Rhizoplane 0.39
Rhizosphere 83.72
Stem 0
Stem Tuber 0
Unclassified 8.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307513_10235023 3300031456 Bacteria 1643
2 rootH2_10336053 3300003320 Unclassified 1023
3 rootH1_10132551 3300003323 Bacteria 2779
4 Ga0065714_10169755 3300005288 Bacteria 1010
5 Ga0070658_10174576 3300005327 Bacteria 1807
6 Ga0070658_10936821 3300005327 Bacteria 753
7 Ga0070683_100306269 3300005329 Bacteria 1511
8 Ga0070683_101468561 3300005329 Bacteria 655
9 Ga0070690_101182183 3300005330 Bacteria 609
10 Ga0070666_10262088 3300005335 Bacteria 1226
11 Ga0070666_11137457 3300005335 Bacteria 581
12 Ga0070680_101053122 3300005336 Bacteria 703
13 Ga0070680_101604744 3300005336 Bacteria 564
14 Ga0068868_100269858 3300005338 Bacteria 1437
15 Ga0070660_100051523 3300005339 Bacteria 3170
16 Ga0070660_100537944 3300005339 Bacteria 974
17 Ga0070661_100386535 3300005344 Bacteria 1104
18 Ga0070661_100577178 3300005344 Unclassified 907
19 Ga0070692_10848670 3300005345 Unclassified 627
20 Ga0070675_100250824 3300005354 Bacteria 1549
21 Ga0070671_100772513 3300005355 Bacteria 836
22 Ga0070671_100819546 3300005355 Bacteria 811
23 Ga0070674_101189454 3300005356 Bacteria 676
24 Ga0070673_101284926 3300005364 Bacteria 687
25 Ga0070705_100019922 3300005440 Bacteria 3539
26 Ga0070678_100308441 3300005456 Bacteria 1347
27 Ga0070662_100500109 3300005457 Bacteria 1014
28 Ga0070679_100087458 3300005530 Bacteria 3103
29 Ga0070679_101174375 3300005530 Bacteria 713
30 Ga0070684_100473712 3300005535 Bacteria 1158
31 Ga0070684_101178280 3300005535 Bacteria 721
32 Ga0068853_100035285 3300005539 Bacteria 4247
33 Ga0068853_100190442 3300005539 Bacteria 1863
34 Ga0068853_101032103 3300005539 Bacteria 792
35 Ga0070672_100285112 3300005543 Bacteria 1397
36 Ga0070672_101726845 3300005543 Bacteria 562
37 Ga0070693_101415112 3300005547 Bacteria 541
38 Ga0068855_100115734 3300005563 Bacteria 3073
39 Ga0068855_101506507 3300005563 Bacteria 690
40 Ga0068857_100244586 3300005577 Bacteria 1643
41 Ga0068857_100431060 3300005577 Bacteria 1230
42 Ga0068856_101635831 3300005614 Bacteria 657
43 Ga0068852_100195166 3300005616 Bacteria 1913
44 Ga0068852_102481947 3300005616 Bacteria 539
45 Ga0068851_10036914 3300005834 Bacteria 2449
46 Ga0068851_10570376 3300005834 Unclassified 686
47 Ga0068860_100177493 3300005843 Bacteria 2059
48 Ga0068860_100417498 3300005843 Bacteria 1329
49 Ga0081455_10839318 3300005937 Bacteria 574
50 Ga0081538_10098345 3300005981 Bacteria 1483
51 Ga0075366_10233621 3300006195 Bacteria 1121
52 Ga0097621_101228445 3300006237 Bacteria 706
53 Ga0068871_102357669 3300006358 Unclassified 507
54 Ga0068865_100773900 3300006881 Bacteria 826
55 Ga0079104_1011080 3300006946 Bacteria 2924
56 Ga0099794_10364398 3300007265 Bacteria 753
57 Ga0105240_11739998 3300009093 Unclassified 650
58 Ga0105243_10564758 3300009148 Bacteria 1089
59 Ga0105241_10038062 3300009174 Bacteria 3627
60 Ga0105241_10440656 3300009174 Bacteria 1150
61 Ga0105241_11211428 3300009174 Bacteria 715
62 Ga0105242_10852276 3300009176 Bacteria 907
63 Ga0105237_10112755 3300009545 Bacteria 2711
64 Ga0105237_10913017 3300009545 Bacteria 885
65 Ga0105238_10366288 3300009551 Bacteria 1431
66 Ga0105239_10001953 3300010375 Bacteria 26885
67 Ga0105239_10026571 3300010375 Bacteria 6372
68 Ga0105239_10109149 3300010375 Bacteria 3066
69 Ga0105239_10220080 3300010375 Bacteria 2129
70 Ga0105239_11909002 3300010375 Bacteria 689
71 Ga0105246_10024533 3300011119 Bacteria 3919
72 Ga0157373_10023076 3300013100 Bacteria 4512
73 Ga0157373_10182981 3300013100 Bacteria 1476
74 Ga0157371_10896737 3300013102 Bacteria 672
75 Ga0157371_11330123 3300013102 Bacteria 557
76 Ga0157369_10012729 3300013105 Bacteria 9539
77 Ga0157369_10535029 3300013105 Bacteria 1211
78 Ga0157374_10018354 3300013296 Bacteria 6172
79 Ga0157374_10487865 3300013296 Bacteria 1236
80 Ga0157374_10646474 3300013296 Unclassified 1069
81 Ga0157372_10005908 3300013307 Bacteria 13031
82 Ga0157372_10034351 3300013307 Bacteria 5574
83 Ga0157372_10133367 3300013307 Bacteria 2859
84 Ga0157372_11138062 3300013307 Bacteria 903
85 Ga0163163_10248177 3300014325 Bacteria 1830
86 Ga0182008_10324044 3300014497 Bacteria 811
87 Ga0157376_10750012 3300014969 Bacteria 985
88 Ga0213874_10179445 3300021377 Unclassified 753
89 Ga0213876_10039116 3300021384 Unclassified 2505
90 Ga0207656_10083850 3300025321 Bacteria 1437
91 Ga0207656_10286153 3300025321 Unclassified 814
92 Ga0207688_10397125 3300025901 Bacteria 855
93 Ga0207680_10266610 3300025903 Bacteria 1187
94 Ga0207647_10003579 3300025904 Bacteria 11646
95 Ga0207705_10181435 3300025909 Bacteria 1589
96 Ga0207705_10886730 3300025909 Bacteria 691
97 Ga0207654_10264080 3300025911 Bacteria 1159
98 Ga0207654_10265852 3300025911 Bacteria 1155
99 Ga0207707_10783466 3300025912 Bacteria 795
100 Ga0207671_10026650 3300025914 Bacteria 4328
101 Ga0207671_10909491 3300025914 Bacteria 695
102 Ga0207660_10850212 3300025917 Bacteria 745
103 Ga0207660_11209621 3300025917 Bacteria 615
104 Ga0207657_10008435 3300025919 Bacteria 10457
105 Ga0207657_10499390 3300025919 Bacteria 953
106 Ga0207649_10574598 3300025920 Bacteria 865
107 Ga0207652_10342505 3300025921 Bacteria 1350
108 Ga0207694_10740798 3300025924 Bacteria 829
109 Ga0207659_10143904 3300025926 Bacteria 1854
110 Ga0207706_10148007 3300025933 Bacteria 2066
111 Ga0207709_10184873 3300025935 Bacteria 1475
112 Ga0207669_10832579 3300025937 Bacteria 767
113 Ga0207669_11409723 3300025937 Bacteria 593
114 Ga0207691_10428897 3300025940 Bacteria 1126
115 Ga0207661_10267890 3300025944 Bacteria 1523
116 Ga0207667_10024671 3300025949 Bacteria 6596
117 Ga0207667_10743224 3300025949 Bacteria 981
118 Ga0207658_12043263 3300025986 Bacteria 521
119 Ga0207639_10037097 3300026041 Bacteria 3618
120 Ga0207639_10960449 3300026041 Bacteria 800
121 Ga0207702_11233102 3300026078 Bacteria 742
122 Ga0207674_10086636 3300026116 Bacteria 3126
123 Ga0207674_10260897 3300026116 Bacteria 1680
124 Ga0207698_11715684 3300026142 Bacteria 643
125 Ga0268264_10068752 3300028381 Bacteria 2994
126 Ga0268264_12176084 3300028381 Bacteria 563
127 Ga0265336_10154740 3300028666 Unclassified 682
128 Ga0307515_10000523 3300028794 Bacteria 91316
129 Ga0307515_10001041 3300028794 Bacteria 63402
130 Ga0307515_10001565 3300028794 Bacteria 51101
131 Ga0307515_10045374 3300028794 Bacteria 6755
132 Ga0307515_10053479 3300028794 Bacteria 5957
133 Ga0307515_10064403 3300028794 Bacteria 5125
134 Ga0307515_10241523 3300028794 Bacteria 1576
135 Ga0307515_10429615 3300028794 Bacteria 939
136 Ga0265338_10001669 3300028800 Bacteria 35306
137 Ga0265338_10294244 3300028800 Bacteria 1182
138 Ga0265324_10161732 3300029957 Bacteria 760
139 Ga0265324_10220467 3300029957 Bacteria 644
140 Ga0307512_10386045 3300030522 Bacteria 596
141 Ga0265330_10047840 3300031235 Bacteria 1882
142 Ga0265339_10057350 3300031249 Unclassified 2106
143 Ga0265331_10024906 3300031250 Bacteria 3023
144 Ga0265316_10233823 3300031344 Bacteria 1353
145 Ga0307509_10170620 3300031507 Bacteria 2055
146 Ga0307408_101763018 3300031548 Bacteria 591
147 Ga0307508_10001284 3300031616 Bacteria 28530
148 Ga0307514_10000727 3300031649 Bacteria 56822
149 Ga0307514_10233877 3300031649 Bacteria 1110
150 Ga0307514_10301042 3300031649 Bacteria 898
151 Ga0316575_10007544 3300031665 Bacteria 3939
152 Ga0316575_10268655 3300031665 Bacteria 718
153 Ga0316579_10000689 3300031691 Bacteria 11501
154 Ga0265314_10213398 3300031711 Unclassified 1132
155 Ga0316576_10003389 3300031727 Bacteria 9320
156 Ga0316576_10196977 3300031727 Bacteria 1518
157 Ga0316576_10475497 3300031727 Bacteria 921
158 Ga0316576_10493410 3300031727 Bacteria 901
159 Ga0316576_11227377 3300031727 Bacteria 529
160 Ga0316578_10010919 3300031728 Bacteria 4731
161 Ga0316578_10681671 3300031728 Unclassified 599
162 Ga0316577_10007790 3300031733 Bacteria 5720
163 Ga0316577_10180357 3300031733 Bacteria 1192
164 Ga0316577_10228937 3300031733 Bacteria 1051
165 Ga0307518_10448553 3300031838 Bacteria 692
166 Ga0307414_10706812 3300032004 Bacteria 913
167 Ga0316583_10000266 3300032133 Bacteria 14355
168 Ga0316585_10001371 3300032137 Bacteria 6411
169 Ga0316580_10016300 3300032139 Bacteria 2279
170 Ga0307507_10000111 3300033179 Bacteria 134722
171 Ga0307507_10026507 3300033179 Bacteria 6246
172 Ga0316596_1116929 3300033541 Unclassified 725
173 Ga0373956_0480161 3300035119 Bacteria 593
174 Ga0316574_0002192 3300035398 Bacteria 9692
175 Ga0316574_0758884 3300035398 Bacteria 592
176 Ga0316582_0004628 3300036647 Bacteria 6982
177 Ga0316582_0021126 3300036647 Bacteria 3839
178 Ga0316582_0105774 3300036647 Bacteria 1868
179 Ga0316582_0393105 3300036647 Bacteria 955
180 Ga0316582_0526873 3300036647 Bacteria 814
181 Ga0316584_0013727 3300036712 Bacteria 5742
182 Ga0316584_0148648 3300036712 Bacteria 1745
183 Ga0316584_0429132 3300036712 Bacteria 938
184 Ga0316584_0465692 3300036712 Unclassified 892
185 Ga0316584_0550267 3300036712 Unclassified 806
186 Ga0395905_0398770 3300037471 Bacteria 1270
187 Ga0395905_0755440 3300037471 Bacteria 875
188 Ga0316581_0000213 3300037588 Bacteria 9847
189 Ga0400490_22743 3300038726 Bacteria 2061
190 Ga0436365_0320556 3300039437 Bacteria 14433
191 Ga0451797_0205016 3300041453 Bacteria 529
192 Ga0451837_0612993 3300041494 Bacteria 523
193 Ga0451853_0119609 3300041512 Bacteria 563
194 Ga0451853_2380633 3300041512 Bacteria 543
195 Ga0451577_0002718 3300042876 Bacteria 20585
196 Ga0451577_0008909 3300042876 Bacteria 9712
197 Ga0451577_0023117 3300042876 Bacteria 5674
198 Ga0451577_0047471 3300042876 Bacteria 3839
199 Ga0451577_0170242 3300042876 Bacteria 1963
200 Ga0451577_0222913 3300042876 Bacteria 1704
201 Ga0451577_0228212 3300042876 Bacteria 1683
202 Ga0453683_0009918 3300044673 Bacteria 6337
203 Ga0453683_0321747 3300044673 Bacteria 991
204 Ga0466961_0000281 3300044693 Bacteria 33824
205 Ga0453684_0000102 3300044712 Bacteria 366870
206 Ga0453684_0000615 3300044712 Bacteria 130336
207 Ga0453684_0001987 3300044712 Bacteria 52449
208 Ga0453684_0010100 3300044712 Bacteria 16221
209 Ga0453684_0014587 3300044712 Bacteria 12545
210 Ga0453684_0021884 3300044712 Bacteria 9515
211 Ga0453684_0030096 3300044712 Bacteria 7681
212 Ga0453684_0052711 3300044712 Bacteria 5317
213 Ga0453684_0625615 3300044712 Unclassified 1177
214 Ga0453684_0874419 3300044712 Bacteria 964
215 Ga0453684_0971060 3300044712 Bacteria 905
216 Ga0453684_1009251 3300044712 Bacteria 884
217 Ga0453684_1453007 3300044712 Bacteria 709
218 Ga0451576_0000632 3300045051 Bacteria 73171
219 Ga0451576_0004341 3300045051 Bacteria 18511
220 Ga0451576_0024400 3300045051 Bacteria 6531
221 Ga0451576_0028769 3300045051 Bacteria 5951
222 Ga0451576_0047480 3300045051 Bacteria 4514
223 Ga0451576_0089729 3300045051 Bacteria 3197
224 Ga0451576_0142396 3300045051 Bacteria 2500
225 Ga0451576_0192435 3300045051 Bacteria 2130
226 Ga0451576_0659608 3300045051 Unclassified 1099
227 Ga0451576_1481333 3300045051 Bacteria 705
228 Ga0451576_1778256 3300045051 Bacteria 637
229 Ga0451576_2754724 3300045051 Bacteria 500
230 Ga0466967_1339155 3300045976 Bacteria 713
231 Ga0495650_0001713 3300046471 Bacteria 20133
232 Ga0495618_0842505 3300046514 Bacteria 532
233 Ga0495648_0345557 3300046524 Bacteria 681
234 Ga0495654_0430051 3300046530 Bacteria 521
235 Ga0495633_0000083 3300046558 Bacteria 125035
236 Ga0495614_0049851 3300048089 Bacteria 1794
237 Ga0496117_0003586 3300048920 Bacteria 17906
238 Ga0496118_0110126 3300048921 Bacteria 1830
239 Ga0496118_0362529 3300048921 Bacteria 767
240 Ga0496119_0001702 3300048922 Bacteria 25707
241 Ga0496120_0001670 3300048923 Bacteria 25539
242 Ga0496122_0000928 3300048925 Bacteria 53465
243 Ga0496123_0000695 3300048926 Bacteria 55320
244 Ga0496124_0000901 3300048927 Bacteria 48046
245 Ga0496124_0796059 3300048927 Bacteria 586
246 Ga0501033_0123421 3300049570 Bacteria 1878
247 Ga0501039_1548398 3300049575 Unclassified 509
248 Ga0501047_0755939 3300049581 Unclassified 788
249 Ga0501206_027035 3300049653 Bacteria 840
250 Ga0501080_0005629 3300049742 Bacteria 11194
251 Ga0501268_080932 3300049765 Bacteria 671
252 Ga0501044_0000575 3300049823 Bacteria 44639
253 Ga0500583_0129455 3300053092 Bacteria 1251
254 2574430353 2574179768 Bacteria 4907129
255 2819660495 2818991457 Bacteria 5323295
256 8021622364 8021622325 Bacteria 4844743
257 8021626885 8021626552 Bacteria 4665214
258 8021648150 8021648035 Bacteria 4772378
259 Ga0307513_10235023
260 rootH2_10336053
261 rootH1_10132551
262 Ga0065714_10169755
263 Ga0070658_10174576
264 Ga0070658_10936821
265 Ga0070683_100306269
266 Ga0070683_101468561
267 Ga0070690_101182183
268 Ga0070666_10262088
269 Ga0070666_11137457
270 Ga0070680_101053122
271 Ga0070680_101604744
272 Ga0068868_100269858
273 Ga0070660_100051523
274 Ga0070660_100537944
275 Ga0070661_100386535
276 Ga0070661_100577178
277 Ga0070692_10848670
278 Ga0070675_100250824
279 Ga0070671_100772513
280 Ga0070671_100819546
281 Ga0070674_101189454
282 Ga0070673_101284926
283 Ga0070705_100019922
284 Ga0070678_100308441
285 Ga0070662_100500109
286 Ga0070679_100087458
287 Ga0070679_101174375
288 Ga0070684_100473712
289 Ga0070684_101178280
290 Ga0068853_100035285
291 Ga0068853_100190442
292 Ga0068853_101032103
293 Ga0070672_100285112
294 Ga0070672_101726845
295 Ga0070693_101415112
296 Ga0068855_100115734
297 Ga0068855_101506507
298 Ga0068857_100244586
299 Ga0068857_100431060
300 Ga0068856_101635831
301 Ga0068852_100195166
302 Ga0068852_102481947
303 Ga0068851_10036914
304 Ga0068851_10570376
305 Ga0068860_100177493
306 Ga0068860_100417498
307 Ga0081455_10839318
308 Ga0081538_10098345
309 Ga0075366_10233621
310 Ga0097621_101228445
311 Ga0068871_102357669
312 Ga0068865_100773900
313 Ga0079104_1011080
314 Ga0099794_10364398
315 Ga0105240_11739998
316 Ga0105243_10564758
317 Ga0105241_10038062
318 Ga0105241_10440656
319 Ga0105241_11211428
320 Ga0105242_10852276
321 Ga0105237_10112755
322 Ga0105237_10913017
323 Ga0105238_10366288
324 Ga0105239_10001953
325 Ga0105239_10026571
326 Ga0105239_10109149
327 Ga0105239_10220080
328 Ga0105239_11909002
329 Ga0105246_10024533
330 Ga0157373_10023076
331 Ga0157373_10182981
332 Ga0157371_10896737
333 Ga0157371_11330123
334 Ga0157369_10012729
335 Ga0157369_10535029
336 Ga0157374_10018354
337 Ga0157374_10487865
338 Ga0157374_10646474
339 Ga0157372_10005908
340 Ga0157372_10034351
341 Ga0157372_10133367
342 Ga0157372_11138062
343 Ga0163163_10248177
344 Ga0182008_10324044
345 Ga0157376_10750012
346 Ga0213874_10179445
347 Ga0213876_10039116
348 Ga0207656_10083850
349 Ga0207656_10286153
350 Ga0207688_10397125
351 Ga0207680_10266610
352 Ga0207647_10003579
353 Ga0207705_10181435
354 Ga0207705_10886730
355 Ga0207654_10264080
356 Ga0207654_10265852
357 Ga0207707_10783466
358 Ga0207671_10026650
359 Ga0207671_10909491
360 Ga0207660_10850212
361 Ga0207660_11209621
362 Ga0207657_10008435
363 Ga0207657_10499390
364 Ga0207649_10574598
365 Ga0207652_10342505
366 Ga0207694_10740798
367 Ga0207659_10143904
368 Ga0207706_10148007
369 Ga0207709_10184873
370 Ga0207669_10832579
371 Ga0207669_11409723
372 Ga0207691_10428897
373 Ga0207661_10267890
374 Ga0207667_10024671
375 Ga0207667_10743224
376 Ga0207658_12043263
377 Ga0207639_10037097
378 Ga0207639_10960449
379 Ga0207702_11233102
380 Ga0207674_10086636
381 Ga0207674_10260897
382 Ga0207698_11715684
383 Ga0268264_10068752
384 Ga0268264_12176084
385 Ga0265336_10154740
386 Ga0307515_10000523
387 Ga0307515_10001041
388 Ga0307515_10001565
389 Ga0307515_10045374
390 Ga0307515_10053479
391 Ga0307515_10064403
392 Ga0307515_10241523
393 Ga0307515_10429615
394 Ga0265338_10001669
395 Ga0265338_10294244
396 Ga0265324_10161732
397 Ga0265324_10220467
398 Ga0307512_10386045
399 Ga0265330_10047840
400 Ga0265339_10057350
401 Ga0265331_10024906
402 Ga0265316_10233823
403 Ga0307509_10170620
404 Ga0307408_101763018
405 Ga0307508_10001284
406 Ga0307514_10000727
407 Ga0307514_10233877
408 Ga0307514_10301042
409 Ga0316575_10007544
410 Ga0316575_10268655
411 Ga0316579_10000689
412 Ga0265314_10213398
413 Ga0316576_10003389
414 Ga0316576_10196977
415 Ga0316576_10475497
416 Ga0316576_10493410
417 Ga0316576_11227377
418 Ga0316578_10010919
419 Ga0316578_10681671
420 Ga0316577_10007790
421 Ga0316577_10180357
422 Ga0316577_10228937
423 Ga0307518_10448553
424 Ga0307414_10706812
425 Ga0316583_10000266
426 Ga0316585_10001371
427 Ga0316580_10016300
428 Ga0307507_10000111
429 Ga0307507_10026507
430 Ga0316596_1116929
431 Ga0373956_0480161
432 Ga0316574_0002192
433 Ga0316574_0758884
434 Ga0316582_0004628
435 Ga0316582_0021126
436 Ga0316582_0105774
437 Ga0316582_0393105
438 Ga0316582_0526873
439 Ga0316584_0013727
440 Ga0316584_0148648
441 Ga0316584_0429132
442 Ga0316584_0465692
443 Ga0316584_0550267
444 Ga0395905_0398770
445 Ga0395905_0755440
446 Ga0316581_0000213
447 Ga0400490_22743
448 Ga0436365_0320556
449 Ga0451797_0205016
450 Ga0451837_0612993
451 Ga0451853_0119609
452 Ga0451853_2380633
453 Ga0451577_0002718
454 Ga0451577_0008909
455 Ga0451577_0023117
456 Ga0451577_0047471
457 Ga0451577_0170242
458 Ga0451577_0222913
459 Ga0451577_0228212
460 Ga0453683_0009918
461 Ga0453683_0321747
462 Ga0466961_0000281
463 Ga0453684_0000102
464 Ga0453684_0000615
465 Ga0453684_0001987
466 Ga0453684_0010100
467 Ga0453684_0014587
468 Ga0453684_0021884
469 Ga0453684_0030096
470 Ga0453684_0052711
471 Ga0453684_0625615
472 Ga0453684_0874419
473 Ga0453684_0971060
474 Ga0453684_1009251
475 Ga0453684_1453007
476 Ga0451576_0000632
477 Ga0451576_0004341
478 Ga0451576_0024400
479 Ga0451576_0028769
480 Ga0451576_0047480
481 Ga0451576_0089729
482 Ga0451576_0142396
483 Ga0451576_0192435
484 Ga0451576_0659608
485 Ga0451576_1481333
486 Ga0451576_1778256
487 Ga0451576_2754724
488 Ga0466967_1339155
489 Ga0495650_0001713
490 Ga0495618_0842505
491 Ga0495648_0345557
492 Ga0495654_0430051
493 Ga0495633_0000083
494 Ga0495614_0049851
495 Ga0496117_0003586
496 Ga0496118_0110126
497 Ga0496118_0362529
498 Ga0496119_0001702
499 Ga0496120_0001670
500 Ga0496122_0000928
501 Ga0496123_0000695
502 Ga0496124_0000901
503 Ga0496124_0796059
504 Ga0501033_0123421
505 Ga0501039_1548398
506 Ga0501047_0755939
507 Ga0501206_027035
508 Ga0501080_0005629
509 Ga0501268_080932
510 Ga0501044_0000575
511 Ga0500583_0129455
512 2574430353
513 2819660495
514 8021622364
515 8021626885
516 8021648150

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06769

YoeB_toxin

YoeB-like toxin of bacterial type II toxin-antitoxin system

5

94

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6n90-assembly1.cif.gz_B yoeb/pare toxin from agrobacterium tumefaciens 0.9826 1 84
6n90-assembly1.cif.gz_A yoeb/pare toxin from agrobacterium tumefaciens 0.9801 1 84
4v8x-assembly2.cif.gz_CY structure of thermus thermophilus ribosome 0.965 1 84
6n90-assembly1.cif.gz_B yoeb/pare toxin from agrobacterium tumefaciens 0.96 1 84
6n90-assembly1.cif.gz_A yoeb/pare toxin from agrobacterium tumefaciens 0.9576 1 84
ID Description Score Start End Superfamily
4bydY00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.965 1 84 3.30.2310.20
af_P9WF09_1_85_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9575 2 84 3.30.2310.20
4bydY00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.954 1 84 3.30.2310.20
af_Q2FVF8_1_87_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8773 2 84 3.30.2310.20
af_Q58573_1_88_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.869 2 83 3.30.2310.20
ID Description Score Start End GO Terms
AF-K2EFL1-F1-model_v4 Putative mRNA interferase YoeB 1.003 2 84 GO:0004519
GO:0006401
GO:0045892
AF-A0A7V4YZ20-F1-model_v4 Putative mRNA interferase YoeB 1.003 1 84 GO:0004519
GO:0006401
GO:0045892
AF-A0A7D4TPN2-F1-model_v4 Putative mRNA interferase YoeB 1.002 1 84 GO:0004519
GO:0006401
AF-A0A7S8FB20-F1-model_v4 Putative mRNA interferase YoeB 1.002 24 84 GO:0004519
GO:0006401
GO:0098795
AF-A0A2G4GLL7-F1-model_v4 Putative mRNA interferase YoeB 1.001 1 84 GO:0004519
GO:0006401
GO:0045892

Map