F367839

General Info

Members Datasets Scaffolds Average Seq Length
258 185 244 292

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100020068|Ga0070670_1000200683
Length 325
Sequence MAIAKTDKIWMNGRWVAWDDAKIHVMTHAMHYASAVFEGIRAYETADGPAVFRLDEHLERLLFSARVYRMELPYTAEQLRQACLEIVAVNKLGDCYIRPLVYRGYENIGVNPFGNPIDVAIAAYPWGQYLGPDALTKGVAVKVSTWHRPAPNTLPVMAKASANYMNSQLAKMEAVVDGYAEAIALDVNGFVSEGSGQNVFGVFKGEIVTPPLSSSILAGITRSTVMTLARDLGYVVREETLLREQLYLADELFYSGTAVEVSPIGSVDRIPVGNGGCGPVTKRLQDAFFETVRGKNAKHRDWLTLARPAAAKNSTPAAAVAARQG

Samples

Sample ID Description Type Environment
1 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
2 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
3 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
4 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
5 2842694124 Methylopila sp. R-72369 Isolate Unclassified
6 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
7 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
8 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
9 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
10 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
11 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
12 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
13 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
14 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
15 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
91 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
92 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
93 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
96 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
97 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
98 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
99 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
100 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
101 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
102 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
103 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
104 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
109 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
118 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
119 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
121 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
122 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
123 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
136 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
137 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
144 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
148 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
149 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
150 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
153 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
154 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
155 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
156 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
163 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
164 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
165 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
166 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
167 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
168 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
171 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
176 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
177 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
178 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
179 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
180 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
181 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
182 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
183 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
184 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
185 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.57
Metatranscriptomes 0
Isolates 5.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.71
Nodule 0.39
Rhizoplane 0.78
Rhizosphere 87.98
Stem 0
Stem Tuber 0.39
Unclassified 7.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1000173 3300001976 Bacteria 8882
2 JGI24737J22298_10027409 3300001990 Bacteria 1796
3 Ga0065704_10073678 3300005289 Bacteria 6891
4 Ga0065715_10232919 3300005293 Bacteria 1207
5 Ga0070683_100010143 3300005329 Bacteria 8086
6 Ga0070670_100000016 3300005331 Bacteria 226440
7 Ga0070670_100020068 3300005331 Bacteria 5740
8 Ga0070680_100000525 3300005336 Bacteria 26135
9 Ga0070680_100170608 3300005336 Bacteria 1830
10 Ga0070660_100008964 3300005339 Bacteria 7019
11 Ga0070660_100093998 3300005339 Bacteria 2368
12 Ga0070660_100417398 3300005339 Bacteria 1111
13 Ga0070660_100491141 3300005339 Bacteria 1021
14 Ga0070660_100553294 3300005339 Bacteria 960
15 Ga0070668_100003995 3300005347 Bacteria 10919
16 Ga0070671_100403533 3300005355 Bacteria 1169
17 Ga0070659_100028972 3300005366 Bacteria 4277
18 Ga0070659_100387874 3300005366 Bacteria 1177
19 Ga0070659_100435650 3300005366 Bacteria 1110
20 Ga0070667_100000670 3300005367 Bacteria 33199
21 Ga0070709_10016293 3300005434 Bacteria 4241
22 Ga0070714_100111692 3300005435 Bacteria 2421
23 Ga0070713_100031818 3300005436 Archaea 4206
24 Ga0070713_100053095 3300005436 Archaea 3357
25 Ga0070710_10045718 3300005437 Archaea 2435
26 Ga0070711_100009307 3300005439 Archaea 6043
27 Ga0070711_100123089 3300005439 Archaea 1921
28 Ga0070711_100145213 3300005439 Archaea 1783
29 Ga0070681_10007604 3300005458 Bacteria 10593
30 Ga0070681_10012231 3300005458 Bacteria 8508
31 Ga0070698_100085098 3300005471 Bacteria 3150
32 Ga0070679_100000112 3300005530 Bacteria 63894
33 Ga0070679_100007751 3300005530 Bacteria 10056
34 Ga0070697_100089873 3300005536 Archaea 2538
35 Ga0068853_100160615 3300005539 Bacteria 2028
36 Ga0070696_100355582 3300005546 Archaea 1135
37 Ga0070696_100402118 3300005546 Bacteria 1071
38 Ga0068855_100000305 3300005563 Bacteria 61038
39 Ga0068856_100187555 3300005614 Bacteria 2082
40 Ga0068859_100015951 3300005617 Bacteria 7552
41 Ga0068864_100000017 3300005618 Bacteria 285607
42 Ga0068863_100000018 3300005841 Bacteria 206948
43 Ga0068862_100000010 3300005844 Bacteria 285607
44 Ga0068862_100115186 3300005844 Bacteria 2364
45 Ga0081455_10138333 3300005937 Bacteria 1894
46 Ga0070712_100023187 3300006175 Bacteria 4096
47 Ga0070712_100186158 3300006175 Archaea 1621
48 Ga0097620_100015951 3300006931 Bacteria 7552
49 Ga0105251_10001854 3300009011 Bacteria 17370
50 Ga0105240_10096616 3300009093 Bacteria 3600
51 Ga0105245_10366543 3300009098 Bacteria 1431
52 Ga0105243_10501285 3300009148 Bacteria 1150
53 Ga0105241_10253048 3300009174 Bacteria 1494
54 Ga0105242_10233878 3300009176 Bacteria 1648
55 Ga0105248_10002326 3300009177 Bacteria 21082
56 Ga0105248_10027863 3300009177 Bacteria 6289
57 Ga0105238_10272187 3300009551 Bacteria 1674
58 Ga0105249_10000489 3300009553 Bacteria 36715
59 Ga0157371_10193686 3300013102 Bacteria 1456
60 Ga0157371_10387106 3300013102 Bacteria 1022
61 Ga0157370_10456188 3300013104 Bacteria 1175
62 Ga0163162_10003521 3300013306 Bacteria 14979
63 Ga0163163_10196531 3300014325 Bacteria 2065
64 Ga0157380_10135202 3300014326 Bacteria 2109
65 Ga0182008_10045912 3300014497 Bacteria 2172
66 Ga0157379_10043095 3300014968 Bacteria 4029
67 Ga0213875_10001419 3300021388 Bacteria 15572
68 Ga0207645_10143294 3300025907 Bacteria 1557
69 Ga0207705_10030380 3300025909 Bacteria 3856
70 Ga0207705_10040965 3300025909 Bacteria 3322
71 Ga0207705_10403651 3300025909 Bacteria 1057
72 Ga0207707_10004709 3300025912 Bacteria 11976
73 Ga0207707_10008026 3300025912 Archaea 9168
74 Ga0207707_10141619 3300025912 Bacteria 2102
75 Ga0207695_10062850 3300025913 Bacteria 3830
76 Ga0207695_10127637 3300025913 Archaea 2504
77 Ga0207693_10023283 3300025915 Bacteria 4919
78 Ga0207693_10059594 3300025915 Bacteria 2990
79 Ga0207663_10006471 3300025916 Archaea 5995
80 Ga0207660_10000218 3300025917 Bacteria 36989
81 Ga0207660_10123824 3300025917 Bacteria 1961
82 Ga0207657_10030470 3300025919 Bacteria 4896
83 Ga0207657_10353224 3300025919 Bacteria 1159
84 Ga0207652_10000001 3300025921 Bacteria 1006643
85 Ga0207652_10021432 3300025921 Bacteria 5333
86 Ga0207652_10086995 3300025921 Bacteria 2741
87 Ga0207652_10506610 3300025921 Archaea 1086
88 Ga0207694_10199639 3300025924 Bacteria 1627
89 Ga0207650_10000196 3300025925 Bacteria 69604
90 Ga0207650_10057932 3300025925 Bacteria 2883
91 Ga0207700_10002066 3300025928 Archaea 11479
92 Ga0207700_10151214 3300025928 Archaea 1918
93 Ga0207700_10162540 3300025928 Bacteria 1855
94 Ga0207664_10017932 3300025929 Archaea 5201
95 Ga0207644_10115646 3300025931 Bacteria 2034
96 Ga0207690_10242745 3300025932 Bacteria 1388
97 Ga0207690_10438045 3300025932 Bacteria 1048
98 Ga0207686_10019778 3300025934 Bacteria 3837
99 Ga0207711_10000031 3300025941 Bacteria 203323
100 Ga0207711_10269372 3300025941 Bacteria 1567
101 Ga0207661_10273972 3300025944 Bacteria 1507
102 Ga0207667_10002213 3300025949 Bacteria 24415
103 Ga0207712_10011215 3300025961 Bacteria 5707
104 Ga0207658_10000221 3300025986 Bacteria 59789
105 Ga0207639_10042789 3300026041 Bacteria 3396
106 Ga0207678_10143792 3300026067 Bacteria 2036
107 Ga0207641_10000002 3300026088 Bacteria 981004
108 Ga0207676_10000005 3300026095 Bacteria 698744
109 Ga0268265_10000003 3300028380 Bacteria 949201
110 Ga0268265_10002622 3300028380 Bacteria 13366
111 Ga0268265_10643665 3300028380 Bacteria 1018
112 Ga0268264_10419969 3300028381 Bacteria 1289
113 Ga0265326_10000154 3300028558 Archaea 36241
114 Ga0265326_10001330 3300028558 Archaea 8774
115 Ga0265334_10011041 3300028573 Archaea 3809
116 Ga0265334_10015624 3300028573 Archaea 3150
117 Ga0265322_10000019 3300028654 Archaea 109865
118 Ga0265336_10000094 3300028666 Archaea 68431
119 Ga0265336_10002989 3300028666 Archaea 6751
120 Ga0265338_10000406 3300028800 Archaea 77267
121 Ga0265338_10000488 3300028800 Archaea 70705
122 Ga0265338_10014940 3300028800 Bacteria 8582
123 Ga0265324_10000802 3300029957 Archaea 20530
124 Ga0265324_10002608 3300029957 Archaea 9050
125 Ga0265332_10000289 3300031238 Archaea 39523
126 Ga0265332_10031550 3300031238 Archaea 2311
127 Ga0265328_10016885 3300031239 Archaea 2834
128 Ga0265320_10104919 3300031240 Archaea 1299
129 Ga0265325_10001116 3300031241 Archaea 19244
130 Ga0265325_10001902 3300031241 Bacteria 14413
131 Ga0265329_10000824 3300031242 Archaea 15789
132 Ga0265340_10000030 3300031247 Archaea 68757
133 Ga0265340_10000922 3300031247 Archaea 16722
134 Ga0265339_10000386 3300031249 Archaea 34880
135 Ga0265339_10002991 3300031249 Archaea 11929
136 Ga0265331_10000071 3300031250 Archaea 150739
137 Ga0265331_10000222 3300031250 Archaea 68418
138 Ga0265331_10002842 3300031250 Bacteria 11476
139 Ga0265327_10001513 3300031251 Bacteria 28744
140 Ga0265316_10006572 3300031344 Archaea 11092
141 Ga0265313_10002387 3300031595 Bacteria 16292
142 Ga0265314_10001477 3300031711 Archaea 26143
143 Ga0265314_10044757 3300031711 Bacteria 3134
144 Ga0265342_10008278 3300031712 Bacteria 7486
145 Ga0265342_10012366 3300031712 Archaea 5785
146 Ga0265342_10109216 3300031712 Archaea 1567
147 Ga0316576_10017382 3300031727 Bacteria 4883
148 Ga0307413_10088486 3300031824 Bacteria 2009
149 Ga0307413_10450651 3300031824 Bacteria 1021
150 Ga0307410_10075225 3300031852 Bacteria 2354
151 Ga0307412_10000643 3300031911 Bacteria 20314
152 Ga0307409_100010518 3300031995 Bacteria 5759
153 Ga0307416_100060691 3300032002 Bacteria 3081
154 Ga0307414_10000068 3300032004 Bacteria 100925
155 Ga0307414_10084952 3300032004 Bacteria 2330
156 Ga0307411_10232762 3300032005 Bacteria 1437
157 Ga0316583_10031827 3300032133 Bacteria 1877
158 Ga0373926_0015124 3300035083 Bacteria 2628
159 Ga0373936_0166105 3300035113 Bacteria 963
160 Ga0373945_0018550 3300035116 Bacteria 2367
161 Ga0373943_0000677 3300035170 Bacteria 14848
162 Ga0373946_0000703 3300035171 Bacteria 11327
163 Ga0373942_0051859 3300035207 Archaea 1153
164 Ga0373935_0009114 3300035692 Bacteria 5938
165 Ga0373927_0002769 3300035695 Bacteria 12797
166 Ga0373947_0001871 3300035725 Bacteria 12836
167 Ga0395899_0052253 3300037312 Bacteria 3030
168 Ga0395900_0014695 3300037418 Bacteria 7985
169 Ga0395900_0126232 3300037418 Bacteria 2624
170 Ga0395898_0554641 3300037466 Bacteria 1091
171 Ga0395905_0020290 3300037471 Bacteria 6297
172 Ga0436364_0986946 3300037853 Bacteria 208509
173 Ga0395901_0135048 3300038443 Bacteria 2593
174 Ga0395901_0148634 3300038443 Bacteria 2462
175 Ga0400483_004433 3300039062 Bacteria 2850
176 Ga0400483_051260 3300039062 Bacteria 4213
177 Ga0400483_059716 3300039062 Bacteria 3528
178 Ga0400483_078994 3300039062 Bacteria 2847
179 Ga0400483_085258 3300039062 Bacteria 3572
180 Ga0400483_112837 3300039062 Bacteria 1485
181 Ga0400483_173111 3300039062 Bacteria 2655
182 Ga0400483_187795 3300039062 Bacteria 2515
183 Ga0400483_258309 3300039062 Bacteria 2938
184 Ga0400483_263783 3300039062 Bacteria 3370
185 Ga0436365_1068878 3300039437 Bacteria 1314
186 Ga0451807_2284578 3300041486 Bacteria 1141
187 Ga0450923_006501 3300042125 Bacteria 1942
188 Ga0439464_0004299 3300042439 Bacteria 3640
189 Ga0466963_0048636 3300044694 Bacteria 2803
190 Ga0466971_0028796 3300044719 Bacteria 2484
191 Ga0466957_0052135 3300044842 Bacteria 2491
192 Ga0451576_0003303 3300045051 Bacteria 22399
193 Ga0451576_0009691 3300045051 Bacteria 11143
194 Ga0466967_0099652 3300045976 Bacteria 2654
195 Ga0466967_0188114 3300045976 Bacteria 1950
196 Ga0495629_0075623 3300046459 Bacteria 2352
197 Ga0495580_0046655 3300046472 Bacteria 3073
198 Ga0495630_0031094 3300046517 Bacteria 3973
199 Ga0495645_0244408 3300046543 Bacteria 1196
200 Ga0495658_0011291 3300046683 Bacteria 4489
201 Ga0495613_0001546 3300046689 Bacteria 17491
202 Ga0495613_0148563 3300046689 Bacteria 1672
203 Ga0495684_0029848 3300047471 Bacteria 4185
204 Ga0495614_0105742 3300048089 Bacteria 1233
205 Ga0496112_0029227 3300048915 Bacteria 5329
206 Ga0496117_0003948 3300048920 Bacteria 16776
207 Ga0496118_0001361 3300048921 Bacteria 36837
208 Ga0501290_003614 3300049513 Bacteria 1944
209 Ga0501293_001654 3300049516 Bacteria 1681
210 Ga0501300_002542 3300049523 Bacteria 2730
211 Ga0501034_0000369 3300049571 Bacteria 76727
212 Ga0501034_0072321 3300049571 Bacteria 3457
213 Ga0501034_0160681 3300049571 Bacteria 2218
214 Ga0501038_0053218 3300049574 Bacteria 3486
215 Ga0501039_0187406 3300049575 Archaea 1627
216 Ga0501039_0272531 3300049575 Bacteria 1330
217 Ga0501039_0288720 3300049575 Bacteria 1290
218 Ga0501047_0000219 3300049581 Bacteria 68712
219 Ga0501072_0264249 3300049588 Bacteria 1370
220 Ga0501074_0330784 3300049590 Bacteria 1082
221 Ga0501223_000388 3300049663 Bacteria 10857
222 Ga0501223_008767 3300049663 Bacteria 2059
223 Ga0501224_000009 3300049664 Bacteria 107191
224 Ga0501233_000511 3300049668 Bacteria 6214
225 Ga0501257_000095 3300049686 Bacteria 21617
226 Ga0501225_0000094 3300049705 Bacteria 28402
227 Ga0501234_001202 3300049707 Bacteria 4081
228 Ga0501080_0109091 3300049742 Bacteria 2565
229 Ga0501083_0006382 3300049744 Bacteria 8358
230 Ga0501280_000828 3300049776 Bacteria 6698
231 Ga0501044_0000255 3300049823 Bacteria 67530
232 Ga0501226_000076 3300049853 Bacteria 29950
233 nmdc:mga0n895_68837_c1 3300050512 Bacteria 3506
234 nmdc:mga08x19_93232_c1 3300050514 Archaea 1990
235 Ga0495619_0241377 3300053085 Bacteria 1252
236 Ga0500643_027482 3300053087 Bacteria 1769
237 Ga0500646_0045173 3300053090 Bacteria 1253
238 Ga0500572_000189 3300053111 Bacteria 21822
239 Ga0500595_008323 3300053119 Bacteria 4244
240 Ga0500652_099801 3300053131 Bacteria 1214
241 Ga0500559_0000010 3300053136 Bacteria 165569
242 Ga0500616_0013607 3300053153 Bacteria 4715
243 Ga0501082_0019072 3300060353 Bacteria 5910
244 Ga0501082_0385413 3300060353 Bacteria 1223

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035113 Ga0373936_0166105 Ga0373936_0166105_57_833 255
2 3300025931 Ga0207644_10115646 Ga0207644_101156462 259
3 3300031824 Ga0307413_10088486 Ga0307413_100884863 259
4 3300031852 Ga0307410_10075225 Ga0307410_100752253 259
5 3300031995 Ga0307409_100010518 Ga0307409_1000105186 259
6 3300032002 Ga0307416_100060691 Ga0307416_1000606915 259
7 3300032004 Ga0307414_10084952 Ga0307414_100849524 259
8 3300005355 Ga0070671_100403533 Ga0070671_1004035332 261
9 3300009177 Ga0105248_10027863 Ga0105248_100278635 261
10 3300025941 Ga0207711_10269372 Ga0207711_102693722 261
11 3300037418 Ga0395900_0014695 Ga0395900_0014695_96_1019 261
12 3300044694 Ga0466963_0048636 Ga0466963_0048636_1834_2730 261
13 3300045976 Ga0466967_0099652 Ga0466967_0099652_1517_2413 261
14 3300048915 Ga0496112_0029227 Ga0496112_0029227_3869_4765 261
15 3300044719 Ga0466971_0028796 Ga0466971_0028796_1030_1926 262
16 3300044842 Ga0466957_0052135 Ga0466957_0052135_819_1715 262
17 3300045976 Ga0466967_0188114 Ga0466967_0188114_647_1543 262
18 3300031250 Ga0265331_10002842 Ga0265331_100028423 263
19 3300031595 Ga0265313_10002387 Ga0265313_100023879 263
20 3300031712 Ga0265342_10008278 Ga0265342_100082783 263
21 3300005347 Ga0070668_100003995 Ga0070668_1000039952 264
22 3300025907 Ga0207645_10143294 Ga0207645_101432942 264
23 3300042439 Ga0439464_0004299 Ga0439464_0004299_1206_2099 264
24 3300050512 nmdc:mga0n895_68837_c1 nmdc:mga0n895_68837_c1_340_1143 266
25 3300005336 Ga0070680_100000525 Ga0070680_1000005259 269
26 3300005339 Ga0070660_100008964 Ga0070660_1000089642 269
27 3300005458 Ga0070681_10012231 Ga0070681_100122314 269
28 3300005530 Ga0070679_100000112 Ga0070679_10000011223 269
29 3300025912 Ga0207707_10004709 Ga0207707_1000470911 269
30 3300025917 Ga0207660_10000218 Ga0207660_1000021819 269
31 3300025919 Ga0207657_10030470 Ga0207657_100304702 269
32 3300025921 Ga0207652_10000001 Ga0207652_1000000152 269
33 3300045051 Ga0451576_0009691 Ga0451576_0009691_636_1514 269
34 3300006175 Ga0070712_100023187 Ga0070712_1000231872 271
35 3300025915 Ga0207693_10023283 Ga0207693_100232834 271
36 3300005434 Ga0070709_10016293 Ga0070709_100162932 272
37 3300025928 Ga0207700_10162540 Ga0207700_101625401 272
38 3300028558 Ga0265326_10001330 Ga0265326_100013302 280
39 3300028573 Ga0265334_10011041 Ga0265334_100110414 280
40 3300028666 Ga0265336_10002989 Ga0265336_100029892 280
41 3300029957 Ga0265324_10002608 Ga0265324_1000260813 280
42 3300031238 Ga0265332_10031550 Ga0265332_100315502 280
43 3300031240 Ga0265320_10104919 Ga0265320_101049191 280
44 3300031247 Ga0265340_10000922 Ga0265340_1000092213 280
45 3300031249 Ga0265339_10002991 Ga0265339_1000299112 280
46 iso_pu_bacteria 2854681122 2854685243 283
47 iso_pu_bacteria 2898795034 2898795465 283
48 iso_pu_bacteria 2899275550 2899276284 283
49 iso_pu_bacteria 2919679072 2919680035 283
50 iso_pu_bacteria 2713897090 2715501456 284
51 iso_pu_bacteria 2834578030 2834580773 284
52 iso_pu_bacteria 2855020534 2855020770 284
53 iso_pu_bacteria 2899259804 2899261294 284
54 iso_pu_bacteria 3000017691 3000019582 284
55 iso_pu_bacteria 3000405567 3000408055 284
56 iso_pu_bacteria 8057132660 8057136204 284
57 iso_pu_bacteria 2840878972 2840881867 285
58 iso_pu_bacteria 2643221699 2644550023 286
59 3300039062 Ga0400483_051260 Ga0400483_051260_1570_2436 287
60 3300039062 Ga0400483_112837 Ga0400483_112837_149_1018 287
61 3300039062 Ga0400483_173111 Ga0400483_173111_1395_2261 287
62 3300039062 Ga0400483_258309 Ga0400483_258309_487_1356 287
63 3300041486 Ga0451807_2284578 Ga0451807_2284578_86_955 287
64 3300045051 Ga0451576_0003303 Ga0451576_0003303_10335_11201 287
65 3300049571 Ga0501034_0000369 Ga0501034_0000369_28212_29081 287
66 3300005436 Ga0070713_100031818 Ga0070713_1000318183 288
67 3300005436 Ga0070713_100053095 Ga0070713_1000530953 288
68 3300005437 Ga0070710_10045718 Ga0070710_100457183 288
69 3300005439 Ga0070711_100009307 Ga0070711_1000093074 288
70 3300005439 Ga0070711_100145213 Ga0070711_1001452131 288
71 3300005536 Ga0070697_100089873 Ga0070697_1000898732 288
72 3300005546 Ga0070696_100355582 Ga0070696_1003555821 288
73 3300006175 Ga0070712_100186158 Ga0070712_1001861582 288
74 3300025912 Ga0207707_10008026 Ga0207707_100080268 288
75 3300025913 Ga0207695_10127637 Ga0207695_101276373 288
76 3300025916 Ga0207663_10006471 Ga0207663_100064717 288
77 3300025921 Ga0207652_10506610 Ga0207652_105066101 288
78 3300025928 Ga0207700_10002066 Ga0207700_100020663 288
79 3300025928 Ga0207700_10151214 Ga0207700_101512142 288
80 3300025929 Ga0207664_10017932 Ga0207664_100179323 288
81 3300028558 Ga0265326_10000154 Ga0265326_1000015410 288
82 3300028573 Ga0265334_10015624 Ga0265334_100156243 288
83 3300028654 Ga0265322_10000019 Ga0265322_1000001914 288
84 3300028666 Ga0265336_10000094 Ga0265336_1000009411 288
85 3300028800 Ga0265338_10000406 Ga0265338_1000040677 288
86 3300028800 Ga0265338_10000488 Ga0265338_1000048868 288
87 3300029957 Ga0265324_10000802 Ga0265324_1000080210 288
88 3300031238 Ga0265332_10000289 Ga0265332_1000028910 288
89 3300031239 Ga0265328_10016885 Ga0265328_100168853 288
90 3300031241 Ga0265325_10001116 Ga0265325_1000111614 288
91 3300031242 Ga0265329_10000824 Ga0265329_1000082412 288
92 3300031247 Ga0265340_10000030 Ga0265340_1000003068 288
93 3300031249 Ga0265339_10000386 Ga0265339_1000038632 288
94 3300031250 Ga0265331_10000071 Ga0265331_10000071157 288
95 3300031250 Ga0265331_10000222 Ga0265331_1000022211 288
96 3300031344 Ga0265316_10006572 Ga0265316_100065727 288
97 3300031711 Ga0265314_10001477 Ga0265314_1000147710 288
98 3300031712 Ga0265342_10012366 Ga0265342_100123662 288
99 3300031712 Ga0265342_10109216 Ga0265342_101092162 288
100 3300035207 Ga0373942_0051859 Ga0373942_0051859_71_985 288
101 3300049575 Ga0501039_0187406 Ga0501039_0187406_256_1170 288
102 3300050514 nmdc:mga08x19_93232_c1 nmdc:mga08x19_93232_c1_671_1585 288
103 3300028380 Ga0268265_10002622 Ga0268265_1000262215 289
104 3300032133 Ga0316583_10031827 Ga0316583_100318271 289
105 3300039062 Ga0400483_004433 Ga0400483_004433_438_1352 289
106 3300039062 Ga0400483_059716 Ga0400483_059716_2115_3026 289
107 3300039062 Ga0400483_187795 Ga0400483_187795_816_1727 289
108 3300005331 Ga0070670_100020068 Ga0070670_1000200683 290
109 3300005439 Ga0070711_100123089 Ga0070711_1001230892 290
110 3300005471 Ga0070698_100085098 Ga0070698_1000850984 290
111 3300005937 Ga0081455_10138333 Ga0081455_101383332 290
112 3300025925 Ga0207650_10057932 Ga0207650_100579323 290
113 3300028381 Ga0268264_10419969 Ga0268264_104199691 290
114 3300039062 Ga0400483_078994 Ga0400483_078994_690_1646 290
115 3300053085 Ga0495619_0241377 Ga0495619_0241377_69_989 290
116 3300053153 Ga0500616_0013607 Ga0500616_0013607_450_1406 290
117 3300031727 Ga0316576_10017382 Ga0316576_100173827 291
118 3300049513 Ga0501290_003614 Ga0501290_003614_486_1361 291
119 3300049516 Ga0501293_001654 Ga0501293_001654_296_1171 291
120 3300049523 Ga0501300_002542 Ga0501300_002542_373_1248 291
121 3300049663 Ga0501223_008767 Ga0501223_008767_128_1003 291
122 3300049686 Ga0501257_000095 Ga0501257_000095_774_1649 291
123 3300049776 Ga0501280_000828 Ga0501280_000828_795_1670 291
124 iso_pu_bacteria 2842694124 2842695964 291
125 3300005546 Ga0070696_100402118 Ga0070696_1004021181 292
126 3300005844 Ga0068862_100115186 Ga0068862_1001151863 292
127 3300009176 Ga0105242_10233878 Ga0105242_102338782 292
128 3300014326 Ga0157380_10135202 Ga0157380_101352022 292
129 3300025934 Ga0207686_10019778 Ga0207686_100197782 292
130 3300028380 Ga0268265_10643665 Ga0268265_106436652 292
131 3300031911 Ga0307412_10000643 Ga0307412_1000064313 292
132 3300032004 Ga0307414_10000068 Ga0307414_1000006853 292
133 3300032005 Ga0307411_10232762 Ga0307411_102327622 292
134 3300039062 Ga0400483_085258 Ga0400483_085258_2166_3047 292
135 3300039062 Ga0400483_263783 Ga0400483_263783_1777_2658 292
136 3300042125 Ga0450923_006501 Ga0450923_006501_406_1287 292
137 3300049571 Ga0501034_0072321 Ga0501034_0072321_380_1261 292
138 3300049575 Ga0501039_0272531 Ga0501039_0272531_93_980 292
139 3300049575 Ga0501039_0288720 Ga0501039_0288720_190_1074 292
140 3300049581 Ga0501047_0000219 Ga0501047_0000219_3453_4331 292
141 3300049588 Ga0501072_0264249 Ga0501072_0264249_346_1230 292
142 3300049663 Ga0501223_000388 Ga0501223_000388_6829_7710 292
143 3300049664 Ga0501224_000009 Ga0501224_000009_21346_22227 292
144 3300049668 Ga0501233_000511 Ga0501233_000511_5155_6036 292
145 3300049705 Ga0501225_0000094 Ga0501225_0000094_4918_5799 292
146 3300049707 Ga0501234_001202 Ga0501234_001202_2440_3321 292
147 3300049742 Ga0501080_0109091 Ga0501080_0109091_1554_2432 292
148 3300049744 Ga0501083_0006382 Ga0501083_0006382_6074_6952 292
149 3300049853 Ga0501226_000076 Ga0501226_000076_8033_8914 292
150 3300060353 Ga0501082_0019072 Ga0501082_0019072_4078_4956 292
151 3300005339 Ga0070660_100491141 Ga0070660_1004911411 293
152 3300005435 Ga0070714_100111692 Ga0070714_1001116922 293
153 3300005458 Ga0070681_10007604 Ga0070681_100076047 293
154 3300005530 Ga0070679_100007751 Ga0070679_1000077517 293
155 3300009098 Ga0105245_10366543 Ga0105245_103665432 293
156 3300009148 Ga0105243_10501285 Ga0105243_105012851 293
157 3300013102 Ga0157371_10193686 Ga0157371_101936862 293
158 3300013104 Ga0157370_10456188 Ga0157370_104561881 293
159 3300014497 Ga0182008_10045912 Ga0182008_100459122 293
160 3300025909 Ga0207705_10040965 Ga0207705_100409652 293
161 3300025909 Ga0207705_10403651 Ga0207705_104036511 293
162 3300025915 Ga0207693_10059594 Ga0207693_100595942 293
163 3300025917 Ga0207660_10123824 Ga0207660_101238242 293
164 3300025919 Ga0207657_10353224 Ga0207657_103532241 293
165 3300025921 Ga0207652_10021432 Ga0207652_100214324 293
166 3300025944 Ga0207661_10273972 Ga0207661_102739722 293
167 3300028800 Ga0265338_10014940 Ga0265338_100149406 293
168 3300031241 Ga0265325_10001902 Ga0265325_1000190215 293
169 3300031251 Ga0265327_10001513 Ga0265327_1000151311 293
170 3300031711 Ga0265314_10044757 Ga0265314_100447574 293
171 3300035083 Ga0373926_0015124 Ga0373926_0015124_888_1778 293
172 3300035116 Ga0373945_0018550 Ga0373945_0018550_829_1719 293
173 3300035170 Ga0373943_0000677 Ga0373943_0000677_879_1769 293
174 3300035171 Ga0373946_0000703 Ga0373946_0000703_3758_4648 293
175 3300035692 Ga0373935_0009114 Ga0373935_0009114_2383_3273 293
176 3300035695 Ga0373927_0002769 Ga0373927_0002769_10051_10941 293
177 3300035725 Ga0373947_0001871 Ga0373947_0001871_827_1717 293
178 3300037312 Ga0395899_0052253 Ga0395899_0052253_579_1463 293
179 3300037418 Ga0395900_0126232 Ga0395900_0126232_1417_2301 293
180 3300037466 Ga0395898_0554641 Ga0395898_0554641_99_983 293
181 3300037471 Ga0395905_0020290 Ga0395905_0020290_3269_4153 293
182 3300038443 Ga0395901_0135048 Ga0395901_0135048_1429_2313 293
183 3300038443 Ga0395901_0148634 Ga0395901_0148634_1363_2247 293
184 3300046459 Ga0495629_0075623 Ga0495629_0075623_70_960 293
185 3300046472 Ga0495580_0046655 Ga0495580_0046655_856_1746 293
186 3300046517 Ga0495630_0031094 Ga0495630_0031094_2284_3174 293
187 3300046543 Ga0495645_0244408 Ga0495645_0244408_55_939 293
188 3300046683 Ga0495658_0011291 Ga0495658_0011291_695_1585 293
189 3300046689 Ga0495613_0001546 Ga0495613_0001546_15327_16211 293
190 3300046689 Ga0495613_0148563 Ga0495613_0148563_111_1001 293
191 3300047471 Ga0495684_0029848 Ga0495684_0029848_2611_3501 293
192 3300048089 Ga0495614_0105742 Ga0495614_0105742_208_1098 293
193 3300049571 Ga0501034_0160681 Ga0501034_0160681_871_1761 293
194 3300049574 Ga0501038_0053218 Ga0501038_0053218_1901_2791 293
195 3300049823 Ga0501044_0000255 Ga0501044_0000255_32179_33069 293
196 3300053087 Ga0500643_027482 Ga0500643_027482_522_1409 293
197 3300053090 Ga0500646_0045173 Ga0500646_0045173_84_974 293
198 3300053119 Ga0500595_008323 Ga0500595_008323_1817_2701 293
199 3300005339 Ga0070660_100553294 Ga0070660_1005532941 294
200 3300005539 Ga0068853_100160615 Ga0068853_1001606152 294
201 3300005563 Ga0068855_100000305 Ga0068855_10000030512 294
202 3300005614 Ga0068856_100187555 Ga0068856_1001875553 294
203 3300009093 Ga0105240_10096616 Ga0105240_100966162 294
204 3300009174 Ga0105241_10253048 Ga0105241_102530482 294
205 3300009551 Ga0105238_10272187 Ga0105238_102721871 294
206 3300025913 Ga0207695_10062850 Ga0207695_100628504 294
207 3300025921 Ga0207652_10086995 Ga0207652_100869952 294
208 3300025924 Ga0207694_10199639 Ga0207694_101996391 294
209 3300025949 Ga0207667_10002213 Ga0207667_1000221320 294
210 3300026041 Ga0207639_10042789 Ga0207639_100427892 294
211 3300031824 Ga0307413_10450651 Ga0307413_104506511 294
212 3300049590 Ga0501074_0330784 Ga0501074_0330784_127_1023 294
213 3300053111 Ga0500572_000189 Ga0500572_000189_20032_20919 294
214 3300053131 Ga0500652_099801 Ga0500652_099801_165_1052 294
215 3300053136 Ga0500559_0000010 Ga0500559_0000010_96957_97850 294
216 3300060353 Ga0501082_0385413 Ga0501082_0385413_248_1174 294
217 3300001976 JGI24752J21851_1000173 JGI24752J21851_10001738 295
218 3300001990 JGI24737J22298_10027409 JGI24737J22298_100274092 295
219 3300005289 Ga0065704_10073678 Ga0065704_100736782 295
220 3300005293 Ga0065715_10232919 Ga0065715_102329191 295
221 3300005329 Ga0070683_100010143 Ga0070683_1000101437 295
222 3300005331 Ga0070670_100000016 Ga0070670_100000016192 295
223 3300005336 Ga0070680_100170608 Ga0070680_1001706082 295
224 3300005339 Ga0070660_100093998 Ga0070660_1000939982 295
225 3300005339 Ga0070660_100417398 Ga0070660_1004173981 295
226 3300005366 Ga0070659_100028972 Ga0070659_1000289721 295
227 3300005366 Ga0070659_100387874 Ga0070659_1003878742 295
228 3300005366 Ga0070659_100435650 Ga0070659_1004356501 295
229 3300005367 Ga0070667_100000670 Ga0070667_10000067029 295
230 3300005617 Ga0068859_100015951 Ga0068859_10001595110 295
231 3300005618 Ga0068864_100000017 Ga0068864_10000001795 295
232 3300005841 Ga0068863_100000018 Ga0068863_10000001813 295
233 3300005844 Ga0068862_100000010 Ga0068862_100000010215 295
234 3300006931 Ga0097620_100015951 Ga0097620_1000159513 295
235 3300009011 Ga0105251_10001854 Ga0105251_1000185421 295
236 3300009177 Ga0105248_10002326 Ga0105248_1000232619 295
237 3300009553 Ga0105249_10000489 Ga0105249_1000048941 295
238 3300013102 Ga0157371_10387106 Ga0157371_103871061 295
239 3300013306 Ga0163162_10003521 Ga0163162_1000352110 295
240 3300014325 Ga0163163_10196531 Ga0163163_101965313 295
241 3300014968 Ga0157379_10043095 Ga0157379_100430954 295
242 3300021388 Ga0213875_10001419 Ga0213875_100014192 295
243 3300025909 Ga0207705_10030380 Ga0207705_100303804 295
244 3300025912 Ga0207707_10141619 Ga0207707_101416192 295
245 3300025925 Ga0207650_10000196 Ga0207650_1000019628 295
246 3300025932 Ga0207690_10242745 Ga0207690_102427451 295
247 3300025932 Ga0207690_10438045 Ga0207690_104380451 295
248 3300025941 Ga0207711_10000031 Ga0207711_10000031211 295
249 3300025961 Ga0207712_10011215 Ga0207712_100112154 295
250 3300025986 Ga0207658_10000221 Ga0207658_1000022115 295
251 3300026067 Ga0207678_10143792 Ga0207678_101437922 295
252 3300026088 Ga0207641_10000002 Ga0207641_10000002270 295
253 3300026095 Ga0207676_10000005 Ga0207676_10000005537 295
254 3300028380 Ga0268265_10000003 Ga0268265_10000003719 295
255 3300037853 Ga0436364_0986946 Ga0436364_0986946_170449_171342 295
256 3300039437 Ga0436365_1068878 Ga0436365_1068878_134_1027 295
257 3300048920 Ga0496117_0003948 Ga0496117_0003948_1070_1957 295
258 3300048921 Ga0496118_0001361 Ga0496118_0001361_26286_27173 295

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01063

Aminotran_4

Amino-transferase class IV

35

267

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4whx-assembly1.cif.gz_E x-ray crystal structure of an amino acid aminotransferase from burkholderia pseudomallei bound to the co-factor pyridoxal phosphate 0.9683 7 293
3u0g-assembly2.cif.gz_A crystal structure of branched-chain amino acid aminotransferase from burkholderia pseudomallei 0.9623 7 293
6nst-assembly1.cif.gz_B crystal structure of branched chain amino acid aminotransferase from pseudomonas aeruginosa 0.9602 7 294
6nst-assembly1.cif.gz_A crystal structure of branched chain amino acid aminotransferase from pseudomonas aeruginosa 0.9554 7 290
1wrv-assembly1.cif.gz_B crystal structure of t.th.hb8 branched-chain amino acid aminotransferase 0.9551 10 294
ID Description Score Start End Superfamily
4whxA01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.9725 11 132 3.30.470.10
3u0gF02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9625 136 291 3.20.10.10
af_P0AB80_8_124_3.30.470.10 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.9599 14 123 3.30.470.10
6h65B02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.956 138 291 3.20.10.10
6gkrB02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9543 138 291 3.20.10.10
ID Description Score Start End GO Terms
AF-U3AAQ9-F1-model_v4 Branched-chain-amino-acid aminotransferase (BCAT) (EC 2.6.1.42) 0.9914 4 289 GO:0009097
GO:0009098
GO:0009099
GO:0052655
GO:0052656
AF-A0A2S6SN88-F1-model_v4 Probable branched-chain-amino-acid aminotransferase (EC 2.6.1.42) 0.9873 62 288 GO:0003824
GO:0008652
GO:0009082
AF-A0A7C9GEA6-F1-model_v4 Branched-chain-amino-acid aminotransferase (BCAT) (EC 2.6.1.42) 0.9847 7 290 GO:0004084
GO:0005829
GO:0009097
GO:0009098
GO:0009099
AF-A0A4V0I2N3-F1-model_v4 Branched-chain-amino-acid aminotransferase (BCAT) (EC 2.6.1.42) 0.9846 1 289 GO:0005829
GO:0009097
GO:0009098
GO:0009099
GO:0052655
GO:0052656
AF-F7XVU9-F1-model_v4 Branched-chain-amino-acid aminotransferase (BCAT) (EC 2.6.1.42) 0.9815 7 288 GO:0009097
GO:0009098
GO:0009099
GO:0052655
GO:0052656

Feature Viewer

pLDDT pTM Quality
92.42 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map