F368172

General Info

Members Datasets Scaffolds Average Seq Length
258 153 516 77

Family's Representative Sequence

Representative Sequence 3300030736|Ga0316180_1111203|Ga0316180_11112032
Length 88
Sequence MTAYPLIDEEGTVSTTETGQVTGTKDKDYNILWFTEACLDNALRLETFIKDAEREGDSELAEFFKKAQTDSRKGAEQGKRLLVSRLSS

Samples

Sample ID Description Type Environment
1 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
2 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
24 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
29 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
30 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
31 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
34 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
35 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
36 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
37 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
53 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
54 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
55 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
56 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
57 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
58 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
59 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
60 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
61 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
62 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
63 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
67 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
68 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
69 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
70 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
71 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
72 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
73 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
74 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
76 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
77 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
80 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
81 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
82 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
83 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
84 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
85 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
86 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
87 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
88 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
89 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
90 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
91 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
92 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
93 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
94 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
99 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
100 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
101 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
102 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
103 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
104 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
105 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
106 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
107 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
108 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
109 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
110 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
111 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
112 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
113 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
114 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
115 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
116 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
117 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
118 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
130 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
131 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
132 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
133 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
134 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
135 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
136 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
137 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
138 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
141 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
143 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
144 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
145 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
147 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
148 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
149 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
152 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
153 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.35
Metatranscriptomes 4.26
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.75
Rhizosphere 87.98
Stem 0
Stem Tuber 0
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316180_1111203 3300030736 Bacteria 1888
2 Ga0006777J48905_1043272 3300003308 Bacteria 750
3 Ga0007409J51694_1112883 3300003575 Unclassified 516
4 Ga0032354_1027008 3300003693 Bacteria 773
5 Ga0006780_1021035 3300003735 Bacteria 714
6 Ga0068869_100704472 3300005334 Bacteria 861
7 Ga0070680_100126670 3300005336 Bacteria 2134
8 Ga0068868_100486544 3300005338 Bacteria 1079
9 Ga0070710_10000032 3300005437 Bacteria 64514
10 Ga0070681_10005689 3300005458 Bacteria 12050
11 Ga0070679_100000202 3300005530 Bacteria 48732
12 Ga0068855_101447403 3300005563 Bacteria 707
13 Ga0068854_100061357 3300005578 Bacteria 2723
14 Ga0068854_100219954 3300005578 Bacteria 1502
15 Ga0068856_100096979 3300005614 Bacteria 2937
16 Ga0068861_102700233 3300005719 Bacteria 501
17 Ga0068858_100000056 3300005842 Bacteria 118532
18 Ga0068860_100264334 3300005843 Bacteria 1678
19 Ga0081455_10002946 3300005937 Bacteria 19937
20 Ga0081455_10024998 3300005937 Bacteria 5519
21 Ga0081455_10784663 3300005937 Bacteria 599
22 Ga0081538_10046289 3300005981 Bacteria 2684
23 Ga0075428_100013168 3300006844 Bacteria 9199
24 Ga0075428_102313483 3300006844 Bacteria 553
25 Ga0075430_100019397 3300006846 Bacteria 5783
26 Ga0075431_100085700 3300006847 Bacteria 3252
27 Ga0075431_101240469 3300006847 Bacteria 707
28 Ga0075429_100421003 3300006880 Bacteria 1170
29 Ga0105247_10000928 3300009101 Bacteria 22045
30 Ga0114129_10480982 3300009147 Bacteria 1625
31 Ga0105238_10849861 3300009551 Bacteria 930
32 Ga0157369_11683533 3300013105 Bacteria 645
33 Ga0157369_12056017 3300013105 Bacteria 579
34 Ga0157378_11227082 3300013297 Bacteria 790
35 Ga0157375_13124140 3300013308 Bacteria 552
36 Ga0157379_10006736 3300014968 Bacteria 9927
37 Ga0197907_10643309 3300020069 Bacteria 695
38 Ga0197907_11345817 3300020069 Bacteria 1043
39 Ga0206352_11338012 3300020078 Bacteria 819
40 Ga0154015_1519895 3300020610 Bacteria 549
41 Ga0213873_10000129 3300021358 Bacteria 14241
42 Ga0213876_10015956 3300021384 Bacteria 3974
43 Ga0213876_10078840 3300021384 Bacteria 1741
44 Ga0213876_10080193 3300021384 Bacteria 1725
45 Ga0213875_10000326 3300021388 Bacteria 45254
46 Ga0224712_10406832 3300022467 Bacteria 649
47 Ga0207692_10001656 3300025898 Bacteria 8427
48 Ga0207710_10000008 3300025900 Bacteria 485312
49 Ga0207707_10009971 3300025912 Bacteria 8238
50 Ga0207660_10101568 3300025917 Bacteria 2149
51 Ga0207652_10000735 3300025921 Bacteria 31707
52 Ga0207694_11666326 3300025924 Bacteria 537
53 Ga0207644_10407544 3300025931 Bacteria 1112
54 Ga0207667_10698558 3300025949 Bacteria 1017
55 Ga0207640_10020572 3300025981 Bacteria 3920
56 Ga0207640_10477355 3300025981 Bacteria 1033
57 Ga0207677_10310977 3300026023 Bacteria 1305
58 Ga0207703_10000014 3300026035 Bacteria 304317
59 Ga0207702_10031466 3300026078 Bacteria 4422
60 Ga0207641_12639227 3300026088 Bacteria 500
61 Ga0268264_10244610 3300028381 Bacteria 1663
62 Ga0316177_1142308 3300030731 Bacteria 2904
63 Ga0316176_1199008 3300030732 Bacteria 4310
64 Ga0314311_1026774 3300030733 Bacteria 5504
65 Ga0314311_1234153 3300030733 Bacteria 1381
66 Ga0316178_1111250 3300030735 Bacteria 2498
67 Ga0316180_1150943 3300030736 Bacteria 943
68 Ga0316181_1007235 3300030744 Bacteria 551
69 Ga0307408_100218550 3300031548 Bacteria 1554
70 Ga0307408_100302841 3300031548 Bacteria 1340
71 Ga0307408_100334287 3300031548 Bacteria 1280
72 Ga0307408_100369811 3300031548 Bacteria 1222
73 Ga0307408_101352183 3300031548 Bacteria 669
74 Ga0307405_10061952 3300031731 Bacteria 2367
75 Ga0307405_11081385 3300031731 Bacteria 688
76 Ga0307405_12098358 3300031731 Bacteria 507
77 Ga0307413_10320128 3300031824 Bacteria 1184
78 Ga0307413_11536975 3300031824 Bacteria 589
79 Ga0307413_12163888 3300031824 Bacteria 504
80 Ga0307410_10346127 3300031852 Bacteria 1186
81 Ga0307410_11016470 3300031852 Bacteria 715
82 Ga0307410_11101913 3300031852 Bacteria 688
83 Ga0307410_11973467 3300031852 Bacteria 520
84 Ga0307406_10048355 3300031901 Bacteria 2686
85 Ga0307406_10066691 3300031901 Bacteria 2344
86 Ga0307406_10543464 3300031901 Bacteria 949
87 Ga0307406_10695927 3300031901 Bacteria 848
88 Ga0307406_11291182 3300031901 Bacteria 637
89 Ga0307406_11640110 3300031901 Bacteria 569
90 Ga0307407_10078431 3300031903 Bacteria 1990
91 Ga0307407_10287092 3300031903 Bacteria 1142
92 Ga0307412_10373502 3300031911 Bacteria 1152
93 Ga0307412_10673805 3300031911 Bacteria 885
94 Ga0307409_100002646 3300031995 Bacteria 9427
95 Ga0307409_100069271 3300031995 Bacteria 2794
96 Ga0307409_100142166 3300031995 Bacteria 2069
97 Ga0307409_100273137 3300031995 Bacteria 1558
98 Ga0307409_100500973 3300031995 Bacteria 1183
99 Ga0307409_100551888 3300031995 Bacteria 1131
100 Ga0307409_100610356 3300031995 Bacteria 1079
101 Ga0307409_100656648 3300031995 Bacteria 1043
102 Ga0307409_101520597 3300031995 Bacteria 697
103 Ga0307409_101639254 3300031995 Bacteria 672
104 Ga0307409_101755590 3300031995 Bacteria 649
105 Ga0307409_102158982 3300031995 Bacteria 586
106 Ga0307416_100026068 3300032002 Bacteria 4301
107 Ga0307416_100096560 3300032002 Bacteria 2556
108 Ga0307416_100357174 3300032002 Bacteria 1481
109 Ga0307416_100461769 3300032002 Bacteria 1325
110 Ga0307416_100728998 3300032002 Bacteria 1082
111 Ga0307416_100806158 3300032002 Bacteria 1035
112 Ga0307416_100947812 3300032002 Bacteria 962
113 Ga0307414_10296015 3300032004 Bacteria 1367
114 Ga0307414_10632366 3300032004 Bacteria 963
115 Ga0307414_10781449 3300032004 Bacteria 870
116 Ga0307414_11575140 3300032004 Bacteria 612
117 Ga0307414_11691151 3300032004 Bacteria 590
118 Ga0307414_12176923 3300032004 Bacteria 518
119 Ga0307411_10442405 3300032005 Bacteria 1085
120 Ga0307411_10583261 3300032005 Bacteria 959
121 Ga0307411_10674895 3300032005 Bacteria 897
122 Ga0307411_11665048 3300032005 Bacteria 590
123 Ga0307415_100001927 3300032126 Bacteria 10211
124 Ga0307415_100037142 3300032126 Bacteria 3199
125 Ga0307415_100100110 3300032126 Bacteria 2123
126 Ga0307415_100123633 3300032126 Bacteria 1945
127 Ga0307415_100156823 3300032126 Bacteria 1759
128 Ga0307415_100165808 3300032126 Bacteria 1717
129 Ga0307415_100585965 3300032126 Bacteria 990
130 Ga0307415_100619364 3300032126 Bacteria 966
131 Ga0307415_101551877 3300032126 Bacteria 635
132 Ga0307415_102320079 3300032126 Bacteria 527
133 Ga0373945_0546235 3300035116 Bacteria 520
134 Ga0373943_0231415 3300035170 Bacteria 1033
135 Ga0373935_0606984 3300035692 Bacteria 800
136 Ga0373927_0331904 3300035695 Bacteria 1002
137 Ga0373947_0068936 3300035725 Bacteria 2164
138 Ga0373925_0076122 3300037068 Bacteria 2544
139 Ga0395900_0880586 3300037418 Bacteria 820
140 Ga0395898_0691746 3300037466 Bacteria 962
141 Ga0436364_0346202 3300037853 Bacteria 62581
142 Ga0395901_0614382 3300038443 Bacteria 1095
143 Ga0436365_0149931 3300039437 Bacteria 1907
144 Ga0436365_1147406 3300039437 Bacteria 5736
145 Ga0436363_1464147 3300039450 Bacteria 631
146 Ga0436362_0636120 3300039453 Bacteria 15321
147 Ga0439455_0002139 3300042012 Bacteria 3532
148 Ga0466969_0018383 3300044656 Bacteria 3642
149 Ga0466969_0498921 3300044656 Bacteria 555
150 Ga0466972_0000546 3300044658 Bacteria 18447
151 Ga0466972_0008008 3300044658 Bacteria 5297
152 Ga0466972_0016633 3300044658 Bacteria 3677
153 Ga0466972_0114911 3300044658 Bacteria 1271
154 Ga0466972_0249151 3300044658 Bacteria 830
155 Ga0466965_0002596 3300044683 Bacteria 7728
156 Ga0466965_0005443 3300044683 Bacteria 5737
157 Ga0466965_0007366 3300044683 Bacteria 5049
158 Ga0466965_0020668 3300044683 Bacteria 3167
159 Ga0466965_0241742 3300044683 Bacteria 966
160 Ga0466966_0022797 3300044684 Bacteria 4104
161 Ga0466966_0363306 3300044684 Bacteria 870
162 Ga0466961_0074039 3300044693 Bacteria 2160
163 Ga0466961_0335680 3300044693 Bacteria 921
164 Ga0466961_0605810 3300044693 Bacteria 658
165 Ga0466961_0753590 3300044693 Bacteria 582
166 Ga0466961_0779441 3300044693 Bacteria 571
167 Ga0466963_0528644 3300044694 Bacteria 833
168 Ga0466963_0577353 3300044694 Bacteria 794
169 Ga0466963_0650017 3300044694 Bacteria 744
170 Ga0466964_0063881 3300044706 Bacteria 1539
171 Ga0466964_0332830 3300044706 Bacteria 775
172 Ga0466971_0044822 3300044719 Bacteria 1986
173 Ga0466971_0068139 3300044719 Bacteria 1613
174 Ga0466968_0151199 3300044735 Bacteria 1067
175 Ga0466968_0328414 3300044735 Bacteria 740
176 Ga0466970_0007157 3300044765 Bacteria 5586
177 Ga0466970_0028760 3300044765 Bacteria 2922
178 Ga0466970_0164482 3300044765 Bacteria 1228
179 Ga0466957_0434653 3300044842 Bacteria 902
180 Ga0466957_0457183 3300044842 Bacteria 880
181 Ga0466960_0002915 3300044901 Bacteria 6509
182 Ga0466960_0013846 3300044901 Bacteria 3436
183 Ga0466959_0085706 3300045049 Bacteria 2266
184 Ga0466959_0097421 3300045049 Bacteria 2108
185 Ga0466959_0234822 3300045049 Bacteria 1268
186 Ga0466958_0117568 3300045836 Bacteria 1662
187 Ga0466958_0683175 3300045836 Bacteria 668
188 Ga0466958_0796528 3300045836 Bacteria 616
189 Ga0466967_0006948 3300045976 Bacteria 8095
190 Ga0466967_0099761 3300045976 Bacteria 2652
191 Ga0466967_0599212 3300045976 Bacteria 1087
192 Ga0466967_0727487 3300045976 Bacteria 984
193 Ga0466967_1126045 3300045976 Bacteria 782
194 Ga0495583_0400628 3300046506 Bacteria 539
195 Ga0495630_0882909 3300046517 Bacteria 681
196 Ga0495643_0328287 3300046522 Bacteria 690
197 Ga0495669_0000493 3300046684 Bacteria 18156
198 Ga0495671_0422372 3300046692 Bacteria 638
199 Ga0495676_0572745 3300047321 Bacteria 737
200 Ga0496101_0299366 3300048904 Bacteria 1260
201 Ga0496101_0823490 3300048904 Bacteria 732
202 Ga0496102_0835119 3300048905 Bacteria 843
203 Ga0496102_1759345 3300048905 Bacteria 537
204 Ga0496104_0804755 3300048907 Bacteria 846
205 Ga0496104_0941160 3300048907 Bacteria 768
206 Ga0496105_0035238 3300048908 Bacteria 4119
207 Ga0496105_0761870 3300048908 Bacteria 739
208 Ga0496106_0020996 3300048909 Bacteria 4846
209 Ga0496107_0422363 3300048910 Bacteria 991
210 Ga0496108_0000055 3300048911 Bacteria 125202
211 Ga0496108_0008695 3300048911 Bacteria 8234
212 Ga0496109_0000043 3300048912 Bacteria 134649
213 Ga0496109_0007435 3300048912 Bacteria 9274
214 Ga0496109_0214879 3300048912 Bacteria 1808
215 Ga0496110_0003440 3300048913 Bacteria 12117
216 Ga0496111_0011603 3300048914 Bacteria 5942
217 Ga0496112_0666414 3300048915 Bacteria 969
218 Ga0496113_0070021 3300048916 Bacteria 2665
219 Ga0496114_1753350 3300048917 Bacteria 509
220 Ga0496119_0379325 3300048922 Bacteria 678
221 Ga0496121_0020168 3300048924 Bacteria 6618
222 Ga0501036_0037347 3300049572 Bacteria 4109
223 Ga0501037_0111336 3300049573 Bacteria 1972
224 Ga0501038_0299389 3300049574 Bacteria 1263
225 Ga0501039_0136425 3300049575 Bacteria 1926
226 Ga0501040_0044345 3300049576 Bacteria 3031
227 Ga0501041_0011241 3300049577 Bacteria 5289
228 Ga0501042_0224941 3300049578 Bacteria 1353
229 Ga0501043_0072519 3300049579 Bacteria 2705
230 Ga0501046_0090694 3300049580 Bacteria 2351
231 Ga0501048_0031050 3300049582 Bacteria 3866
232 Ga0501068_0010247 3300049584 Bacteria 5260
233 Ga0501071_0109665 3300049587 Bacteria 2039
234 Ga0501072_0025988 3300049588 Bacteria 4562
235 Ga0501074_0211773 3300049590 Bacteria 1381
236 Ga0501075_0023715 3300049591 Bacteria 4493
237 Ga0501076_0218333 3300049592 Bacteria 1558
238 Ga0501077_0048079 3300049593 Bacteria 2710
239 Ga0501243_108778 3300049675 Bacteria 566
240 Ga0501225_0107992 3300049705 Bacteria 818
241 Ga0501079_0030909 3300049741 Bacteria 4115
242 Ga0501080_0490542 3300049742 Bacteria 1099
243 Ga0501081_0013887 3300049743 Bacteria 5301
244 Ga0501035_0443027 3300049822 Bacteria 1075
245 Ga0501045_0059433 3300049824 Bacteria 2800
246 nmdc:mga05p37_1558926_c1 3300050507 Bacteria 654
247 nmdc:mga09592_208848_c1 3300050508 Bacteria 1691
248 nmdc:mga0qj67_565105_c1 3300050509 Bacteria 912
249 nmdc:mga06r32_73172_c1 3300050510 Bacteria 3319
250 nmdc:mga06r32_790752_c1 3300050510 Bacteria 910
251 Ga0501084_0111989 3300054114 Bacteria 2293
252 Ga0590075_045597 3300059424 Bacteria 1123
253 Ga0587083_0071561 3300059505 Bacteria 806
254 Ga0587128_040331 3300059630 Bacteria 814
255 Ga0466962_0021661 3300061719 Bacteria 3085
256 Ga0466962_0028658 3300061719 Bacteria 2666
257 Ga0530510_0094499 3300061734 Bacteria 2183
258 2816509296 2816332139 Bacteria 9138787
259 Ga0316180_1111203
260 Ga0006777J48905_1043272
261 Ga0007409J51694_1112883
262 Ga0032354_1027008
263 Ga0006780_1021035
264 Ga0068869_100704472
265 Ga0070680_100126670
266 Ga0068868_100486544
267 Ga0070710_10000032
268 Ga0070681_10005689
269 Ga0070679_100000202
270 Ga0068855_101447403
271 Ga0068854_100061357
272 Ga0068854_100219954
273 Ga0068856_100096979
274 Ga0068861_102700233
275 Ga0068858_100000056
276 Ga0068860_100264334
277 Ga0081455_10002946
278 Ga0081455_10024998
279 Ga0081455_10784663
280 Ga0081538_10046289
281 Ga0075428_100013168
282 Ga0075428_102313483
283 Ga0075430_100019397
284 Ga0075431_100085700
285 Ga0075431_101240469
286 Ga0075429_100421003
287 Ga0105247_10000928
288 Ga0114129_10480982
289 Ga0105238_10849861
290 Ga0157369_11683533
291 Ga0157369_12056017
292 Ga0157378_11227082
293 Ga0157375_13124140
294 Ga0157379_10006736
295 Ga0197907_10643309
296 Ga0197907_11345817
297 Ga0206352_11338012
298 Ga0154015_1519895
299 Ga0213873_10000129
300 Ga0213876_10015956
301 Ga0213876_10078840
302 Ga0213876_10080193
303 Ga0213875_10000326
304 Ga0224712_10406832
305 Ga0207692_10001656
306 Ga0207710_10000008
307 Ga0207707_10009971
308 Ga0207660_10101568
309 Ga0207652_10000735
310 Ga0207694_11666326
311 Ga0207644_10407544
312 Ga0207667_10698558
313 Ga0207640_10020572
314 Ga0207640_10477355
315 Ga0207677_10310977
316 Ga0207703_10000014
317 Ga0207702_10031466
318 Ga0207641_12639227
319 Ga0268264_10244610
320 Ga0316177_1142308
321 Ga0316176_1199008
322 Ga0314311_1026774
323 Ga0314311_1234153
324 Ga0316178_1111250
325 Ga0316180_1150943
326 Ga0316181_1007235
327 Ga0307408_100218550
328 Ga0307408_100302841
329 Ga0307408_100334287
330 Ga0307408_100369811
331 Ga0307408_101352183
332 Ga0307405_10061952
333 Ga0307405_11081385
334 Ga0307405_12098358
335 Ga0307413_10320128
336 Ga0307413_11536975
337 Ga0307413_12163888
338 Ga0307410_10346127
339 Ga0307410_11016470
340 Ga0307410_11101913
341 Ga0307410_11973467
342 Ga0307406_10048355
343 Ga0307406_10066691
344 Ga0307406_10543464
345 Ga0307406_10695927
346 Ga0307406_11291182
347 Ga0307406_11640110
348 Ga0307407_10078431
349 Ga0307407_10287092
350 Ga0307412_10373502
351 Ga0307412_10673805
352 Ga0307409_100002646
353 Ga0307409_100069271
354 Ga0307409_100142166
355 Ga0307409_100273137
356 Ga0307409_100500973
357 Ga0307409_100551888
358 Ga0307409_100610356
359 Ga0307409_100656648
360 Ga0307409_101520597
361 Ga0307409_101639254
362 Ga0307409_101755590
363 Ga0307409_102158982
364 Ga0307416_100026068
365 Ga0307416_100096560
366 Ga0307416_100357174
367 Ga0307416_100461769
368 Ga0307416_100728998
369 Ga0307416_100806158
370 Ga0307416_100947812
371 Ga0307414_10296015
372 Ga0307414_10632366
373 Ga0307414_10781449
374 Ga0307414_11575140
375 Ga0307414_11691151
376 Ga0307414_12176923
377 Ga0307411_10442405
378 Ga0307411_10583261
379 Ga0307411_10674895
380 Ga0307411_11665048
381 Ga0307415_100001927
382 Ga0307415_100037142
383 Ga0307415_100100110
384 Ga0307415_100123633
385 Ga0307415_100156823
386 Ga0307415_100165808
387 Ga0307415_100585965
388 Ga0307415_100619364
389 Ga0307415_101551877
390 Ga0307415_102320079
391 Ga0373945_0546235
392 Ga0373943_0231415
393 Ga0373935_0606984
394 Ga0373927_0331904
395 Ga0373947_0068936
396 Ga0373925_0076122
397 Ga0395900_0880586
398 Ga0395898_0691746
399 Ga0436364_0346202
400 Ga0395901_0614382
401 Ga0436365_0149931
402 Ga0436365_1147406
403 Ga0436363_1464147
404 Ga0436362_0636120
405 Ga0439455_0002139
406 Ga0466969_0018383
407 Ga0466969_0498921
408 Ga0466972_0000546
409 Ga0466972_0008008
410 Ga0466972_0016633
411 Ga0466972_0114911
412 Ga0466972_0249151
413 Ga0466965_0002596
414 Ga0466965_0005443
415 Ga0466965_0007366
416 Ga0466965_0020668
417 Ga0466965_0241742
418 Ga0466966_0022797
419 Ga0466966_0363306
420 Ga0466961_0074039
421 Ga0466961_0335680
422 Ga0466961_0605810
423 Ga0466961_0753590
424 Ga0466961_0779441
425 Ga0466963_0528644
426 Ga0466963_0577353
427 Ga0466963_0650017
428 Ga0466964_0063881
429 Ga0466964_0332830
430 Ga0466971_0044822
431 Ga0466971_0068139
432 Ga0466968_0151199
433 Ga0466968_0328414
434 Ga0466970_0007157
435 Ga0466970_0028760
436 Ga0466970_0164482
437 Ga0466957_0434653
438 Ga0466957_0457183
439 Ga0466960_0002915
440 Ga0466960_0013846
441 Ga0466959_0085706
442 Ga0466959_0097421
443 Ga0466959_0234822
444 Ga0466958_0117568
445 Ga0466958_0683175
446 Ga0466958_0796528
447 Ga0466967_0006948
448 Ga0466967_0099761
449 Ga0466967_0599212
450 Ga0466967_0727487
451 Ga0466967_1126045
452 Ga0495583_0400628
453 Ga0495630_0882909
454 Ga0495643_0328287
455 Ga0495669_0000493
456 Ga0495671_0422372
457 Ga0495676_0572745
458 Ga0496101_0299366
459 Ga0496101_0823490
460 Ga0496102_0835119
461 Ga0496102_1759345
462 Ga0496104_0804755
463 Ga0496104_0941160
464 Ga0496105_0035238
465 Ga0496105_0761870
466 Ga0496106_0020996
467 Ga0496107_0422363
468 Ga0496108_0000055
469 Ga0496108_0008695
470 Ga0496109_0000043
471 Ga0496109_0007435
472 Ga0496109_0214879
473 Ga0496110_0003440
474 Ga0496111_0011603
475 Ga0496112_0666414
476 Ga0496113_0070021
477 Ga0496114_1753350
478 Ga0496119_0379325
479 Ga0496121_0020168
480 Ga0501036_0037347
481 Ga0501037_0111336
482 Ga0501038_0299389
483 Ga0501039_0136425
484 Ga0501040_0044345
485 Ga0501041_0011241
486 Ga0501042_0224941
487 Ga0501043_0072519
488 Ga0501046_0090694
489 Ga0501048_0031050
490 Ga0501068_0010247
491 Ga0501071_0109665
492 Ga0501072_0025988
493 Ga0501074_0211773
494 Ga0501075_0023715
495 Ga0501076_0218333
496 Ga0501077_0048079
497 Ga0501243_108778
498 Ga0501225_0107992
499 Ga0501079_0030909
500 Ga0501080_0490542
501 Ga0501081_0013887
502 Ga0501035_0443027
503 Ga0501045_0059433
504 nmdc:mga05p37_1558926_c1
505 nmdc:mga09592_208848_c1
506 nmdc:mga0qj67_565105_c1
507 nmdc:mga06r32_73172_c1
508 nmdc:mga06r32_790752_c1
509 Ga0501084_0111989
510 Ga0590075_045597
511 Ga0587083_0071561
512 Ga0587128_040331
513 Ga0466962_0021661
514 Ga0466962_0028658
515 Ga0530510_0094499
516 2816509296

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f4n-assembly1.cif.gz_B c2 crystal structure of ala2ile2-6, a version of rop with a repacked hydrophobic core and a new fold. 0.9818 23 66
5l8b-assembly1.cif.gz_I crystal structure of rhodospirillum rubrum rru_a0973 mutant e62a 0.9813 17 71
6e8g-assembly1.cif.gz_T cryoem reconstruction of ist1-chmp1b copolymer filament bound to ssdna at 2.9 angstrom resolution 0.9809 17 73
5l89-assembly3.cif.gz_Z crystal structure of rhodospirillum rubrum rru_a0973 mutant e32a 0.9801 18 73
2d5k-assembly1.cif.gz_B crystal structure of dps from staphylococcus aureus 0.9786 17 71
ID Description Score Start End Superfamily
1f4nB00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9818 23 66 1.10.287.230
5l89a00 Special;Helix non-globular;Helix Hairpins; 0.9808 17 71 6.10.140.1960
3qvdE01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9807 17 72 1.20.1260.10
5l8bG00 Special;Helix non-globular;Helix Hairpins; 0.9806 18 71 6.10.140.1960
3pwfA01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9795 17 72 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A3D2JBZ2-F1-model_v4 Ferritin-like diiron domain-containing protein 1.003 17 75
AF-A0A2M7SUK7-F1-model_v4 Uncharacterized protein 1.001 17 73
AF-A0A7X6LZF7-F1-model_v4 Ferritin-like diiron domain-containing protein 1 15 75
AF-A0A2X2BWU6-F1-model_v4 protein-glutamate methylesterase (EC 3.1.1.61) 0.9988 17 76 GO:0000156
GO:0005737
GO:0006935
GO:0008984
AF-A0A2N5KF19-F1-model_v4 Methylmalonyl Co-A mutase-associated GTPase MeaB 0.9977 15 72

Map