F367839
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 258 | 185 | 244 | 292 |
Family's Representative Sequence
| Representative Sequence | 3300005331|Ga0070670_100020068|Ga0070670_1000200683 |
| Length | 325 |
| Sequence | MAIAKTDKIWMNGRWVAWDDAKIHVMTHAMHYASAVFEGIRAYETADGPAVFRLDEHLERLLFSARVYRMELPYTAEQLRQACLEIVAVNKLGDCYIRPLVYRGYENIGVNPFGNPIDVAIAAYPWGQYLGPDALTKGVAVKVSTWHRPAPNTLPVMAKASANYMNSQLAKMEAVVDGYAEAIALDVNGFVSEGSGQNVFGVFKGEIVTPPLSSSILAGITRSTVMTLARDLGYVVREETLLREQLYLADELFYSGTAVEVSPIGSVDRIPVGNGGCGPVTKRLQDAFFETVRGKNAKHRDWLTLARPAAAKNSTPAAAVAARQG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 2 | 2713897090 | Paracoccus sphaerophysae HAMBI 3106 | Isolate | Nodule |
| 3 | 2834578030 | Paracoccus thiocyanatus SST | Isolate | Unclassified |
| 4 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 5 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 6 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 7 | 2855020534 | Paracoccus endophyticus SYSUP0003 | Isolate | Stem Tuber |
| 8 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 9 | 2899259804 | Paracoccus aeridis JC501 | Isolate | Rhizosphere |
| 10 | 2899275550 | Paracoccus hibiscisoli CCTCC AB2016182 | Isolate | Rhizosphere |
| 11 | 2919679072 | Pseudotabrizicola sp. 4114 | Isolate | Unclassified |
| 12 | 3000017691 | Rhodobacteraceae bacterium GH2-2 | Isolate | Rhizosphere |
| 13 | 3000405567 | Rhodobacteraceae bacterium LNNU 3342 | Isolate | Rhizosphere |
| 14 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 15 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 16 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 44 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 61 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 63 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 91 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 92 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 93 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 94 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 95 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 96 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 97 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 98 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 99 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 100 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 101 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 102 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 103 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 104 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 105 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 106 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 107 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 108 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 109 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 110 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 111 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 112 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 113 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 114 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 115 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 116 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 117 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 118 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 119 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 120 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 121 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 122 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 123 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 124 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 125 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 126 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 127 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 128 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 129 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 130 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 131 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 132 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 133 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 134 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 135 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 136 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 137 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 138 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 139 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 140 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 141 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 142 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 143 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 152 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 153 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 154 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 155 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 156 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 157 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 164 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 165 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 166 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 167 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 168 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 169 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 172 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 174 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 178 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 179 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 180 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 181 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 182 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 183 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 184 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 185 | 8057132660 | Paracoccus rhizosphaerae LMG 21293 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.57 |
| Metatranscriptomes | 0 |
| Isolates | 5.43 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.71 |
| Nodule | 0.39 |
| Rhizoplane | 0.78 |
| Rhizosphere | 87.98 |
| Stem | 0 |
| Stem Tuber | 0.39 |
| Unclassified | 7.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1000173 | 3300001976 | Bacteria | 8882 |
| 2 | JGI24737J22298_10027409 | 3300001990 | Bacteria | 1796 |
| 3 | Ga0065704_10073678 | 3300005289 | Bacteria | 6891 |
| 4 | Ga0065715_10232919 | 3300005293 | Bacteria | 1207 |
| 5 | Ga0070683_100010143 | 3300005329 | Bacteria | 8086 |
| 6 | Ga0070670_100000016 | 3300005331 | Bacteria | 226440 |
| 7 | Ga0070670_100020068 | 3300005331 | Bacteria | 5740 |
| 8 | Ga0070680_100000525 | 3300005336 | Bacteria | 26135 |
| 9 | Ga0070680_100170608 | 3300005336 | Bacteria | 1830 |
| 10 | Ga0070660_100008964 | 3300005339 | Bacteria | 7019 |
| 11 | Ga0070660_100093998 | 3300005339 | Bacteria | 2368 |
| 12 | Ga0070660_100417398 | 3300005339 | Bacteria | 1111 |
| 13 | Ga0070660_100491141 | 3300005339 | Bacteria | 1021 |
| 14 | Ga0070660_100553294 | 3300005339 | Bacteria | 960 |
| 15 | Ga0070668_100003995 | 3300005347 | Bacteria | 10919 |
| 16 | Ga0070671_100403533 | 3300005355 | Bacteria | 1169 |
| 17 | Ga0070659_100028972 | 3300005366 | Bacteria | 4277 |
| 18 | Ga0070659_100387874 | 3300005366 | Bacteria | 1177 |
| 19 | Ga0070659_100435650 | 3300005366 | Bacteria | 1110 |
| 20 | Ga0070667_100000670 | 3300005367 | Bacteria | 33199 |
| 21 | Ga0070709_10016293 | 3300005434 | Bacteria | 4241 |
| 22 | Ga0070714_100111692 | 3300005435 | Bacteria | 2421 |
| 23 | Ga0070713_100031818 | 3300005436 | Archaea | 4206 |
| 24 | Ga0070713_100053095 | 3300005436 | Archaea | 3357 |
| 25 | Ga0070710_10045718 | 3300005437 | Archaea | 2435 |
| 26 | Ga0070711_100009307 | 3300005439 | Archaea | 6043 |
| 27 | Ga0070711_100123089 | 3300005439 | Archaea | 1921 |
| 28 | Ga0070711_100145213 | 3300005439 | Archaea | 1783 |
| 29 | Ga0070681_10007604 | 3300005458 | Bacteria | 10593 |
| 30 | Ga0070681_10012231 | 3300005458 | Bacteria | 8508 |
| 31 | Ga0070698_100085098 | 3300005471 | Bacteria | 3150 |
| 32 | Ga0070679_100000112 | 3300005530 | Bacteria | 63894 |
| 33 | Ga0070679_100007751 | 3300005530 | Bacteria | 10056 |
| 34 | Ga0070697_100089873 | 3300005536 | Archaea | 2538 |
| 35 | Ga0068853_100160615 | 3300005539 | Bacteria | 2028 |
| 36 | Ga0070696_100355582 | 3300005546 | Archaea | 1135 |
| 37 | Ga0070696_100402118 | 3300005546 | Bacteria | 1071 |
| 38 | Ga0068855_100000305 | 3300005563 | Bacteria | 61038 |
| 39 | Ga0068856_100187555 | 3300005614 | Bacteria | 2082 |
| 40 | Ga0068859_100015951 | 3300005617 | Bacteria | 7552 |
| 41 | Ga0068864_100000017 | 3300005618 | Bacteria | 285607 |
| 42 | Ga0068863_100000018 | 3300005841 | Bacteria | 206948 |
| 43 | Ga0068862_100000010 | 3300005844 | Bacteria | 285607 |
| 44 | Ga0068862_100115186 | 3300005844 | Bacteria | 2364 |
| 45 | Ga0081455_10138333 | 3300005937 | Bacteria | 1894 |
| 46 | Ga0070712_100023187 | 3300006175 | Bacteria | 4096 |
| 47 | Ga0070712_100186158 | 3300006175 | Archaea | 1621 |
| 48 | Ga0097620_100015951 | 3300006931 | Bacteria | 7552 |
| 49 | Ga0105251_10001854 | 3300009011 | Bacteria | 17370 |
| 50 | Ga0105240_10096616 | 3300009093 | Bacteria | 3600 |
| 51 | Ga0105245_10366543 | 3300009098 | Bacteria | 1431 |
| 52 | Ga0105243_10501285 | 3300009148 | Bacteria | 1150 |
| 53 | Ga0105241_10253048 | 3300009174 | Bacteria | 1494 |
| 54 | Ga0105242_10233878 | 3300009176 | Bacteria | 1648 |
| 55 | Ga0105248_10002326 | 3300009177 | Bacteria | 21082 |
| 56 | Ga0105248_10027863 | 3300009177 | Bacteria | 6289 |
| 57 | Ga0105238_10272187 | 3300009551 | Bacteria | 1674 |
| 58 | Ga0105249_10000489 | 3300009553 | Bacteria | 36715 |
| 59 | Ga0157371_10193686 | 3300013102 | Bacteria | 1456 |
| 60 | Ga0157371_10387106 | 3300013102 | Bacteria | 1022 |
| 61 | Ga0157370_10456188 | 3300013104 | Bacteria | 1175 |
| 62 | Ga0163162_10003521 | 3300013306 | Bacteria | 14979 |
| 63 | Ga0163163_10196531 | 3300014325 | Bacteria | 2065 |
| 64 | Ga0157380_10135202 | 3300014326 | Bacteria | 2109 |
| 65 | Ga0182008_10045912 | 3300014497 | Bacteria | 2172 |
| 66 | Ga0157379_10043095 | 3300014968 | Bacteria | 4029 |
| 67 | Ga0213875_10001419 | 3300021388 | Bacteria | 15572 |
| 68 | Ga0207645_10143294 | 3300025907 | Bacteria | 1557 |
| 69 | Ga0207705_10030380 | 3300025909 | Bacteria | 3856 |
| 70 | Ga0207705_10040965 | 3300025909 | Bacteria | 3322 |
| 71 | Ga0207705_10403651 | 3300025909 | Bacteria | 1057 |
| 72 | Ga0207707_10004709 | 3300025912 | Bacteria | 11976 |
| 73 | Ga0207707_10008026 | 3300025912 | Archaea | 9168 |
| 74 | Ga0207707_10141619 | 3300025912 | Bacteria | 2102 |
| 75 | Ga0207695_10062850 | 3300025913 | Bacteria | 3830 |
| 76 | Ga0207695_10127637 | 3300025913 | Archaea | 2504 |
| 77 | Ga0207693_10023283 | 3300025915 | Bacteria | 4919 |
| 78 | Ga0207693_10059594 | 3300025915 | Bacteria | 2990 |
| 79 | Ga0207663_10006471 | 3300025916 | Archaea | 5995 |
| 80 | Ga0207660_10000218 | 3300025917 | Bacteria | 36989 |
| 81 | Ga0207660_10123824 | 3300025917 | Bacteria | 1961 |
| 82 | Ga0207657_10030470 | 3300025919 | Bacteria | 4896 |
| 83 | Ga0207657_10353224 | 3300025919 | Bacteria | 1159 |
| 84 | Ga0207652_10000001 | 3300025921 | Bacteria | 1006643 |
| 85 | Ga0207652_10021432 | 3300025921 | Bacteria | 5333 |
| 86 | Ga0207652_10086995 | 3300025921 | Bacteria | 2741 |
| 87 | Ga0207652_10506610 | 3300025921 | Archaea | 1086 |
| 88 | Ga0207694_10199639 | 3300025924 | Bacteria | 1627 |
| 89 | Ga0207650_10000196 | 3300025925 | Bacteria | 69604 |
| 90 | Ga0207650_10057932 | 3300025925 | Bacteria | 2883 |
| 91 | Ga0207700_10002066 | 3300025928 | Archaea | 11479 |
| 92 | Ga0207700_10151214 | 3300025928 | Archaea | 1918 |
| 93 | Ga0207700_10162540 | 3300025928 | Bacteria | 1855 |
| 94 | Ga0207664_10017932 | 3300025929 | Archaea | 5201 |
| 95 | Ga0207644_10115646 | 3300025931 | Bacteria | 2034 |
| 96 | Ga0207690_10242745 | 3300025932 | Bacteria | 1388 |
| 97 | Ga0207690_10438045 | 3300025932 | Bacteria | 1048 |
| 98 | Ga0207686_10019778 | 3300025934 | Bacteria | 3837 |
| 99 | Ga0207711_10000031 | 3300025941 | Bacteria | 203323 |
| 100 | Ga0207711_10269372 | 3300025941 | Bacteria | 1567 |
| 101 | Ga0207661_10273972 | 3300025944 | Bacteria | 1507 |
| 102 | Ga0207667_10002213 | 3300025949 | Bacteria | 24415 |
| 103 | Ga0207712_10011215 | 3300025961 | Bacteria | 5707 |
| 104 | Ga0207658_10000221 | 3300025986 | Bacteria | 59789 |
| 105 | Ga0207639_10042789 | 3300026041 | Bacteria | 3396 |
| 106 | Ga0207678_10143792 | 3300026067 | Bacteria | 2036 |
| 107 | Ga0207641_10000002 | 3300026088 | Bacteria | 981004 |
| 108 | Ga0207676_10000005 | 3300026095 | Bacteria | 698744 |
| 109 | Ga0268265_10000003 | 3300028380 | Bacteria | 949201 |
| 110 | Ga0268265_10002622 | 3300028380 | Bacteria | 13366 |
| 111 | Ga0268265_10643665 | 3300028380 | Bacteria | 1018 |
| 112 | Ga0268264_10419969 | 3300028381 | Bacteria | 1289 |
| 113 | Ga0265326_10000154 | 3300028558 | Archaea | 36241 |
| 114 | Ga0265326_10001330 | 3300028558 | Archaea | 8774 |
| 115 | Ga0265334_10011041 | 3300028573 | Archaea | 3809 |
| 116 | Ga0265334_10015624 | 3300028573 | Archaea | 3150 |
| 117 | Ga0265322_10000019 | 3300028654 | Archaea | 109865 |
| 118 | Ga0265336_10000094 | 3300028666 | Archaea | 68431 |
| 119 | Ga0265336_10002989 | 3300028666 | Archaea | 6751 |
| 120 | Ga0265338_10000406 | 3300028800 | Archaea | 77267 |
| 121 | Ga0265338_10000488 | 3300028800 | Archaea | 70705 |
| 122 | Ga0265338_10014940 | 3300028800 | Bacteria | 8582 |
| 123 | Ga0265324_10000802 | 3300029957 | Archaea | 20530 |
| 124 | Ga0265324_10002608 | 3300029957 | Archaea | 9050 |
| 125 | Ga0265332_10000289 | 3300031238 | Archaea | 39523 |
| 126 | Ga0265332_10031550 | 3300031238 | Archaea | 2311 |
| 127 | Ga0265328_10016885 | 3300031239 | Archaea | 2834 |
| 128 | Ga0265320_10104919 | 3300031240 | Archaea | 1299 |
| 129 | Ga0265325_10001116 | 3300031241 | Archaea | 19244 |
| 130 | Ga0265325_10001902 | 3300031241 | Bacteria | 14413 |
| 131 | Ga0265329_10000824 | 3300031242 | Archaea | 15789 |
| 132 | Ga0265340_10000030 | 3300031247 | Archaea | 68757 |
| 133 | Ga0265340_10000922 | 3300031247 | Archaea | 16722 |
| 134 | Ga0265339_10000386 | 3300031249 | Archaea | 34880 |
| 135 | Ga0265339_10002991 | 3300031249 | Archaea | 11929 |
| 136 | Ga0265331_10000071 | 3300031250 | Archaea | 150739 |
| 137 | Ga0265331_10000222 | 3300031250 | Archaea | 68418 |
| 138 | Ga0265331_10002842 | 3300031250 | Bacteria | 11476 |
| 139 | Ga0265327_10001513 | 3300031251 | Bacteria | 28744 |
| 140 | Ga0265316_10006572 | 3300031344 | Archaea | 11092 |
| 141 | Ga0265313_10002387 | 3300031595 | Bacteria | 16292 |
| 142 | Ga0265314_10001477 | 3300031711 | Archaea | 26143 |
| 143 | Ga0265314_10044757 | 3300031711 | Bacteria | 3134 |
| 144 | Ga0265342_10008278 | 3300031712 | Bacteria | 7486 |
| 145 | Ga0265342_10012366 | 3300031712 | Archaea | 5785 |
| 146 | Ga0265342_10109216 | 3300031712 | Archaea | 1567 |
| 147 | Ga0316576_10017382 | 3300031727 | Bacteria | 4883 |
| 148 | Ga0307413_10088486 | 3300031824 | Bacteria | 2009 |
| 149 | Ga0307413_10450651 | 3300031824 | Bacteria | 1021 |
| 150 | Ga0307410_10075225 | 3300031852 | Bacteria | 2354 |
| 151 | Ga0307412_10000643 | 3300031911 | Bacteria | 20314 |
| 152 | Ga0307409_100010518 | 3300031995 | Bacteria | 5759 |
| 153 | Ga0307416_100060691 | 3300032002 | Bacteria | 3081 |
| 154 | Ga0307414_10000068 | 3300032004 | Bacteria | 100925 |
| 155 | Ga0307414_10084952 | 3300032004 | Bacteria | 2330 |
| 156 | Ga0307411_10232762 | 3300032005 | Bacteria | 1437 |
| 157 | Ga0316583_10031827 | 3300032133 | Bacteria | 1877 |
| 158 | Ga0373926_0015124 | 3300035083 | Bacteria | 2628 |
| 159 | Ga0373936_0166105 | 3300035113 | Bacteria | 963 |
| 160 | Ga0373945_0018550 | 3300035116 | Bacteria | 2367 |
| 161 | Ga0373943_0000677 | 3300035170 | Bacteria | 14848 |
| 162 | Ga0373946_0000703 | 3300035171 | Bacteria | 11327 |
| 163 | Ga0373942_0051859 | 3300035207 | Archaea | 1153 |
| 164 | Ga0373935_0009114 | 3300035692 | Bacteria | 5938 |
| 165 | Ga0373927_0002769 | 3300035695 | Bacteria | 12797 |
| 166 | Ga0373947_0001871 | 3300035725 | Bacteria | 12836 |
| 167 | Ga0395899_0052253 | 3300037312 | Bacteria | 3030 |
| 168 | Ga0395900_0014695 | 3300037418 | Bacteria | 7985 |
| 169 | Ga0395900_0126232 | 3300037418 | Bacteria | 2624 |
| 170 | Ga0395898_0554641 | 3300037466 | Bacteria | 1091 |
| 171 | Ga0395905_0020290 | 3300037471 | Bacteria | 6297 |
| 172 | Ga0436364_0986946 | 3300037853 | Bacteria | 208509 |
| 173 | Ga0395901_0135048 | 3300038443 | Bacteria | 2593 |
| 174 | Ga0395901_0148634 | 3300038443 | Bacteria | 2462 |
| 175 | Ga0400483_004433 | 3300039062 | Bacteria | 2850 |
| 176 | Ga0400483_051260 | 3300039062 | Bacteria | 4213 |
| 177 | Ga0400483_059716 | 3300039062 | Bacteria | 3528 |
| 178 | Ga0400483_078994 | 3300039062 | Bacteria | 2847 |
| 179 | Ga0400483_085258 | 3300039062 | Bacteria | 3572 |
| 180 | Ga0400483_112837 | 3300039062 | Bacteria | 1485 |
| 181 | Ga0400483_173111 | 3300039062 | Bacteria | 2655 |
| 182 | Ga0400483_187795 | 3300039062 | Bacteria | 2515 |
| 183 | Ga0400483_258309 | 3300039062 | Bacteria | 2938 |
| 184 | Ga0400483_263783 | 3300039062 | Bacteria | 3370 |
| 185 | Ga0436365_1068878 | 3300039437 | Bacteria | 1314 |
| 186 | Ga0451807_2284578 | 3300041486 | Bacteria | 1141 |
| 187 | Ga0450923_006501 | 3300042125 | Bacteria | 1942 |
| 188 | Ga0439464_0004299 | 3300042439 | Bacteria | 3640 |
| 189 | Ga0466963_0048636 | 3300044694 | Bacteria | 2803 |
| 190 | Ga0466971_0028796 | 3300044719 | Bacteria | 2484 |
| 191 | Ga0466957_0052135 | 3300044842 | Bacteria | 2491 |
| 192 | Ga0451576_0003303 | 3300045051 | Bacteria | 22399 |
| 193 | Ga0451576_0009691 | 3300045051 | Bacteria | 11143 |
| 194 | Ga0466967_0099652 | 3300045976 | Bacteria | 2654 |
| 195 | Ga0466967_0188114 | 3300045976 | Bacteria | 1950 |
| 196 | Ga0495629_0075623 | 3300046459 | Bacteria | 2352 |
| 197 | Ga0495580_0046655 | 3300046472 | Bacteria | 3073 |
| 198 | Ga0495630_0031094 | 3300046517 | Bacteria | 3973 |
| 199 | Ga0495645_0244408 | 3300046543 | Bacteria | 1196 |
| 200 | Ga0495658_0011291 | 3300046683 | Bacteria | 4489 |
| 201 | Ga0495613_0001546 | 3300046689 | Bacteria | 17491 |
| 202 | Ga0495613_0148563 | 3300046689 | Bacteria | 1672 |
| 203 | Ga0495684_0029848 | 3300047471 | Bacteria | 4185 |
| 204 | Ga0495614_0105742 | 3300048089 | Bacteria | 1233 |
| 205 | Ga0496112_0029227 | 3300048915 | Bacteria | 5329 |
| 206 | Ga0496117_0003948 | 3300048920 | Bacteria | 16776 |
| 207 | Ga0496118_0001361 | 3300048921 | Bacteria | 36837 |
| 208 | Ga0501290_003614 | 3300049513 | Bacteria | 1944 |
| 209 | Ga0501293_001654 | 3300049516 | Bacteria | 1681 |
| 210 | Ga0501300_002542 | 3300049523 | Bacteria | 2730 |
| 211 | Ga0501034_0000369 | 3300049571 | Bacteria | 76727 |
| 212 | Ga0501034_0072321 | 3300049571 | Bacteria | 3457 |
| 213 | Ga0501034_0160681 | 3300049571 | Bacteria | 2218 |
| 214 | Ga0501038_0053218 | 3300049574 | Bacteria | 3486 |
| 215 | Ga0501039_0187406 | 3300049575 | Archaea | 1627 |
| 216 | Ga0501039_0272531 | 3300049575 | Bacteria | 1330 |
| 217 | Ga0501039_0288720 | 3300049575 | Bacteria | 1290 |
| 218 | Ga0501047_0000219 | 3300049581 | Bacteria | 68712 |
| 219 | Ga0501072_0264249 | 3300049588 | Bacteria | 1370 |
| 220 | Ga0501074_0330784 | 3300049590 | Bacteria | 1082 |
| 221 | Ga0501223_000388 | 3300049663 | Bacteria | 10857 |
| 222 | Ga0501223_008767 | 3300049663 | Bacteria | 2059 |
| 223 | Ga0501224_000009 | 3300049664 | Bacteria | 107191 |
| 224 | Ga0501233_000511 | 3300049668 | Bacteria | 6214 |
| 225 | Ga0501257_000095 | 3300049686 | Bacteria | 21617 |
| 226 | Ga0501225_0000094 | 3300049705 | Bacteria | 28402 |
| 227 | Ga0501234_001202 | 3300049707 | Bacteria | 4081 |
| 228 | Ga0501080_0109091 | 3300049742 | Bacteria | 2565 |
| 229 | Ga0501083_0006382 | 3300049744 | Bacteria | 8358 |
| 230 | Ga0501280_000828 | 3300049776 | Bacteria | 6698 |
| 231 | Ga0501044_0000255 | 3300049823 | Bacteria | 67530 |
| 232 | Ga0501226_000076 | 3300049853 | Bacteria | 29950 |
| 233 | nmdc:mga0n895_68837_c1 | 3300050512 | Bacteria | 3506 |
| 234 | nmdc:mga08x19_93232_c1 | 3300050514 | Archaea | 1990 |
| 235 | Ga0495619_0241377 | 3300053085 | Bacteria | 1252 |
| 236 | Ga0500643_027482 | 3300053087 | Bacteria | 1769 |
| 237 | Ga0500646_0045173 | 3300053090 | Bacteria | 1253 |
| 238 | Ga0500572_000189 | 3300053111 | Bacteria | 21822 |
| 239 | Ga0500595_008323 | 3300053119 | Bacteria | 4244 |
| 240 | Ga0500652_099801 | 3300053131 | Bacteria | 1214 |
| 241 | Ga0500559_0000010 | 3300053136 | Bacteria | 165569 |
| 242 | Ga0500616_0013607 | 3300053153 | Bacteria | 4715 |
| 243 | Ga0501082_0019072 | 3300060353 | Bacteria | 5910 |
| 244 | Ga0501082_0385413 | 3300060353 | Bacteria | 1223 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035113 | Ga0373936_0166105 | Ga0373936_0166105_57_833 | 255 |
| 2 | 3300025931 | Ga0207644_10115646 | Ga0207644_101156462 | 259 |
| 3 | 3300031824 | Ga0307413_10088486 | Ga0307413_100884863 | 259 |
| 4 | 3300031852 | Ga0307410_10075225 | Ga0307410_100752253 | 259 |
| 5 | 3300031995 | Ga0307409_100010518 | Ga0307409_1000105186 | 259 |
| 6 | 3300032002 | Ga0307416_100060691 | Ga0307416_1000606915 | 259 |
| 7 | 3300032004 | Ga0307414_10084952 | Ga0307414_100849524 | 259 |
| 8 | 3300005355 | Ga0070671_100403533 | Ga0070671_1004035332 | 261 |
| 9 | 3300009177 | Ga0105248_10027863 | Ga0105248_100278635 | 261 |
| 10 | 3300025941 | Ga0207711_10269372 | Ga0207711_102693722 | 261 |
| 11 | 3300037418 | Ga0395900_0014695 | Ga0395900_0014695_96_1019 | 261 |
| 12 | 3300044694 | Ga0466963_0048636 | Ga0466963_0048636_1834_2730 | 261 |
| 13 | 3300045976 | Ga0466967_0099652 | Ga0466967_0099652_1517_2413 | 261 |
| 14 | 3300048915 | Ga0496112_0029227 | Ga0496112_0029227_3869_4765 | 261 |
| 15 | 3300044719 | Ga0466971_0028796 | Ga0466971_0028796_1030_1926 | 262 |
| 16 | 3300044842 | Ga0466957_0052135 | Ga0466957_0052135_819_1715 | 262 |
| 17 | 3300045976 | Ga0466967_0188114 | Ga0466967_0188114_647_1543 | 262 |
| 18 | 3300031250 | Ga0265331_10002842 | Ga0265331_100028423 | 263 |
| 19 | 3300031595 | Ga0265313_10002387 | Ga0265313_100023879 | 263 |
| 20 | 3300031712 | Ga0265342_10008278 | Ga0265342_100082783 | 263 |
| 21 | 3300005347 | Ga0070668_100003995 | Ga0070668_1000039952 | 264 |
| 22 | 3300025907 | Ga0207645_10143294 | Ga0207645_101432942 | 264 |
| 23 | 3300042439 | Ga0439464_0004299 | Ga0439464_0004299_1206_2099 | 264 |
| 24 | 3300050512 | nmdc:mga0n895_68837_c1 | nmdc:mga0n895_68837_c1_340_1143 | 266 |
| 25 | 3300005336 | Ga0070680_100000525 | Ga0070680_1000005259 | 269 |
| 26 | 3300005339 | Ga0070660_100008964 | Ga0070660_1000089642 | 269 |
| 27 | 3300005458 | Ga0070681_10012231 | Ga0070681_100122314 | 269 |
| 28 | 3300005530 | Ga0070679_100000112 | Ga0070679_10000011223 | 269 |
| 29 | 3300025912 | Ga0207707_10004709 | Ga0207707_1000470911 | 269 |
| 30 | 3300025917 | Ga0207660_10000218 | Ga0207660_1000021819 | 269 |
| 31 | 3300025919 | Ga0207657_10030470 | Ga0207657_100304702 | 269 |
| 32 | 3300025921 | Ga0207652_10000001 | Ga0207652_1000000152 | 269 |
| 33 | 3300045051 | Ga0451576_0009691 | Ga0451576_0009691_636_1514 | 269 |
| 34 | 3300006175 | Ga0070712_100023187 | Ga0070712_1000231872 | 271 |
| 35 | 3300025915 | Ga0207693_10023283 | Ga0207693_100232834 | 271 |
| 36 | 3300005434 | Ga0070709_10016293 | Ga0070709_100162932 | 272 |
| 37 | 3300025928 | Ga0207700_10162540 | Ga0207700_101625401 | 272 |
| 38 | 3300028558 | Ga0265326_10001330 | Ga0265326_100013302 | 280 |
| 39 | 3300028573 | Ga0265334_10011041 | Ga0265334_100110414 | 280 |
| 40 | 3300028666 | Ga0265336_10002989 | Ga0265336_100029892 | 280 |
| 41 | 3300029957 | Ga0265324_10002608 | Ga0265324_1000260813 | 280 |
| 42 | 3300031238 | Ga0265332_10031550 | Ga0265332_100315502 | 280 |
| 43 | 3300031240 | Ga0265320_10104919 | Ga0265320_101049191 | 280 |
| 44 | 3300031247 | Ga0265340_10000922 | Ga0265340_1000092213 | 280 |
| 45 | 3300031249 | Ga0265339_10002991 | Ga0265339_1000299112 | 280 |
| 46 | iso_pu_bacteria | 2854681122 | 2854685243 | 283 |
| 47 | iso_pu_bacteria | 2898795034 | 2898795465 | 283 |
| 48 | iso_pu_bacteria | 2899275550 | 2899276284 | 283 |
| 49 | iso_pu_bacteria | 2919679072 | 2919680035 | 283 |
| 50 | iso_pu_bacteria | 2713897090 | 2715501456 | 284 |
| 51 | iso_pu_bacteria | 2834578030 | 2834580773 | 284 |
| 52 | iso_pu_bacteria | 2855020534 | 2855020770 | 284 |
| 53 | iso_pu_bacteria | 2899259804 | 2899261294 | 284 |
| 54 | iso_pu_bacteria | 3000017691 | 3000019582 | 284 |
| 55 | iso_pu_bacteria | 3000405567 | 3000408055 | 284 |
| 56 | iso_pu_bacteria | 8057132660 | 8057136204 | 284 |
| 57 | iso_pu_bacteria | 2840878972 | 2840881867 | 285 |
| 58 | iso_pu_bacteria | 2643221699 | 2644550023 | 286 |
| 59 | 3300039062 | Ga0400483_051260 | Ga0400483_051260_1570_2436 | 287 |
| 60 | 3300039062 | Ga0400483_112837 | Ga0400483_112837_149_1018 | 287 |
| 61 | 3300039062 | Ga0400483_173111 | Ga0400483_173111_1395_2261 | 287 |
| 62 | 3300039062 | Ga0400483_258309 | Ga0400483_258309_487_1356 | 287 |
| 63 | 3300041486 | Ga0451807_2284578 | Ga0451807_2284578_86_955 | 287 |
| 64 | 3300045051 | Ga0451576_0003303 | Ga0451576_0003303_10335_11201 | 287 |
| 65 | 3300049571 | Ga0501034_0000369 | Ga0501034_0000369_28212_29081 | 287 |
| 66 | 3300005436 | Ga0070713_100031818 | Ga0070713_1000318183 | 288 |
| 67 | 3300005436 | Ga0070713_100053095 | Ga0070713_1000530953 | 288 |
| 68 | 3300005437 | Ga0070710_10045718 | Ga0070710_100457183 | 288 |
| 69 | 3300005439 | Ga0070711_100009307 | Ga0070711_1000093074 | 288 |
| 70 | 3300005439 | Ga0070711_100145213 | Ga0070711_1001452131 | 288 |
| 71 | 3300005536 | Ga0070697_100089873 | Ga0070697_1000898732 | 288 |
| 72 | 3300005546 | Ga0070696_100355582 | Ga0070696_1003555821 | 288 |
| 73 | 3300006175 | Ga0070712_100186158 | Ga0070712_1001861582 | 288 |
| 74 | 3300025912 | Ga0207707_10008026 | Ga0207707_100080268 | 288 |
| 75 | 3300025913 | Ga0207695_10127637 | Ga0207695_101276373 | 288 |
| 76 | 3300025916 | Ga0207663_10006471 | Ga0207663_100064717 | 288 |
| 77 | 3300025921 | Ga0207652_10506610 | Ga0207652_105066101 | 288 |
| 78 | 3300025928 | Ga0207700_10002066 | Ga0207700_100020663 | 288 |
| 79 | 3300025928 | Ga0207700_10151214 | Ga0207700_101512142 | 288 |
| 80 | 3300025929 | Ga0207664_10017932 | Ga0207664_100179323 | 288 |
| 81 | 3300028558 | Ga0265326_10000154 | Ga0265326_1000015410 | 288 |
| 82 | 3300028573 | Ga0265334_10015624 | Ga0265334_100156243 | 288 |
| 83 | 3300028654 | Ga0265322_10000019 | Ga0265322_1000001914 | 288 |
| 84 | 3300028666 | Ga0265336_10000094 | Ga0265336_1000009411 | 288 |
| 85 | 3300028800 | Ga0265338_10000406 | Ga0265338_1000040677 | 288 |
| 86 | 3300028800 | Ga0265338_10000488 | Ga0265338_1000048868 | 288 |
| 87 | 3300029957 | Ga0265324_10000802 | Ga0265324_1000080210 | 288 |
| 88 | 3300031238 | Ga0265332_10000289 | Ga0265332_1000028910 | 288 |
| 89 | 3300031239 | Ga0265328_10016885 | Ga0265328_100168853 | 288 |
| 90 | 3300031241 | Ga0265325_10001116 | Ga0265325_1000111614 | 288 |
| 91 | 3300031242 | Ga0265329_10000824 | Ga0265329_1000082412 | 288 |
| 92 | 3300031247 | Ga0265340_10000030 | Ga0265340_1000003068 | 288 |
| 93 | 3300031249 | Ga0265339_10000386 | Ga0265339_1000038632 | 288 |
| 94 | 3300031250 | Ga0265331_10000071 | Ga0265331_10000071157 | 288 |
| 95 | 3300031250 | Ga0265331_10000222 | Ga0265331_1000022211 | 288 |
| 96 | 3300031344 | Ga0265316_10006572 | Ga0265316_100065727 | 288 |
| 97 | 3300031711 | Ga0265314_10001477 | Ga0265314_1000147710 | 288 |
| 98 | 3300031712 | Ga0265342_10012366 | Ga0265342_100123662 | 288 |
| 99 | 3300031712 | Ga0265342_10109216 | Ga0265342_101092162 | 288 |
| 100 | 3300035207 | Ga0373942_0051859 | Ga0373942_0051859_71_985 | 288 |
| 101 | 3300049575 | Ga0501039_0187406 | Ga0501039_0187406_256_1170 | 288 |
| 102 | 3300050514 | nmdc:mga08x19_93232_c1 | nmdc:mga08x19_93232_c1_671_1585 | 288 |
| 103 | 3300028380 | Ga0268265_10002622 | Ga0268265_1000262215 | 289 |
| 104 | 3300032133 | Ga0316583_10031827 | Ga0316583_100318271 | 289 |
| 105 | 3300039062 | Ga0400483_004433 | Ga0400483_004433_438_1352 | 289 |
| 106 | 3300039062 | Ga0400483_059716 | Ga0400483_059716_2115_3026 | 289 |
| 107 | 3300039062 | Ga0400483_187795 | Ga0400483_187795_816_1727 | 289 |
| 108 | 3300005331 | Ga0070670_100020068 | Ga0070670_1000200683 | 290 |
| 109 | 3300005439 | Ga0070711_100123089 | Ga0070711_1001230892 | 290 |
| 110 | 3300005471 | Ga0070698_100085098 | Ga0070698_1000850984 | 290 |
| 111 | 3300005937 | Ga0081455_10138333 | Ga0081455_101383332 | 290 |
| 112 | 3300025925 | Ga0207650_10057932 | Ga0207650_100579323 | 290 |
| 113 | 3300028381 | Ga0268264_10419969 | Ga0268264_104199691 | 290 |
| 114 | 3300039062 | Ga0400483_078994 | Ga0400483_078994_690_1646 | 290 |
| 115 | 3300053085 | Ga0495619_0241377 | Ga0495619_0241377_69_989 | 290 |
| 116 | 3300053153 | Ga0500616_0013607 | Ga0500616_0013607_450_1406 | 290 |
| 117 | 3300031727 | Ga0316576_10017382 | Ga0316576_100173827 | 291 |
| 118 | 3300049513 | Ga0501290_003614 | Ga0501290_003614_486_1361 | 291 |
| 119 | 3300049516 | Ga0501293_001654 | Ga0501293_001654_296_1171 | 291 |
| 120 | 3300049523 | Ga0501300_002542 | Ga0501300_002542_373_1248 | 291 |
| 121 | 3300049663 | Ga0501223_008767 | Ga0501223_008767_128_1003 | 291 |
| 122 | 3300049686 | Ga0501257_000095 | Ga0501257_000095_774_1649 | 291 |
| 123 | 3300049776 | Ga0501280_000828 | Ga0501280_000828_795_1670 | 291 |
| 124 | iso_pu_bacteria | 2842694124 | 2842695964 | 291 |
| 125 | 3300005546 | Ga0070696_100402118 | Ga0070696_1004021181 | 292 |
| 126 | 3300005844 | Ga0068862_100115186 | Ga0068862_1001151863 | 292 |
| 127 | 3300009176 | Ga0105242_10233878 | Ga0105242_102338782 | 292 |
| 128 | 3300014326 | Ga0157380_10135202 | Ga0157380_101352022 | 292 |
| 129 | 3300025934 | Ga0207686_10019778 | Ga0207686_100197782 | 292 |
| 130 | 3300028380 | Ga0268265_10643665 | Ga0268265_106436652 | 292 |
| 131 | 3300031911 | Ga0307412_10000643 | Ga0307412_1000064313 | 292 |
| 132 | 3300032004 | Ga0307414_10000068 | Ga0307414_1000006853 | 292 |
| 133 | 3300032005 | Ga0307411_10232762 | Ga0307411_102327622 | 292 |
| 134 | 3300039062 | Ga0400483_085258 | Ga0400483_085258_2166_3047 | 292 |
| 135 | 3300039062 | Ga0400483_263783 | Ga0400483_263783_1777_2658 | 292 |
| 136 | 3300042125 | Ga0450923_006501 | Ga0450923_006501_406_1287 | 292 |
| 137 | 3300049571 | Ga0501034_0072321 | Ga0501034_0072321_380_1261 | 292 |
| 138 | 3300049575 | Ga0501039_0272531 | Ga0501039_0272531_93_980 | 292 |
| 139 | 3300049575 | Ga0501039_0288720 | Ga0501039_0288720_190_1074 | 292 |
| 140 | 3300049581 | Ga0501047_0000219 | Ga0501047_0000219_3453_4331 | 292 |
| 141 | 3300049588 | Ga0501072_0264249 | Ga0501072_0264249_346_1230 | 292 |
| 142 | 3300049663 | Ga0501223_000388 | Ga0501223_000388_6829_7710 | 292 |
| 143 | 3300049664 | Ga0501224_000009 | Ga0501224_000009_21346_22227 | 292 |
| 144 | 3300049668 | Ga0501233_000511 | Ga0501233_000511_5155_6036 | 292 |
| 145 | 3300049705 | Ga0501225_0000094 | Ga0501225_0000094_4918_5799 | 292 |
| 146 | 3300049707 | Ga0501234_001202 | Ga0501234_001202_2440_3321 | 292 |
| 147 | 3300049742 | Ga0501080_0109091 | Ga0501080_0109091_1554_2432 | 292 |
| 148 | 3300049744 | Ga0501083_0006382 | Ga0501083_0006382_6074_6952 | 292 |
| 149 | 3300049853 | Ga0501226_000076 | Ga0501226_000076_8033_8914 | 292 |
| 150 | 3300060353 | Ga0501082_0019072 | Ga0501082_0019072_4078_4956 | 292 |
| 151 | 3300005339 | Ga0070660_100491141 | Ga0070660_1004911411 | 293 |
| 152 | 3300005435 | Ga0070714_100111692 | Ga0070714_1001116922 | 293 |
| 153 | 3300005458 | Ga0070681_10007604 | Ga0070681_100076047 | 293 |
| 154 | 3300005530 | Ga0070679_100007751 | Ga0070679_1000077517 | 293 |
| 155 | 3300009098 | Ga0105245_10366543 | Ga0105245_103665432 | 293 |
| 156 | 3300009148 | Ga0105243_10501285 | Ga0105243_105012851 | 293 |
| 157 | 3300013102 | Ga0157371_10193686 | Ga0157371_101936862 | 293 |
| 158 | 3300013104 | Ga0157370_10456188 | Ga0157370_104561881 | 293 |
| 159 | 3300014497 | Ga0182008_10045912 | Ga0182008_100459122 | 293 |
| 160 | 3300025909 | Ga0207705_10040965 | Ga0207705_100409652 | 293 |
| 161 | 3300025909 | Ga0207705_10403651 | Ga0207705_104036511 | 293 |
| 162 | 3300025915 | Ga0207693_10059594 | Ga0207693_100595942 | 293 |
| 163 | 3300025917 | Ga0207660_10123824 | Ga0207660_101238242 | 293 |
| 164 | 3300025919 | Ga0207657_10353224 | Ga0207657_103532241 | 293 |
| 165 | 3300025921 | Ga0207652_10021432 | Ga0207652_100214324 | 293 |
| 166 | 3300025944 | Ga0207661_10273972 | Ga0207661_102739722 | 293 |
| 167 | 3300028800 | Ga0265338_10014940 | Ga0265338_100149406 | 293 |
| 168 | 3300031241 | Ga0265325_10001902 | Ga0265325_1000190215 | 293 |
| 169 | 3300031251 | Ga0265327_10001513 | Ga0265327_1000151311 | 293 |
| 170 | 3300031711 | Ga0265314_10044757 | Ga0265314_100447574 | 293 |
| 171 | 3300035083 | Ga0373926_0015124 | Ga0373926_0015124_888_1778 | 293 |
| 172 | 3300035116 | Ga0373945_0018550 | Ga0373945_0018550_829_1719 | 293 |
| 173 | 3300035170 | Ga0373943_0000677 | Ga0373943_0000677_879_1769 | 293 |
| 174 | 3300035171 | Ga0373946_0000703 | Ga0373946_0000703_3758_4648 | 293 |
| 175 | 3300035692 | Ga0373935_0009114 | Ga0373935_0009114_2383_3273 | 293 |
| 176 | 3300035695 | Ga0373927_0002769 | Ga0373927_0002769_10051_10941 | 293 |
| 177 | 3300035725 | Ga0373947_0001871 | Ga0373947_0001871_827_1717 | 293 |
| 178 | 3300037312 | Ga0395899_0052253 | Ga0395899_0052253_579_1463 | 293 |
| 179 | 3300037418 | Ga0395900_0126232 | Ga0395900_0126232_1417_2301 | 293 |
| 180 | 3300037466 | Ga0395898_0554641 | Ga0395898_0554641_99_983 | 293 |
| 181 | 3300037471 | Ga0395905_0020290 | Ga0395905_0020290_3269_4153 | 293 |
| 182 | 3300038443 | Ga0395901_0135048 | Ga0395901_0135048_1429_2313 | 293 |
| 183 | 3300038443 | Ga0395901_0148634 | Ga0395901_0148634_1363_2247 | 293 |
| 184 | 3300046459 | Ga0495629_0075623 | Ga0495629_0075623_70_960 | 293 |
| 185 | 3300046472 | Ga0495580_0046655 | Ga0495580_0046655_856_1746 | 293 |
| 186 | 3300046517 | Ga0495630_0031094 | Ga0495630_0031094_2284_3174 | 293 |
| 187 | 3300046543 | Ga0495645_0244408 | Ga0495645_0244408_55_939 | 293 |
| 188 | 3300046683 | Ga0495658_0011291 | Ga0495658_0011291_695_1585 | 293 |
| 189 | 3300046689 | Ga0495613_0001546 | Ga0495613_0001546_15327_16211 | 293 |
| 190 | 3300046689 | Ga0495613_0148563 | Ga0495613_0148563_111_1001 | 293 |
| 191 | 3300047471 | Ga0495684_0029848 | Ga0495684_0029848_2611_3501 | 293 |
| 192 | 3300048089 | Ga0495614_0105742 | Ga0495614_0105742_208_1098 | 293 |
| 193 | 3300049571 | Ga0501034_0160681 | Ga0501034_0160681_871_1761 | 293 |
| 194 | 3300049574 | Ga0501038_0053218 | Ga0501038_0053218_1901_2791 | 293 |
| 195 | 3300049823 | Ga0501044_0000255 | Ga0501044_0000255_32179_33069 | 293 |
| 196 | 3300053087 | Ga0500643_027482 | Ga0500643_027482_522_1409 | 293 |
| 197 | 3300053090 | Ga0500646_0045173 | Ga0500646_0045173_84_974 | 293 |
| 198 | 3300053119 | Ga0500595_008323 | Ga0500595_008323_1817_2701 | 293 |
| 199 | 3300005339 | Ga0070660_100553294 | Ga0070660_1005532941 | 294 |
| 200 | 3300005539 | Ga0068853_100160615 | Ga0068853_1001606152 | 294 |
| 201 | 3300005563 | Ga0068855_100000305 | Ga0068855_10000030512 | 294 |
| 202 | 3300005614 | Ga0068856_100187555 | Ga0068856_1001875553 | 294 |
| 203 | 3300009093 | Ga0105240_10096616 | Ga0105240_100966162 | 294 |
| 204 | 3300009174 | Ga0105241_10253048 | Ga0105241_102530482 | 294 |
| 205 | 3300009551 | Ga0105238_10272187 | Ga0105238_102721871 | 294 |
| 206 | 3300025913 | Ga0207695_10062850 | Ga0207695_100628504 | 294 |
| 207 | 3300025921 | Ga0207652_10086995 | Ga0207652_100869952 | 294 |
| 208 | 3300025924 | Ga0207694_10199639 | Ga0207694_101996391 | 294 |
| 209 | 3300025949 | Ga0207667_10002213 | Ga0207667_1000221320 | 294 |
| 210 | 3300026041 | Ga0207639_10042789 | Ga0207639_100427892 | 294 |
| 211 | 3300031824 | Ga0307413_10450651 | Ga0307413_104506511 | 294 |
| 212 | 3300049590 | Ga0501074_0330784 | Ga0501074_0330784_127_1023 | 294 |
| 213 | 3300053111 | Ga0500572_000189 | Ga0500572_000189_20032_20919 | 294 |
| 214 | 3300053131 | Ga0500652_099801 | Ga0500652_099801_165_1052 | 294 |
| 215 | 3300053136 | Ga0500559_0000010 | Ga0500559_0000010_96957_97850 | 294 |
| 216 | 3300060353 | Ga0501082_0385413 | Ga0501082_0385413_248_1174 | 294 |
| 217 | 3300001976 | JGI24752J21851_1000173 | JGI24752J21851_10001738 | 295 |
| 218 | 3300001990 | JGI24737J22298_10027409 | JGI24737J22298_100274092 | 295 |
| 219 | 3300005289 | Ga0065704_10073678 | Ga0065704_100736782 | 295 |
| 220 | 3300005293 | Ga0065715_10232919 | Ga0065715_102329191 | 295 |
| 221 | 3300005329 | Ga0070683_100010143 | Ga0070683_1000101437 | 295 |
| 222 | 3300005331 | Ga0070670_100000016 | Ga0070670_100000016192 | 295 |
| 223 | 3300005336 | Ga0070680_100170608 | Ga0070680_1001706082 | 295 |
| 224 | 3300005339 | Ga0070660_100093998 | Ga0070660_1000939982 | 295 |
| 225 | 3300005339 | Ga0070660_100417398 | Ga0070660_1004173981 | 295 |
| 226 | 3300005366 | Ga0070659_100028972 | Ga0070659_1000289721 | 295 |
| 227 | 3300005366 | Ga0070659_100387874 | Ga0070659_1003878742 | 295 |
| 228 | 3300005366 | Ga0070659_100435650 | Ga0070659_1004356501 | 295 |
| 229 | 3300005367 | Ga0070667_100000670 | Ga0070667_10000067029 | 295 |
| 230 | 3300005617 | Ga0068859_100015951 | Ga0068859_10001595110 | 295 |
| 231 | 3300005618 | Ga0068864_100000017 | Ga0068864_10000001795 | 295 |
| 232 | 3300005841 | Ga0068863_100000018 | Ga0068863_10000001813 | 295 |
| 233 | 3300005844 | Ga0068862_100000010 | Ga0068862_100000010215 | 295 |
| 234 | 3300006931 | Ga0097620_100015951 | Ga0097620_1000159513 | 295 |
| 235 | 3300009011 | Ga0105251_10001854 | Ga0105251_1000185421 | 295 |
| 236 | 3300009177 | Ga0105248_10002326 | Ga0105248_1000232619 | 295 |
| 237 | 3300009553 | Ga0105249_10000489 | Ga0105249_1000048941 | 295 |
| 238 | 3300013102 | Ga0157371_10387106 | Ga0157371_103871061 | 295 |
| 239 | 3300013306 | Ga0163162_10003521 | Ga0163162_1000352110 | 295 |
| 240 | 3300014325 | Ga0163163_10196531 | Ga0163163_101965313 | 295 |
| 241 | 3300014968 | Ga0157379_10043095 | Ga0157379_100430954 | 295 |
| 242 | 3300021388 | Ga0213875_10001419 | Ga0213875_100014192 | 295 |
| 243 | 3300025909 | Ga0207705_10030380 | Ga0207705_100303804 | 295 |
| 244 | 3300025912 | Ga0207707_10141619 | Ga0207707_101416192 | 295 |
| 245 | 3300025925 | Ga0207650_10000196 | Ga0207650_1000019628 | 295 |
| 246 | 3300025932 | Ga0207690_10242745 | Ga0207690_102427451 | 295 |
| 247 | 3300025932 | Ga0207690_10438045 | Ga0207690_104380451 | 295 |
| 248 | 3300025941 | Ga0207711_10000031 | Ga0207711_10000031211 | 295 |
| 249 | 3300025961 | Ga0207712_10011215 | Ga0207712_100112154 | 295 |
| 250 | 3300025986 | Ga0207658_10000221 | Ga0207658_1000022115 | 295 |
| 251 | 3300026067 | Ga0207678_10143792 | Ga0207678_101437922 | 295 |
| 252 | 3300026088 | Ga0207641_10000002 | Ga0207641_10000002270 | 295 |
| 253 | 3300026095 | Ga0207676_10000005 | Ga0207676_10000005537 | 295 |
| 254 | 3300028380 | Ga0268265_10000003 | Ga0268265_10000003719 | 295 |
| 255 | 3300037853 | Ga0436364_0986946 | Ga0436364_0986946_170449_171342 | 295 |
| 256 | 3300039437 | Ga0436365_1068878 | Ga0436365_1068878_134_1027 | 295 |
| 257 | 3300048920 | Ga0496117_0003948 | Ga0496117_0003948_1070_1957 | 295 |
| 258 | 3300048921 | Ga0496118_0001361 | Ga0496118_0001361_26286_27173 | 295 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4whx-assembly1.cif.gz_E | x-ray crystal structure of an amino acid aminotransferase from burkholderia pseudomallei bound to the co-factor pyridoxal phosphate | 0.9683 | 7 | 293 |
| 3u0g-assembly2.cif.gz_A | crystal structure of branched-chain amino acid aminotransferase from burkholderia pseudomallei | 0.9623 | 7 | 293 |
| 6nst-assembly1.cif.gz_B | crystal structure of branched chain amino acid aminotransferase from pseudomonas aeruginosa | 0.9602 | 7 | 294 |
| 6nst-assembly1.cif.gz_A | crystal structure of branched chain amino acid aminotransferase from pseudomonas aeruginosa | 0.9554 | 7 | 290 |
| 1wrv-assembly1.cif.gz_B | crystal structure of t.th.hb8 branched-chain amino acid aminotransferase | 0.9551 | 10 | 294 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4whxA01 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain | 0.9725 | 11 | 132 | 3.30.470.10 |
| 3u0gF02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9625 | 136 | 291 | 3.20.10.10 |
| af_P0AB80_8_124_3.30.470.10 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain | 0.9599 | 14 | 123 | 3.30.470.10 |
| 6h65B02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.956 | 138 | 291 | 3.20.10.10 |
| 6gkrB02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9543 | 138 | 291 | 3.20.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-U3AAQ9-F1-model_v4 | Branched-chain-amino-acid aminotransferase (BCAT) (EC 2.6.1.42) | 0.9914 | 4 | 289 |
GO:0009097
GO:0009098 GO:0009099 GO:0052655 GO:0052656 |
| AF-A0A2S6SN88-F1-model_v4 | Probable branched-chain-amino-acid aminotransferase (EC 2.6.1.42) | 0.9873 | 62 | 288 |
GO:0003824
GO:0008652 GO:0009082 |
| AF-A0A7C9GEA6-F1-model_v4 | Branched-chain-amino-acid aminotransferase (BCAT) (EC 2.6.1.42) | 0.9847 | 7 | 290 |
GO:0004084
GO:0005829 GO:0009097 GO:0009098 GO:0009099 |
| AF-A0A4V0I2N3-F1-model_v4 | Branched-chain-amino-acid aminotransferase (BCAT) (EC 2.6.1.42) | 0.9846 | 1 | 289 |
GO:0005829
GO:0009097 GO:0009098 GO:0009099 GO:0052655 GO:0052656 |
| AF-F7XVU9-F1-model_v4 | Branched-chain-amino-acid aminotransferase (BCAT) (EC 2.6.1.42) | 0.9815 | 7 | 288 |
GO:0009097
GO:0009098 GO:0009099 GO:0052655 GO:0052656 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar