F367890

General Info

Members Datasets Scaffolds Average Seq Length
258 167 516 235

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100325578|Ga0070713_1003255782
Length 269
Sequence MTASGNNDVIFVTQGKAASEDRALAAIAYNLQLTFANGDELMPGVTGRVALVTGASQGIGRACALALAEGGALIALAARNEEKLAAVAKEITDKGGQAATFRMDVSNEADVKSVVKAVIERFGKVEILVNNAGVTKDTLLMRMKKEDWDSVIQTNLSGAFYTTQAVIGSMLKPRWGRIINITLIGFTMAIAREVASRNITVNAVAPGYIETAMTEVLSAELKSKVNEAIPLGRAGTDMEVAHAVRFLASEEASYITGHVLKVNGGMLMG

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
58 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
59 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
84 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
86 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
90 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
91 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
92 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
93 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
94 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
95 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
96 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
99 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
108 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
109 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
110 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
111 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
112 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
118 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
119 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
120 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
121 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
124 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
125 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
126 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
127 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
128 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
129 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
130 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
131 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
132 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
133 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
136 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
137 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
154 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
164 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
167 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.45
Metatranscriptomes 1.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.43
Rhizosphere 93.41
Stem 0
Stem Tuber 0
Unclassified 5.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100325578 3300005436 Unclassified 1420
2 Ga0058861_12008625 3300004800 Bacteria 1594
3 Ga0070658_10512459 3300005327 Bacteria 1037
4 Ga0070683_100006315 3300005329 Bacteria 9942
5 Ga0068869_100196988 3300005334 Bacteria 1587
6 Ga0070680_100214215 3300005336 Bacteria 1625
7 Ga0070682_100035345 3300005337 Bacteria 3050
8 Ga0070682_100191756 3300005337 Bacteria 1435
9 Ga0070691_10056826 3300005341 Bacteria 1876
10 Ga0070692_10163484 3300005345 Bacteria 1277
11 Ga0070673_100212860 3300005364 Bacteria 1670
12 Ga0070659_100050662 3300005366 Bacteria 3263
13 Ga0070714_100028911 3300005435 Bacteria 4604
14 Ga0070714_100208705 3300005435 Bacteria 1789
15 Ga0070713_100109782 3300005436 Bacteria 2403
16 Ga0070713_100324620 3300005436 Unclassified 1422
17 Ga0070713_100373237 3300005436 Bacteria 1328
18 Ga0070713_100430928 3300005436 Bacteria 1236
19 Ga0070710_10069726 3300005437 Bacteria 2023
20 Ga0070711_100009173 3300005439 Bacteria 6081
21 Ga0070705_100002490 3300005440 Bacteria 9255
22 Ga0070700_100193179 3300005441 Bacteria 1425
23 Ga0070681_10008339 3300005458 Bacteria 10150
24 Ga0070681_10020362 3300005458 Bacteria 6649
25 Ga0070681_10029706 3300005458 Bacteria 5488
26 Ga0070679_100037101 3300005530 Bacteria 4839
27 Ga0070684_100045184 3300005535 Bacteria 3813
28 Ga0070684_100219055 3300005535 Bacteria 1737
29 Ga0068853_100330955 3300005539 Bacteria 1413
30 Ga0068853_100436181 3300005539 Bacteria 1230
31 Ga0070693_100004567 3300005547 Bacteria 6564
32 Ga0070665_100023128 3300005548 Bacteria 6261
33 Ga0070704_100120379 3300005549 Bacteria 2015
34 Ga0068855_100026281 3300005563 Bacteria 6964
35 Ga0068855_100820105 3300005563 Bacteria 988
36 Ga0068857_100484489 3300005577 Bacteria 1159
37 Ga0068854_100012857 3300005578 Bacteria 5482
38 Ga0068856_100177583 3300005614 Bacteria 2142
39 Ga0068852_100020510 3300005616 Bacteria 5257
40 Ga0068861_100306492 3300005719 Bacteria 1378
41 Ga0068851_10042518 3300005834 Unclassified 2288
42 Ga0070717_10180954 3300006028 Unclassified 1837
43 Ga0070717_10236815 3300006028 Bacteria 1608
44 Ga0070717_10280568 3300006028 Unclassified 1477
45 Ga0070715_10034881 3300006163 Bacteria 2065
46 Ga0070712_100025146 3300006175 Bacteria 3954
47 Ga0070712_100159823 3300006175 Bacteria 1739
48 Ga0070712_100635943 3300006175 Bacteria 906
49 Ga0075428_100003696 3300006844 Bacteria 16773
50 Ga0075428_100012012 3300006844 Bacteria 9635
51 Ga0075428_100364895 3300006844 Bacteria 1549
52 Ga0075430_100006626 3300006846 Bacteria 9763
53 Ga0075430_100006967 3300006846 Bacteria 9530
54 Ga0075430_100036173 3300006846 Bacteria 4186
55 Ga0075430_100187489 3300006846 Bacteria 1720
56 Ga0075431_100003920 3300006847 Bacteria 14486
57 Ga0075431_100043033 3300006847 Bacteria 4660
58 Ga0075429_100001253 3300006880 Bacteria 20630
59 Ga0075429_100006768 3300006880 Bacteria 9939
60 Ga0075429_100076025 3300006880 Bacteria 2925
61 Ga0075436_100001239 3300006914 Bacteria 17347
62 Ga0075436_100001616 3300006914 Bacteria 15424
63 Ga0075436_100207993 3300006914 Unclassified 1387
64 Ga0075435_100164371 3300007076 Bacteria 1871
65 Ga0075435_100205501 3300007076 Bacteria 1669
66 Ga0105240_10129537 3300009093 Bacteria 3028
67 Ga0105240_10133697 3300009093 Bacteria 2972
68 Ga0105240_10175453 3300009093 Bacteria 2534
69 Ga0111539_10000058 3300009094 Bacteria 114638
70 Ga0111539_10004206 3300009094 Bacteria 18884
71 Ga0114129_10288399 3300009147 Bacteria 2191
72 Ga0114129_10316704 3300009147 Bacteria 2075
73 Ga0114129_10405763 3300009147 Bacteria 1795
74 Ga0105241_10049714 3300009174 Unclassified 3194
75 Ga0105242_10586827 3300009176 Bacteria 1074
76 Ga0105248_10031100 3300009177 Bacteria 5966
77 Ga0105237_10051306 3300009545 Bacteria 4143
78 Ga0105238_10114617 3300009551 Unclassified 2674
79 Ga0105238_10128278 3300009551 Bacteria 2515
80 Ga0105238_10173321 3300009551 Bacteria 2134
81 Ga0105239_10096390 3300010375 Bacteria 3268
82 Ga0157373_10010325 3300013100 Bacteria 6877
83 Ga0157373_10062383 3300013100 Bacteria 2640
84 Ga0157370_10209307 3300013104 Bacteria 1808
85 Ga0157369_10161528 3300013105 Bacteria 2365
86 Ga0157369_10244904 3300013105 Bacteria 1872
87 Ga0157369_10378696 3300013105 Bacteria 1469
88 Ga0157378_10942811 3300013297 Bacteria 895
89 Ga0157378_11048773 3300013297 Bacteria 851
90 Ga0163162_10413588 3300013306 Bacteria 1481
91 Ga0157372_10040116 3300013307 Bacteria 5169
92 Ga0157372_10637445 3300013307 Bacteria 1241
93 Ga0157372_10745396 3300013307 Unclassified 1139
94 Ga0157380_10312969 3300014326 Bacteria 1452
95 Ga0157376_10468780 3300014969 Bacteria 1232
96 Ga0213875_10000103 3300021388 Bacteria 96738
97 Ga0213871_10006375 3300021441 Bacteria 2492
98 Ga0224712_10039441 3300022467 Bacteria 1771
99 Ga0207707_10007255 3300025912 Bacteria 9647
100 Ga0207707_10011007 3300025912 Bacteria 7871
101 Ga0207707_10160340 3300025912 Bacteria 1967
102 Ga0207695_10110364 3300025913 Bacteria 2731
103 Ga0207695_10144286 3300025913 Bacteria 2326
104 Ga0207693_10025536 3300025915 Bacteria 4684
105 Ga0207693_10029224 3300025915 Bacteria 4355
106 Ga0207660_10413549 3300025917 Bacteria 1087
107 Ga0207660_10465059 3300025917 Bacteria 1024
108 Ga0207652_10321711 3300025921 Bacteria 1396
109 Ga0207694_10060613 3300025924 Bacteria 2945
110 Ga0207694_10146597 3300025924 Bacteria 1900
111 Ga0207694_10271215 3300025924 Bacteria 1392
112 Ga0207687_10007432 3300025927 Bacteria 7213
113 Ga0207700_10000566 3300025928 Bacteria 21734
114 Ga0207700_10056617 3300025928 Unclassified 2952
115 Ga0207700_10070507 3300025928 Bacteria 2687
116 Ga0207700_10093661 3300025928 Bacteria 2378
117 Ga0207664_10090946 3300025929 Unclassified 2501
118 Ga0207664_10109711 3300025929 Bacteria 2293
119 Ga0207664_10514798 3300025929 Bacteria 1072
120 Ga0207690_10099660 3300025932 Bacteria 2072
121 Ga0207706_10250989 3300025933 Bacteria 1545
122 Ga0207686_10049401 3300025934 Bacteria 2611
123 Ga0207669_10455483 3300025937 Bacteria 1015
124 Ga0207665_10005793 3300025939 Bacteria 8218
125 Ga0207665_10256849 3300025939 Bacteria 1293
126 Ga0207661_10025394 3300025944 Bacteria 4502
127 Ga0207667_10010002 3300025949 Bacteria 11123
128 Ga0207667_10445378 3300025949 Bacteria 1316
129 Ga0207651_10308855 3300025960 Bacteria 1318
130 Ga0207640_10166976 3300025981 Bacteria 1635
131 Ga0207658_10279412 3300025986 Bacteria 1431
132 Ga0207677_10585354 3300026023 Bacteria 977
133 Ga0207678_10225231 3300026067 Bacteria 1605
134 Ga0207674_10478167 3300026116 Bacteria 1204
135 Ga0207698_10287717 3300026142 Bacteria 1523
136 Ga0207428_10011556 3300027907 Bacteria 7797
137 Ga0207428_10026301 3300027907 Bacteria 4857
138 Ga0265770_1016323 3300030878 Bacteria 1137
139 Ga0316579_10138475 3300031691 Bacteria 1173
140 Ga0316577_10072772 3300031733 Bacteria 1919
141 Ga0307416_100158292 3300032002 Bacteria 2089
142 Ga0307416_101056198 3300032002 Bacteria 916
143 Ga0316593_10050805 3300032168 Bacteria 1400
144 Ga0373936_0143247 3300035113 Bacteria 1033
145 Ga0373945_0022905 3300035116 Bacteria 2155
146 Ga0373956_0013874 3300035119 Bacteria 3357
147 Ga0373943_0054779 3300035170 Bacteria 1973
148 Ga0373943_0175203 3300035170 Bacteria 1176
149 Ga0373955_0027457 3300035172 Bacteria 2943
150 Ga0373924_0024247 3300035410 Bacteria 2389
151 Ga0373924_0043516 3300035410 Bacteria 1844
152 Ga0373927_0046129 3300035695 Bacteria 2820
153 Ga0373927_0054215 3300035695 Bacteria 2593
154 Ga0373947_0028489 3300035725 Bacteria 3275
155 Ga0373947_0207361 3300035725 Bacteria 1284
156 Ga0373937_0001760 3300036401 Bacteria 18230
157 Ga0373937_0017198 3300036401 Bacteria 6437
158 Ga0373937_0296762 3300036401 Bacteria 1527
159 Ga0316582_0055741 3300036647 Bacteria 2520
160 Ga0316582_0085211 3300036647 Bacteria 2070
161 Ga0316584_0074895 3300036712 Bacteria 2537
162 Ga0373925_0020880 3300037068 Bacteria 4773
163 Ga0373925_0022385 3300037068 Bacteria 4608
164 Ga0395900_0010775 3300037418 Bacteria 9353
165 Ga0395898_0006158 3300037466 Bacteria 12847
166 Ga0395898_0007997 3300037466 Bacteria 11221
167 Ga0395905_0006285 3300037471 Bacteria 11981
168 Ga0316581_0008189 3300037588 Bacteria 2834
169 Ga0436364_0129406 3300037853 Bacteria 129389
170 Ga0436364_0620583 3300037853 Bacteria 3126
171 Ga0395901_0262272 3300038443 Bacteria 1798
172 Ga0436360_0532175 3300039438 Bacteria 13193
173 Ga0436360_0665081 3300039438 Bacteria 2279
174 Ga0436361_0711299 3300039447 Bacteria 1082
175 Ga0436362_0009035 3300039453 Bacteria 3285
176 Ga0451577_0682028 3300042876 Bacteria 931
177 Ga0466966_0079822 3300044684 Bacteria 2039
178 Ga0466963_0000663 3300044694 Bacteria 16638
179 Ga0453684_0023364 3300044712 Bacteria 9115
180 Ga0453684_0224371 3300044712 Bacteria 2174
181 Ga0453684_0423971 3300044712 Bacteria 1486
182 Ga0466959_0004555 3300045049 Bacteria 9301
183 Ga0466958_0169881 3300045836 Bacteria 1380
184 Ga0466958_0318082 3300045836 Bacteria 1000
185 Ga0466967_0002865 3300045976 Bacteria 10962
186 Ga0466967_0415950 3300045976 Unclassified 1310
187 Ga0495651_0032470 3300046462 Bacteria 4072
188 Ga0495653_0327120 3300046463 Bacteria 992
189 Ga0495580_0468940 3300046472 Bacteria 843
190 Ga0495582_0095158 3300046473 Bacteria 1663
191 Ga0495582_0138507 3300046473 Bacteria 1378
192 Ga0495639_0091980 3300046475 Bacteria 1424
193 Ga0495628_0032980 3300046516 Bacteria 4177
194 Ga0495643_0001737 3300046522 Bacteria 18806
195 Ga0495642_0003553 3300046528 Bacteria 6139
196 Ga0495652_0132098 3300046529 Bacteria 1975
197 Ga0495665_0053268 3300046531 Bacteria 2140
198 Ga0495586_0148373 3300046535 Bacteria 1319
199 Ga0495598_0005129 3300046537 Bacteria 2885
200 Ga0495609_0034365 3300046538 Bacteria 2299
201 Ga0495656_0169722 3300046615 Bacteria 1066
202 Ga0495635_0061637 3300046663 Bacteria 2576
203 Ga0495659_0014189 3300046664 Bacteria 2605
204 Ga0495659_0048526 3300046664 Bacteria 1538
205 Ga0495623_0006552 3300046679 Bacteria 7580
206 Ga0495658_0235876 3300046683 Bacteria 1148
207 Ga0495669_0004746 3300046684 Bacteria 5633
208 Ga0495669_0037140 3300046684 Bacteria 2155
209 Ga0495604_0046016 3300047317 Unclassified 3403
210 Ga0495685_035394 3300047447 Bacteria 1716
211 Ga0496104_0098854 3300048907 Unclassified 2793
212 Ga0496104_0135487 3300048907 Bacteria 2366
213 Ga0496105_0003486 3300048908 Bacteria 11642
214 Ga0496110_0216040 3300048913 Bacteria 1743
215 Ga0496111_0025347 3300048914 Bacteria 4185
216 Ga0496111_0278736 3300048914 Bacteria 1240
217 Ga0496112_0003251 3300048915 Bacteria 13398
218 Ga0496112_0013989 3300048915 Bacteria 7427
219 Ga0496112_0467797 3300048915 Bacteria 1198
220 Ga0496112_0565445 3300048915 Bacteria 1070
221 Ga0496113_0000270 3300048916 Bacteria 24476
222 Ga0496113_0185495 3300048916 Bacteria 1650
223 Ga0496115_0087927 3300048918 Bacteria 2536
224 Ga0496115_0269335 3300048918 Bacteria 1399
225 Ga0501034_0209060 3300049571 Bacteria 1907
226 Ga0501036_0438465 3300049572 Bacteria 1088
227 Ga0501036_0734229 3300049572 Bacteria 815
228 Ga0501039_0195046 3300049575 Bacteria 1592
229 Ga0501040_0310866 3300049576 Bacteria 1127
230 Ga0501042_0098356 3300049578 Bacteria 2104
231 Ga0501046_0019835 3300049580 Bacteria 5568
232 Ga0501068_0105289 3300049584 Bacteria 1751
233 Ga0501072_0041863 3300049588 Bacteria 3598
234 Ga0501075_0069495 3300049591 Bacteria 2661
235 Ga0501076_0058185 3300049592 Bacteria 3071
236 Ga0501079_0015438 3300049741 Bacteria 5828
237 Ga0501081_0028777 3300049743 Bacteria 3751
238 Ga0501035_0333101 3300049822 Bacteria 1273
239 nmdc:mga05p37_278124_c1 3300050507 Bacteria 1997
240 nmdc:mga09592_111150_c1 3300050508 Bacteria 2351
241 nmdc:mga09592_3186_c1 3300050508 Bacteria 13307
242 nmdc:mga09592_581081_c1 3300050508 Bacteria 961
243 nmdc:mga0qj67_10476_c1 3300050509 Bacteria 6925
244 nmdc:mga0qj67_106698_c1 3300050509 Bacteria 2260
245 nmdc:mga0qj67_605423_c1 3300050509 Bacteria 876
246 nmdc:mga0qj67_6124_c1 3300050509 Bacteria 8820
247 nmdc:mga06r32_340056_c1 3300050510 Bacteria 1486
248 nmdc:mga06r32_3572_c1 3300050510 Bacteria 13880
249 nmdc:mga08y16_3505_c1 3300050511 Bacteria 16295
250 nmdc:mga08y16_635_c1 3300050511 Bacteria 32952
251 nmdc:mga08y16_779579_c1 3300050511 Bacteria 950
252 nmdc:mga0n895_97193_c1 3300050512 Bacteria 2950
253 nmdc:mga08x19_150267_c1 3300050514 Bacteria 1577
254 nmdc:mga08x19_3589_c1 3300050514 Bacteria 9229
255 nmdc:mga08x19_398517_c1 3300050514 Bacteria 965
256 Ga0501084_0384919 3300054114 Bacteria 1185
257 Ga0501082_0027378 3300060353 Bacteria 4907
258 Ga0530510_0164170 3300061734 Bacteria 1643
259 Ga0070713_100325578
260 Ga0058861_12008625
261 Ga0070658_10512459
262 Ga0070683_100006315
263 Ga0068869_100196988
264 Ga0070680_100214215
265 Ga0070682_100035345
266 Ga0070682_100191756
267 Ga0070691_10056826
268 Ga0070692_10163484
269 Ga0070673_100212860
270 Ga0070659_100050662
271 Ga0070714_100028911
272 Ga0070714_100208705
273 Ga0070713_100109782
274 Ga0070713_100324620
275 Ga0070713_100373237
276 Ga0070713_100430928
277 Ga0070710_10069726
278 Ga0070711_100009173
279 Ga0070705_100002490
280 Ga0070700_100193179
281 Ga0070681_10008339
282 Ga0070681_10020362
283 Ga0070681_10029706
284 Ga0070679_100037101
285 Ga0070684_100045184
286 Ga0070684_100219055
287 Ga0068853_100330955
288 Ga0068853_100436181
289 Ga0070693_100004567
290 Ga0070665_100023128
291 Ga0070704_100120379
292 Ga0068855_100026281
293 Ga0068855_100820105
294 Ga0068857_100484489
295 Ga0068854_100012857
296 Ga0068856_100177583
297 Ga0068852_100020510
298 Ga0068861_100306492
299 Ga0068851_10042518
300 Ga0070717_10180954
301 Ga0070717_10236815
302 Ga0070717_10280568
303 Ga0070715_10034881
304 Ga0070712_100025146
305 Ga0070712_100159823
306 Ga0070712_100635943
307 Ga0075428_100003696
308 Ga0075428_100012012
309 Ga0075428_100364895
310 Ga0075430_100006626
311 Ga0075430_100006967
312 Ga0075430_100036173
313 Ga0075430_100187489
314 Ga0075431_100003920
315 Ga0075431_100043033
316 Ga0075429_100001253
317 Ga0075429_100006768
318 Ga0075429_100076025
319 Ga0075436_100001239
320 Ga0075436_100001616
321 Ga0075436_100207993
322 Ga0075435_100164371
323 Ga0075435_100205501
324 Ga0105240_10129537
325 Ga0105240_10133697
326 Ga0105240_10175453
327 Ga0111539_10000058
328 Ga0111539_10004206
329 Ga0114129_10288399
330 Ga0114129_10316704
331 Ga0114129_10405763
332 Ga0105241_10049714
333 Ga0105242_10586827
334 Ga0105248_10031100
335 Ga0105237_10051306
336 Ga0105238_10114617
337 Ga0105238_10128278
338 Ga0105238_10173321
339 Ga0105239_10096390
340 Ga0157373_10010325
341 Ga0157373_10062383
342 Ga0157370_10209307
343 Ga0157369_10161528
344 Ga0157369_10244904
345 Ga0157369_10378696
346 Ga0157378_10942811
347 Ga0157378_11048773
348 Ga0163162_10413588
349 Ga0157372_10040116
350 Ga0157372_10637445
351 Ga0157372_10745396
352 Ga0157380_10312969
353 Ga0157376_10468780
354 Ga0213875_10000103
355 Ga0213871_10006375
356 Ga0224712_10039441
357 Ga0207707_10007255
358 Ga0207707_10011007
359 Ga0207707_10160340
360 Ga0207695_10110364
361 Ga0207695_10144286
362 Ga0207693_10025536
363 Ga0207693_10029224
364 Ga0207660_10413549
365 Ga0207660_10465059
366 Ga0207652_10321711
367 Ga0207694_10060613
368 Ga0207694_10146597
369 Ga0207694_10271215
370 Ga0207687_10007432
371 Ga0207700_10000566
372 Ga0207700_10056617
373 Ga0207700_10070507
374 Ga0207700_10093661
375 Ga0207664_10090946
376 Ga0207664_10109711
377 Ga0207664_10514798
378 Ga0207690_10099660
379 Ga0207706_10250989
380 Ga0207686_10049401
381 Ga0207669_10455483
382 Ga0207665_10005793
383 Ga0207665_10256849
384 Ga0207661_10025394
385 Ga0207667_10010002
386 Ga0207667_10445378
387 Ga0207651_10308855
388 Ga0207640_10166976
389 Ga0207658_10279412
390 Ga0207677_10585354
391 Ga0207678_10225231
392 Ga0207674_10478167
393 Ga0207698_10287717
394 Ga0207428_10011556
395 Ga0207428_10026301
396 Ga0265770_1016323
397 Ga0316579_10138475
398 Ga0316577_10072772
399 Ga0307416_100158292
400 Ga0307416_101056198
401 Ga0316593_10050805
402 Ga0373936_0143247
403 Ga0373945_0022905
404 Ga0373956_0013874
405 Ga0373943_0054779
406 Ga0373943_0175203
407 Ga0373955_0027457
408 Ga0373924_0024247
409 Ga0373924_0043516
410 Ga0373927_0046129
411 Ga0373927_0054215
412 Ga0373947_0028489
413 Ga0373947_0207361
414 Ga0373937_0001760
415 Ga0373937_0017198
416 Ga0373937_0296762
417 Ga0316582_0055741
418 Ga0316582_0085211
419 Ga0316584_0074895
420 Ga0373925_0020880
421 Ga0373925_0022385
422 Ga0395900_0010775
423 Ga0395898_0006158
424 Ga0395898_0007997
425 Ga0395905_0006285
426 Ga0316581_0008189
427 Ga0436364_0129406
428 Ga0436364_0620583
429 Ga0395901_0262272
430 Ga0436360_0532175
431 Ga0436360_0665081
432 Ga0436361_0711299
433 Ga0436362_0009035
434 Ga0451577_0682028
435 Ga0466966_0079822
436 Ga0466963_0000663
437 Ga0453684_0023364
438 Ga0453684_0224371
439 Ga0453684_0423971
440 Ga0466959_0004555
441 Ga0466958_0169881
442 Ga0466958_0318082
443 Ga0466967_0002865
444 Ga0466967_0415950
445 Ga0495651_0032470
446 Ga0495653_0327120
447 Ga0495580_0468940
448 Ga0495582_0095158
449 Ga0495582_0138507
450 Ga0495639_0091980
451 Ga0495628_0032980
452 Ga0495643_0001737
453 Ga0495642_0003553
454 Ga0495652_0132098
455 Ga0495665_0053268
456 Ga0495586_0148373
457 Ga0495598_0005129
458 Ga0495609_0034365
459 Ga0495656_0169722
460 Ga0495635_0061637
461 Ga0495659_0014189
462 Ga0495659_0048526
463 Ga0495623_0006552
464 Ga0495658_0235876
465 Ga0495669_0004746
466 Ga0495669_0037140
467 Ga0495604_0046016
468 Ga0495685_035394
469 Ga0496104_0098854
470 Ga0496104_0135487
471 Ga0496105_0003486
472 Ga0496110_0216040
473 Ga0496111_0025347
474 Ga0496111_0278736
475 Ga0496112_0003251
476 Ga0496112_0013989
477 Ga0496112_0467797
478 Ga0496112_0565445
479 Ga0496113_0000270
480 Ga0496113_0185495
481 Ga0496115_0087927
482 Ga0496115_0269335
483 Ga0501034_0209060
484 Ga0501036_0438465
485 Ga0501036_0734229
486 Ga0501039_0195046
487 Ga0501040_0310866
488 Ga0501042_0098356
489 Ga0501046_0019835
490 Ga0501068_0105289
491 Ga0501072_0041863
492 Ga0501075_0069495
493 Ga0501076_0058185
494 Ga0501079_0015438
495 Ga0501081_0028777
496 Ga0501035_0333101
497 nmdc:mga05p37_278124_c1
498 nmdc:mga09592_111150_c1
499 nmdc:mga09592_3186_c1
500 nmdc:mga09592_581081_c1
501 nmdc:mga0qj67_10476_c1
502 nmdc:mga0qj67_106698_c1
503 nmdc:mga0qj67_605423_c1
504 nmdc:mga0qj67_6124_c1
505 nmdc:mga06r32_340056_c1
506 nmdc:mga06r32_3572_c1
507 nmdc:mga08y16_3505_c1
508 nmdc:mga08y16_635_c1
509 nmdc:mga08y16_779579_c1
510 nmdc:mga0n895_97193_c1
511 nmdc:mga08x19_150267_c1
512 nmdc:mga08x19_3589_c1
513 nmdc:mga08x19_398517_c1
514 Ga0501084_0384919
515 Ga0501082_0027378
516 Ga0530510_0164170

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

48

184

0.99

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

181

267

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

54

191

0.94

PF00106

adh_short

short chain dehydrogenase

182

222

0.92

PF08659

KR

KR domain

49

172

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nbv-assembly1.cif.gz_A crystal structure of fabg from cupriavidus taiwanensis 0.9647 4 233
2p68-assembly1.cif.gz_A crystal structure of aq_1716 from aquifex aeolicus vf5 0.9641 3 232
4jro-assembly1.cif.gz_C crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ 0.9604 4 233
3sj7-assembly1.cif.gz_B-2 structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with nadph 0.9597 7 233
3gaf-assembly1.cif.gz_A 2.2a crystal structure of 7-alpha-hydroxysteroid dehydrogenase from brucella melitensis 0.9597 1 230
ID Description Score Start End Superfamily
af_A0A0R0HUJ2_8_65_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9718 8 53 3.40.50.720
af_P0AET8_1_255_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9701 2 230 3.40.50.720
2pnfB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9645 3 232 3.40.50.720
af_B7FAC8_69_312_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9638 7 233 3.40.50.720
4urfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9593 4 234 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6S7B4R7-F1-model_v4 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase LinX (EC 1.1.1.-) 0.9703 4 231 GO:0016616
GO:0030497
AF-F9EF91-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 0.9699 2 231 GO:0004316
AF-A0A7V5HY18-F1-model_v4 SDR family oxidoreductase 0.9697 3 234 GO:0016616
AF-A0A7V3XEK9-F1-model_v4 3-oxoacyl-ACP reductase FabG 0.9697 3 231 GO:0016616
GO:0030497
AF-A0A2V8WTN0-F1-model_v4 Short-chain dehydrogenase 0.9697 4 231 GO:0006633
GO:0016616
GO:0048038

Map