F367788
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 258 | 214 | 251 | 191 |
Family's Representative Sequence
| Representative Sequence | 3300003775|Ga0055524_1000767|Ga0055524_100076717 |
| Length | 180 |
| Sequence | MATTLTPVLSFPPEVLLKAQGIRACIFDVDGVLTDGRIYIGANGEEFKAFNTLDGHGLKLLAQGGIEPLIITGRDSPAVRRRVADLGIRHAVYGAHDKLAAARGLLATLQLDWPQPLMTRTAFACAPANAHAEVLAVAHHVTQARGGYGAARECCDLLLTAVGAYARLLHGHLTTLDGTP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 2 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 3 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 4 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 5 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 6 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 7 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 8 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 9 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 10 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 11 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 14 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 15 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 19 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 38 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 39 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 42 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 43 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 44 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 45 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 46 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 47 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 69 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 70 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 71 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 73 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 74 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 76 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 77 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 78 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 81 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 111 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 112 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 113 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 114 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 115 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 116 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 117 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 118 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 119 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 120 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 121 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 122 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 123 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 124 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 125 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 126 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 127 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 128 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 129 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 130 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 131 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 132 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 133 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 134 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 135 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 136 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 137 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 138 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 139 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 140 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 141 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 142 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 143 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 144 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 145 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 146 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 147 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 148 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 149 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 150 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 151 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 152 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 153 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 154 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 155 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 156 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 157 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 174 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 175 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 176 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 177 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 179 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 180 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 181 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 182 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 189 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 190 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 191 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 193 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 195 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 196 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 197 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 198 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 201 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 202 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 203 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 204 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 205 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 206 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 207 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 208 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 209 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 210 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 211 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 212 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 213 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 214 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.29 |
| Metatranscriptomes | 0 |
| Isolates | 2.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 22.48 |
| Nodule | 0 |
| Rhizoplane | 5.43 |
| Rhizosphere | 60.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1000246 | 3300002705 | Bacteria | 37389 |
| 2 | JGI25154J39366_1001217 | 3300002738 | Bacteria | 9742 |
| 3 | JGI25157J39369_1000069 | 3300002741 | Bacteria | 93257 |
| 4 | JGI25152J39213_1001209 | 3300002773 | Bacteria | 11840 |
| 5 | JGI25153J46596_10004893 | 3300003215 | Bacteria | 7120 |
| 6 | rootH1_10010532 | 3300003316 | Bacteria | 4738 |
| 7 | rootL2_10035584 | 3300003322 | Bacteria | 4662 |
| 8 | Ga0055533_1000026 | 3300003756 | Bacteria | 323407 |
| 9 | Ga0055533_1000068 | 3300003756 | Bacteria | 155215 |
| 10 | Ga0055525_1000036 | 3300003759 | Bacteria | 298878 |
| 11 | Ga0055525_1002368 | 3300003759 | Bacteria | 1974 |
| 12 | Ga0055524_1000767 | 3300003775 | Bacteria | 21616 |
| 13 | Ga0065165_1000757 | 3300005262 | Bacteria | 43947 |
| 14 | Ga0065707_10087586 | 3300005295 | Bacteria | 4967 |
| 15 | Ga0070676_10081271 | 3300005328 | Bacteria | 1967 |
| 16 | Ga0070683_100221342 | 3300005329 | Bacteria | 1799 |
| 17 | Ga0070670_100088504 | 3300005331 | Bacteria | 2662 |
| 18 | Ga0068869_100300704 | 3300005334 | Bacteria | 1295 |
| 19 | Ga0070675_100102362 | 3300005354 | Bacteria | 2413 |
| 20 | Ga0070671_100033697 | 3300005355 | Bacteria | 4238 |
| 21 | Ga0070671_100093150 | 3300005355 | Bacteria | 2525 |
| 22 | Ga0070674_100116253 | 3300005356 | Bacteria | 1973 |
| 23 | Ga0070673_100324567 | 3300005364 | Bacteria | 1360 |
| 24 | Ga0068867_100003698 | 3300005459 | Bacteria | 10761 |
| 25 | Ga0070684_100306594 | 3300005535 | Bacteria | 1458 |
| 26 | Ga0068853_100390107 | 3300005539 | Bacteria | 1302 |
| 27 | Ga0068855_100014082 | 3300005563 | Bacteria | 9640 |
| 28 | Ga0068857_100003113 | 3300005577 | Bacteria | 13728 |
| 29 | Ga0068854_100052500 | 3300005578 | Bacteria | 2923 |
| 30 | Ga0068854_100670327 | 3300005578 | Bacteria | 892 |
| 31 | Ga0068856_100000521 | 3300005614 | Bacteria | 42463 |
| 32 | Ga0068852_100440177 | 3300005616 | Bacteria | 1289 |
| 33 | Ga0068852_100638690 | 3300005616 | Bacteria | 1071 |
| 34 | Ga0068864_100072777 | 3300005618 | Bacteria | 2996 |
| 35 | Ga0068866_10430185 | 3300005718 | Bacteria | 858 |
| 36 | Ga0068861_100062863 | 3300005719 | Bacteria | 2852 |
| 37 | Ga0068851_10054004 | 3300005834 | Bacteria | 2046 |
| 38 | Ga0068863_100083601 | 3300005841 | Bacteria | 3025 |
| 39 | Ga0075362_10225125 | 3300006177 | Bacteria | 917 |
| 40 | Ga0075367_10076899 | 3300006178 | Bacteria | 2015 |
| 41 | Ga0075366_10055635 | 3300006195 | Bacteria | 2350 |
| 42 | Ga0075366_10098996 | 3300006195 | Bacteria | 1749 |
| 43 | Ga0075366_10171567 | 3300006195 | Bacteria | 1316 |
| 44 | Ga0075370_10001815 | 3300006353 | Bacteria | 9555 |
| 45 | Ga0075370_10021591 | 3300006353 | Bacteria | 3527 |
| 46 | Ga0075370_10052162 | 3300006353 | Bacteria | 2320 |
| 47 | Ga0075430_100306175 | 3300006846 | Bacteria | 1314 |
| 48 | Ga0075429_100003990 | 3300006880 | Bacteria | 12633 |
| 49 | Ga0114129_10644403 | 3300009147 | Bacteria | 1368 |
| 50 | Ga0105243_10028502 | 3300009148 | Bacteria | 4287 |
| 51 | Ga0105241_10823517 | 3300009174 | Bacteria | 857 |
| 52 | Ga0105242_11045471 | 3300009176 | Bacteria | 827 |
| 53 | Ga0105248_10125640 | 3300009177 | Bacteria | 2894 |
| 54 | Ga0105237_10204663 | 3300009545 | Bacteria | 1974 |
| 55 | Ga0105238_10100394 | 3300009551 | Bacteria | 2877 |
| 56 | Ga0105238_10265783 | 3300009551 | Bacteria | 1695 |
| 57 | Ga0105239_10574982 | 3300010375 | Bacteria | 1284 |
| 58 | Ga0157370_10230362 | 3300013104 | Bacteria | 1715 |
| 59 | Ga0157369_10016190 | 3300013105 | Bacteria | 8393 |
| 60 | Ga0157378_10008020 | 3300013297 | Bacteria | 9219 |
| 61 | Ga0157378_10056348 | 3300013297 | Bacteria | 3502 |
| 62 | Ga0163162_10548535 | 3300013306 | Bacteria | 1284 |
| 63 | Ga0157372_10184372 | 3300013307 | Bacteria | 2417 |
| 64 | Ga0157380_10004986 | 3300014326 | Bacteria | 9248 |
| 65 | Ga0157380_10763056 | 3300014326 | Bacteria | 980 |
| 66 | Ga0157377_10000010 | 3300014745 | Bacteria | 380929 |
| 67 | Ga0163161_10083569 | 3300017792 | Bacteria | 2353 |
| 68 | Ga0209674_100024 | 3300025226 | Bacteria | 535481 |
| 69 | Ga0209563_100014 | 3300025230 | Bacteria | 940582 |
| 70 | Ga0209563_100101 | 3300025230 | Bacteria | 152297 |
| 71 | Ga0207427_100885 | 3300025231 | Bacteria | 13072 |
| 72 | Ga0209437_119778 | 3300025233 | Bacteria | 840 |
| 73 | Ga0209258_100589 | 3300025242 | Bacteria | 30120 |
| 74 | Ga0207425_1000986 | 3300025245 | Bacteria | 13369 |
| 75 | Ga0209646_1000012 | 3300025246 | Bacteria | 573300 |
| 76 | Ga0209026_1000004 | 3300025250 | Bacteria | 949012 |
| 77 | Ga0209677_100048 | 3300025253 | Bacteria | 183563 |
| 78 | Ga0209677_100857 | 3300025253 | Bacteria | 15038 |
| 79 | Ga0209759_1000003 | 3300025256 | Bacteria | 792130 |
| 80 | Ga0209759_1000067 | 3300025256 | Bacteria | 183764 |
| 81 | Ga0209759_1006784 | 3300025256 | Bacteria | 3795 |
| 82 | Ga0209129_1000038 | 3300025258 | Bacteria | 322778 |
| 83 | Ga0209565_1027065 | 3300025263 | Bacteria | 1144 |
| 84 | Ga0209673_1021270 | 3300025273 | Bacteria | 2274 |
| 85 | Ga0209675_1035675 | 3300025291 | Bacteria | 1132 |
| 86 | Ga0209564_1000129 | 3300025295 | Bacteria | 195163 |
| 87 | Ga0209758_1000197 | 3300025297 | Bacteria | 133706 |
| 88 | Ga0209050_1000720 | 3300025298 | Bacteria | 48448 |
| 89 | Ga0209050_1033664 | 3300025298 | Bacteria | 1549 |
| 90 | Ga0209256_1000627 | 3300025299 | Bacteria | 48553 |
| 91 | Ga0209051_1012210 | 3300025303 | Bacteria | 4167 |
| 92 | Ga0207688_10120937 | 3300025901 | Bacteria | 1528 |
| 93 | Ga0207645_10003152 | 3300025907 | Bacteria | 12630 |
| 94 | Ga0207654_10675910 | 3300025911 | Bacteria | 741 |
| 95 | Ga0207695_10062918 | 3300025913 | Bacteria | 3827 |
| 96 | Ga0207671_10332364 | 3300025914 | Bacteria | 1203 |
| 97 | Ga0207694_10019003 | 3300025924 | Bacteria | 5194 |
| 98 | Ga0207659_10068893 | 3300025926 | Bacteria | 2575 |
| 99 | Ga0207644_10169933 | 3300025931 | Bacteria | 1701 |
| 100 | Ga0207690_10166462 | 3300025932 | Bacteria | 1648 |
| 101 | Ga0207706_10000451 | 3300025933 | Bacteria | 43919 |
| 102 | Ga0207709_10015440 | 3300025935 | Bacteria | 4234 |
| 103 | Ga0207704_10592458 | 3300025938 | Bacteria | 906 |
| 104 | Ga0207711_10019160 | 3300025941 | Bacteria | 5696 |
| 105 | Ga0207661_10259313 | 3300025944 | Bacteria | 1548 |
| 106 | Ga0207667_10208749 | 3300025949 | Bacteria | 2002 |
| 107 | Ga0207651_10158606 | 3300025960 | Bacteria | 1771 |
| 108 | Ga0207640_10035994 | 3300025981 | Bacteria | 3103 |
| 109 | Ga0207678_10001133 | 3300026067 | Bacteria | 24407 |
| 110 | Ga0207702_10004674 | 3300026078 | Bacteria | 12100 |
| 111 | Ga0207641_10158412 | 3300026088 | Bacteria | 2056 |
| 112 | Ga0207648_10000002 | 3300026089 | Bacteria | 307909 |
| 113 | Ga0207648_10008460 | 3300026089 | Bacteria | 9961 |
| 114 | Ga0207676_10023387 | 3300026095 | Bacteria | 4559 |
| 115 | Ga0207674_10008041 | 3300026116 | Bacteria | 12227 |
| 116 | Ga0207675_100075719 | 3300026118 | Bacteria | 3150 |
| 117 | Ga0207683_10547226 | 3300026121 | Bacteria | 1070 |
| 118 | Ga0207698_10739932 | 3300026142 | Bacteria | 981 |
| 119 | Ga0209974_10003338 | 3300027876 | Bacteria | 5799 |
| 120 | Ga0268265_11455857 | 3300028380 | Bacteria | 688 |
| 121 | Ga0307515_10000567 | 3300028794 | Bacteria | 87086 |
| 122 | Ga0307515_10007744 | 3300028794 | Bacteria | 21142 |
| 123 | Ga0307515_10036002 | 3300028794 | Bacteria | 8025 |
| 124 | Ga0307512_10065192 | 3300030522 | Bacteria | 2765 |
| 125 | Ga0307512_10318118 | 3300030522 | Bacteria | 710 |
| 126 | Ga0265328_10002198 | 3300031239 | Bacteria | 8806 |
| 127 | Ga0265327_10000143 | 3300031251 | Bacteria | 156870 |
| 128 | Ga0265316_10000069 | 3300031344 | Bacteria | 104235 |
| 129 | Ga0307513_10005283 | 3300031456 | Bacteria | 17092 |
| 130 | Ga0307513_10051534 | 3300031456 | Bacteria | 4439 |
| 131 | Ga0307509_10103547 | 3300031507 | Bacteria | 2874 |
| 132 | Ga0307509_10623977 | 3300031507 | Bacteria | 749 |
| 133 | Ga0307408_100561846 | 3300031548 | Bacteria | 1008 |
| 134 | Ga0307508_10159179 | 3300031616 | Bacteria | 1862 |
| 135 | Ga0307514_10001199 | 3300031649 | Bacteria | 34587 |
| 136 | Ga0307514_10171681 | 3300031649 | Bacteria | 1415 |
| 137 | Ga0307516_10004964 | 3300031730 | Bacteria | 16154 |
| 138 | Ga0307516_10529487 | 3300031730 | Bacteria | 832 |
| 139 | Ga0307405_10423360 | 3300031731 | Bacteria | 1048 |
| 140 | Ga0307413_10069263 | 3300031824 | Bacteria | 2213 |
| 141 | Ga0307410_10052196 | 3300031852 | Bacteria | 2760 |
| 142 | Ga0307406_10716145 | 3300031901 | Bacteria | 837 |
| 143 | Ga0307407_10048254 | 3300031903 | Bacteria | 2422 |
| 144 | Ga0307407_10063081 | 3300031903 | Bacteria | 2173 |
| 145 | Ga0307409_100034371 | 3300031995 | Bacteria | 3702 |
| 146 | Ga0307416_100035253 | 3300032002 | Bacteria | 3819 |
| 147 | Ga0307416_100046863 | 3300032002 | Bacteria | 3416 |
| 148 | Ga0307414_10240910 | 3300032004 | Bacteria | 1497 |
| 149 | Ga0307411_10017190 | 3300032005 | Bacteria | 4112 |
| 150 | Ga0307415_100264733 | 3300032126 | Bacteria | 1405 |
| 151 | Ga0395898_0079525 | 3300037466 | Bacteria | 3163 |
| 152 | Ga0395905_0000181 | 3300037471 | Bacteria | 100569 |
| 153 | Ga0395905_0071498 | 3300037471 | Bacteria | 3252 |
| 154 | Ga0395905_0276369 | 3300037471 | Bacteria | 1565 |
| 155 | Ga0395905_0429095 | 3300037471 | Bacteria | 1218 |
| 156 | Ga0439439_0096445 | 3300041406 | Bacteria | 811 |
| 157 | Ga0451793_1229966 | 3300041452 | Bacteria | 1896 |
| 158 | Ga0451798_0338171 | 3300041458 | Bacteria | 989 |
| 159 | Ga0451807_1322174 | 3300041486 | Bacteria | 1547 |
| 160 | Ga0451841_0872396 | 3300041498 | Bacteria | 1738 |
| 161 | Ga0451853_3365336 | 3300041512 | Bacteria | 1316 |
| 162 | Ga0439457_022498 | 3300042014 | Bacteria | 1396 |
| 163 | Ga0450898_045183 | 3300042134 | Bacteria | 841 |
| 164 | Ga0451577_0248545 | 3300042876 | Bacteria | 1610 |
| 165 | Ga0466972_0001282 | 3300044658 | Bacteria | 12137 |
| 166 | Ga0466972_0214106 | 3300044658 | Bacteria | 901 |
| 167 | Ga0466965_0002086 | 3300044683 | Bacteria | 8378 |
| 168 | Ga0466965_0196211 | 3300044683 | Bacteria | 1069 |
| 169 | Ga0466966_0000509 | 3300044684 | Bacteria | 24742 |
| 170 | Ga0466961_0003273 | 3300044693 | Bacteria | 10085 |
| 171 | Ga0466963_0051512 | 3300044694 | Bacteria | 2729 |
| 172 | Ga0466963_0659951 | 3300044694 | Bacteria | 738 |
| 173 | Ga0466964_0000391 | 3300044706 | Bacteria | 13325 |
| 174 | Ga0466964_0042501 | 3300044706 | Bacteria | 1841 |
| 175 | Ga0466971_0051544 | 3300044719 | Bacteria | 1852 |
| 176 | Ga0466968_0017912 | 3300044735 | Bacteria | 2837 |
| 177 | Ga0466970_0003788 | 3300044765 | Bacteria | 7403 |
| 178 | Ga0466957_0237210 | 3300044842 | Bacteria | 1209 |
| 179 | Ga0466960_0403731 | 3300044901 | Bacteria | 787 |
| 180 | Ga0466959_0007095 | 3300045049 | Bacteria | 7838 |
| 181 | Ga0451576_0016862 | 3300045051 | Bacteria | 8048 |
| 182 | Ga0466958_0009637 | 3300045836 | Bacteria | 5387 |
| 183 | Ga0466967_0039904 | 3300045976 | Bacteria | 4039 |
| 184 | Ga0466967_0061637 | 3300045976 | Bacteria | 3328 |
| 185 | Ga0466967_0534025 | 3300045976 | Bacteria | 1153 |
| 186 | Ga0495638_0133020 | 3300046460 | Bacteria | 1459 |
| 187 | Ga0495585_0038945 | 3300046492 | Bacteria | 2674 |
| 188 | Ga0495583_0000022 | 3300046506 | Bacteria | 282544 |
| 189 | Ga0495606_0001282 | 3300046507 | Bacteria | 34808 |
| 190 | Ga0495610_0009549 | 3300046512 | Bacteria | 6119 |
| 191 | Ga0495620_0153419 | 3300046515 | Bacteria | 897 |
| 192 | Ga0495632_0011887 | 3300046519 | Bacteria | 5057 |
| 193 | Ga0495632_0017797 | 3300046519 | Bacteria | 3914 |
| 194 | Ga0495643_0105008 | 3300046522 | Bacteria | 1443 |
| 195 | Ga0495642_0339226 | 3300046528 | Bacteria | 660 |
| 196 | Ga0495668_0006957 | 3300046616 | Bacteria | 7318 |
| 197 | Ga0495625_0007448 | 3300046660 | Bacteria | 9518 |
| 198 | Ga0495625_0060537 | 3300046660 | Bacteria | 2682 |
| 199 | Ga0495669_0017628 | 3300046684 | Bacteria | 3067 |
| 200 | Ga0495671_0304215 | 3300046692 | Bacteria | 767 |
| 201 | Ga0495649_0000099 | 3300046694 | Bacteria | 75713 |
| 202 | Ga0495589_0019806 | 3300046794 | Bacteria | 3443 |
| 203 | Ga0495686_0000992 | 3300047472 | Bacteria | 34617 |
| 204 | Ga0496102_0001753 | 3300048905 | Bacteria | 18929 |
| 205 | Ga0496104_0021304 | 3300048907 | Bacteria | 5949 |
| 206 | Ga0496104_0041626 | 3300048907 | Bacteria | 4309 |
| 207 | Ga0496104_0286530 | 3300048907 | Bacteria | 1560 |
| 208 | Ga0496105_0056883 | 3300048908 | Bacteria | 3229 |
| 209 | Ga0496108_0093421 | 3300048911 | Bacteria | 2559 |
| 210 | Ga0496109_0317450 | 3300048912 | Bacteria | 1470 |
| 211 | Ga0496110_0515250 | 3300048913 | Bacteria | 1088 |
| 212 | Ga0496112_0002750 | 3300048915 | Bacteria | 14255 |
| 213 | Ga0496113_0029266 | 3300048916 | Bacteria | 3975 |
| 214 | Ga0496114_0001249 | 3300048917 | Bacteria | 19250 |
| 215 | Ga0501032_0046196 | 3300049569 | Bacteria | 2943 |
| 216 | Ga0501043_0000024 | 3300049579 | Bacteria | 154045 |
| 217 | Ga0501046_0000173 | 3300049580 | Bacteria | 65571 |
| 218 | Ga0501047_0000051 | 3300049581 | Bacteria | 154281 |
| 219 | Ga0501048_0000650 | 3300049582 | Bacteria | 25020 |
| 220 | Ga0501075_0314811 | 3300049591 | Bacteria | 1193 |
| 221 | Ga0501198_000003 | 3300049649 | Bacteria | 175301 |
| 222 | Ga0501206_019416 | 3300049653 | Bacteria | 962 |
| 223 | Ga0501222_000001 | 3300049662 | Bacteria | 307689 |
| 224 | Ga0501083_0122189 | 3300049744 | Bacteria | 1708 |
| 225 | Ga0501265_006960 | 3300049762 | Bacteria | 1324 |
| 226 | Ga0501045_0003244 | 3300049824 | Bacteria | 11107 |
| 227 | nmdc:mga03n38_475377_c1 | 3300050490 | Bacteria | 698 |
| 228 | nmdc:mga0k408_142636_c1 | 3300050493 | Bacteria | 1425 |
| 229 | nmdc:mga0k408_36296_c1 | 3300050493 | Bacteria | 2829 |
| 230 | nmdc:mga06z11_338565_c1 | 3300050494 | Bacteria | 899 |
| 231 | nmdc:mga07m45_1268_c1 | 3300050496 | Bacteria | 11491 |
| 232 | nmdc:mga07m45_2131_c1 | 3300050496 | Bacteria | 9210 |
| 233 | nmdc:mga07m45_99700_c1 | 3300050496 | Bacteria | 1668 |
| 234 | nmdc:mga09592_98893_c1 | 3300050508 | Bacteria | 2498 |
| 235 | nmdc:mga0qj67_291339_c1 | 3300050509 | Bacteria | 1323 |
| 236 | Ga0500635_0000303 | 3300053080 | Bacteria | 17222 |
| 237 | Ga0500635_0008472 | 3300053080 | Bacteria | 2821 |
| 238 | Ga0500578_0000393 | 3300053086 | Bacteria | 53719 |
| 239 | Ga0500646_0003415 | 3300053090 | Bacteria | 4075 |
| 240 | Ga0500583_0236525 | 3300053092 | Bacteria | 904 |
| 241 | Ga0500651_0019981 | 3300053093 | Bacteria | 4168 |
| 242 | Ga0500642_0211698 | 3300053130 | Bacteria | 899 |
| 243 | Ga0500652_088444 | 3300053131 | Bacteria | 1293 |
| 244 | Ga0500568_0006612 | 3300053139 | Bacteria | 5798 |
| 245 | Ga0500577_0256456 | 3300053142 | Bacteria | 760 |
| 246 | Ga0500604_0111810 | 3300053151 | Bacteria | 907 |
| 247 | Ga0500619_000167 | 3300053154 | Bacteria | 16030 |
| 248 | Ga0500622_0004817 | 3300053156 | Bacteria | 8285 |
| 249 | Ga0500636_0017211 | 3300053177 | Bacteria | 4265 |
| 250 | Ga0500587_005050 | 3300053739 | Bacteria | 1790 |
| 251 | Ga0500661_003583 | 3300055283 | Bacteria | 2918 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006195 | Ga0075366_10055635 | Ga0075366_100556352 | 165 |
| 2 | 3300053086 | Ga0500578_0000393 | Ga0500578_0000393_41165_41743 | 169 |
| 3 | 3300014745 | Ga0157377_10000010 | Ga0157377_1000001083 | 172 |
| 4 | 3300006846 | Ga0075430_100306175 | Ga0075430_1003061752 | 173 |
| 5 | 3300006880 | Ga0075429_100003990 | Ga0075429_1000039904 | 173 |
| 6 | 3300009147 | Ga0114129_10644403 | Ga0114129_106444032 | 173 |
| 7 | 3300050508 | nmdc:mga09592_98893_c1 | nmdc:mga09592_98893_c1_104_691 | 173 |
| 8 | 3300050509 | nmdc:mga0qj67_291339_c1 | nmdc:mga0qj67_291339_c1_477_1064 | 173 |
| 9 | 3300006353 | Ga0075370_10021591 | Ga0075370_100215914 | 174 |
| 10 | 3300009148 | Ga0105243_10028502 | Ga0105243_100285023 | 174 |
| 11 | 3300025935 | Ga0207709_10015440 | Ga0207709_100154403 | 174 |
| 12 | 3300026089 | Ga0207648_10000002 | Ga0207648_1000000219 | 174 |
| 13 | 3300042876 | Ga0451577_0248545 | Ga0451577_0248545_169_738 | 176 |
| 14 | 3300003775 | Ga0055524_1000767 | Ga0055524_100076717 | 177 |
| 15 | 3300025263 | Ga0209565_1027065 | Ga0209565_10270652 | 177 |
| 16 | 3300025291 | Ga0209675_1035675 | Ga0209675_10356752 | 177 |
| 17 | 3300025298 | Ga0209050_1033664 | Ga0209050_10336641 | 177 |
| 18 | 3300025299 | Ga0209256_1000627 | Ga0209256_10006274 | 177 |
| 19 | 3300048917 | Ga0496114_0001249 | Ga0496114_0001249_1560_2135 | 177 |
| 20 | 3300005262 | Ga0065165_1000757 | Ga0065165_100075728 | 178 |
| 21 | 3300025298 | Ga0209050_1000720 | Ga0209050_10007205 | 178 |
| 22 | 3300025914 | Ga0207671_10332364 | Ga0207671_103323642 | 178 |
| 23 | 3300031548 | Ga0307408_100561846 | Ga0307408_1005618462 | 178 |
| 24 | 3300041406 | Ga0439439_0096445 | Ga0439439_0096445_170_748 | 178 |
| 25 | 3300042014 | Ga0439457_022498 | Ga0439457_022498_321_899 | 178 |
| 26 | 3300049653 | Ga0501206_019416 | Ga0501206_019416_37_615 | 178 |
| 27 | 3300049762 | Ga0501265_006960 | Ga0501265_006960_456_1034 | 178 |
| 28 | 3300046528 | Ga0495642_0339226 | Ga0495642_0339226_103_642 | 179 |
| 29 | 3300032126 | Ga0307415_100264733 | Ga0307415_1002647332 | 180 |
| 30 | 3300031731 | Ga0307405_10423360 | Ga0307405_104233601 | 181 |
| 31 | 3300031824 | Ga0307413_10069263 | Ga0307413_100692632 | 181 |
| 32 | 3300031852 | Ga0307410_10052196 | Ga0307410_100521963 | 181 |
| 33 | 3300031903 | Ga0307407_10048254 | Ga0307407_100482544 | 181 |
| 34 | 3300031995 | Ga0307409_100034371 | Ga0307409_1000343714 | 181 |
| 35 | 3300032002 | Ga0307416_100035253 | Ga0307416_1000352533 | 181 |
| 36 | 3300032004 | Ga0307414_10240910 | Ga0307414_102409102 | 181 |
| 37 | 3300032005 | Ga0307411_10017190 | Ga0307411_100171903 | 181 |
| 38 | 3300037471 | Ga0395905_0276369 | Ga0395905_0276369_977_1522 | 181 |
| 39 | 3300049591 | Ga0501075_0314811 | Ga0501075_0314811_289_840 | 182 |
| 40 | 3300005295 | Ga0065707_10087586 | Ga0065707_100875863 | 185 |
| 41 | 3300017792 | Ga0163161_10083569 | Ga0163161_100835691 | 185 |
| 42 | 3300025901 | Ga0207688_10120937 | Ga0207688_101209372 | 185 |
| 43 | 3300037471 | Ga0395905_0071498 | Ga0395905_0071498_2104_2667 | 185 |
| 44 | iso_pu_bacteria | 2585428062 | 2587757978 | 185 |
| 45 | 3300025932 | Ga0207690_10166462 | Ga0207690_101664621 | 186 |
| 46 | 3300053080 | Ga0500635_0008472 | Ga0500635_0008472_1541_2101 | 186 |
| 47 | 3300053177 | Ga0500636_0017211 | Ga0500636_0017211_1524_2084 | 186 |
| 48 | 3300031507 | Ga0307509_10623977 | Ga0307509_106239772 | 187 |
| 49 | 3300047472 | Ga0495686_0000992 | Ga0495686_0000992_14673_15242 | 187 |
| 50 | iso_pu_bacteria | 2585428058 | 2587733599 | 187 |
| 51 | iso_pu_bacteria | 2588253510 | 2588293998 | 187 |
| 52 | iso_pu_bacteria | 2643221592 | 2643967103 | 187 |
| 53 | iso_pu_bacteria | 2643221625 | 2644139933 | 187 |
| 54 | iso_pu_bacteria | 2643221648 | 2644271173 | 187 |
| 55 | 3300006195 | Ga0075366_10171567 | Ga0075366_101715672 | 188 |
| 56 | 3300006353 | Ga0075370_10052162 | Ga0075370_100521623 | 188 |
| 57 | 3300013297 | Ga0157378_10008020 | Ga0157378_100080207 | 188 |
| 58 | 3300014326 | Ga0157380_10004986 | Ga0157380_100049863 | 188 |
| 59 | 3300042134 | Ga0450898_045183 | Ga0450898_045183_189_758 | 188 |
| 60 | 3300050493 | nmdc:mga0k408_142636_c1 | nmdc:mga0k408_142636_c1_147_719 | 188 |
| 61 | 3300050496 | nmdc:mga07m45_99700_c1 | nmdc:mga07m45_99700_c1_55_627 | 188 |
| 62 | 3300002773 | JGI25152J39213_1001209 | JGI25152J39213_10012099 | 189 |
| 63 | 3300003215 | JGI25153J46596_10004893 | JGI25153J46596_100048932 | 189 |
| 64 | 3300003316 | rootH1_10010532 | rootH1_100105323 | 189 |
| 65 | 3300003322 | rootL2_10035584 | rootL2_100355842 | 189 |
| 66 | 3300005354 | Ga0070675_100102362 | Ga0070675_1001023622 | 189 |
| 67 | 3300005355 | Ga0070671_100033697 | Ga0070671_1000336973 | 189 |
| 68 | 3300005356 | Ga0070674_100116253 | Ga0070674_1001162532 | 189 |
| 69 | 3300005618 | Ga0068864_100072777 | Ga0068864_1000727773 | 189 |
| 70 | 3300005841 | Ga0068863_100083601 | Ga0068863_1000836012 | 189 |
| 71 | 3300006177 | Ga0075362_10225125 | Ga0075362_102251252 | 189 |
| 72 | 3300006178 | Ga0075367_10076899 | Ga0075367_100768992 | 189 |
| 73 | 3300006195 | Ga0075366_10098996 | Ga0075366_100989962 | 189 |
| 74 | 3300009176 | Ga0105242_11045471 | Ga0105242_110454712 | 189 |
| 75 | 3300009177 | Ga0105248_10125640 | Ga0105248_101256402 | 189 |
| 76 | 3300025245 | Ga0207425_1000986 | Ga0207425_10009863 | 189 |
| 77 | 3300025258 | Ga0209129_1000038 | Ga0209129_1000038151 | 189 |
| 78 | 3300025273 | Ga0209673_1021270 | Ga0209673_10212703 | 189 |
| 79 | 3300025295 | Ga0209564_1000129 | Ga0209564_100012936 | 189 |
| 80 | 3300025297 | Ga0209758_1000197 | Ga0209758_100019736 | 189 |
| 81 | 3300025926 | Ga0207659_10068893 | Ga0207659_100688932 | 189 |
| 82 | 3300025941 | Ga0207711_10019160 | Ga0207711_100191604 | 189 |
| 83 | 3300026067 | Ga0207678_10001133 | Ga0207678_100011339 | 189 |
| 84 | 3300026088 | Ga0207641_10158412 | Ga0207641_101584122 | 189 |
| 85 | 3300026095 | Ga0207676_10023387 | Ga0207676_100233873 | 189 |
| 86 | 3300027876 | Ga0209974_10003338 | Ga0209974_100033383 | 189 |
| 87 | 3300028794 | Ga0307515_10000567 | Ga0307515_1000056770 | 189 |
| 88 | 3300028794 | Ga0307515_10007744 | Ga0307515_1000774412 | 189 |
| 89 | 3300028794 | Ga0307515_10036002 | Ga0307515_100360025 | 189 |
| 90 | 3300030522 | Ga0307512_10065192 | Ga0307512_100651923 | 189 |
| 91 | 3300031239 | Ga0265328_10002198 | Ga0265328_100021989 | 189 |
| 92 | 3300031251 | Ga0265327_10000143 | Ga0265327_10000143100 | 189 |
| 93 | 3300031344 | Ga0265316_10000069 | Ga0265316_1000006928 | 189 |
| 94 | 3300031456 | Ga0307513_10005283 | Ga0307513_1000528312 | 189 |
| 95 | 3300031456 | Ga0307513_10051534 | Ga0307513_100515342 | 189 |
| 96 | 3300031507 | Ga0307509_10103547 | Ga0307509_101035471 | 189 |
| 97 | 3300031649 | Ga0307514_10001199 | Ga0307514_1000119927 | 189 |
| 98 | 3300031649 | Ga0307514_10171681 | Ga0307514_101716812 | 189 |
| 99 | 3300031730 | Ga0307516_10004964 | Ga0307516_100049644 | 189 |
| 100 | 3300031730 | Ga0307516_10529487 | Ga0307516_105294872 | 189 |
| 101 | 3300031901 | Ga0307406_10716145 | Ga0307406_107161452 | 189 |
| 102 | 3300032002 | Ga0307416_100046863 | Ga0307416_1000468632 | 189 |
| 103 | 3300037471 | Ga0395905_0000181 | Ga0395905_0000181_8021_8620 | 189 |
| 104 | 3300037471 | Ga0395905_0429095 | Ga0395905_0429095_90_668 | 189 |
| 105 | 3300041452 | Ga0451793_1229966 | Ga0451793_1229966_651_1223 | 189 |
| 106 | 3300041458 | Ga0451798_0338171 | Ga0451798_0338171_291_869 | 189 |
| 107 | 3300041486 | Ga0451807_1322174 | Ga0451807_1322174_380_952 | 189 |
| 108 | 3300041498 | Ga0451841_0872396 | Ga0451841_0872396_149_721 | 189 |
| 109 | 3300041512 | Ga0451853_3365336 | Ga0451853_3365336_87_659 | 189 |
| 110 | 3300046460 | Ga0495638_0133020 | Ga0495638_0133020_782_1360 | 189 |
| 111 | 3300046512 | Ga0495610_0009549 | Ga0495610_0009549_2022_2594 | 189 |
| 112 | 3300046515 | Ga0495620_0153419 | Ga0495620_0153419_284_862 | 189 |
| 113 | 3300046519 | Ga0495632_0011887 | Ga0495632_0011887_2413_2991 | 189 |
| 114 | 3300046519 | Ga0495632_0017797 | Ga0495632_0017797_988_1560 | 189 |
| 115 | 3300046522 | Ga0495643_0105008 | Ga0495643_0105008_821_1393 | 189 |
| 116 | 3300046660 | Ga0495625_0007448 | Ga0495625_0007448_7014_7586 | 189 |
| 117 | 3300046692 | Ga0495671_0304215 | Ga0495671_0304215_85_657 | 189 |
| 118 | 3300048905 | Ga0496102_0001753 | Ga0496102_0001753_2502_3074 | 189 |
| 119 | 3300048907 | Ga0496104_0041626 | Ga0496104_0041626_1174_1755 | 189 |
| 120 | 3300048908 | Ga0496105_0056883 | Ga0496105_0056883_921_1502 | 189 |
| 121 | 3300048911 | Ga0496108_0093421 | Ga0496108_0093421_1536_2117 | 189 |
| 122 | 3300048913 | Ga0496110_0515250 | Ga0496110_0515250_342_935 | 189 |
| 123 | 3300048915 | Ga0496112_0002750 | Ga0496112_0002750_2881_3462 | 189 |
| 124 | 3300048916 | Ga0496113_0029266 | Ga0496113_0029266_3247_3828 | 189 |
| 125 | 3300049569 | Ga0501032_0046196 | Ga0501032_0046196_2060_2638 | 189 |
| 126 | 3300049579 | Ga0501043_0000024 | Ga0501043_0000024_37382_37960 | 189 |
| 127 | 3300049580 | Ga0501046_0000173 | Ga0501046_0000173_37382_37960 | 189 |
| 128 | 3300049581 | Ga0501047_0000051 | Ga0501047_0000051_116322_116900 | 189 |
| 129 | 3300049582 | Ga0501048_0000650 | Ga0501048_0000650_20230_20808 | 189 |
| 130 | 3300049744 | Ga0501083_0122189 | Ga0501083_0122189_979_1557 | 189 |
| 131 | 3300049824 | Ga0501045_0003244 | Ga0501045_0003244_4250_4828 | 189 |
| 132 | 3300050490 | nmdc:mga03n38_475377_c1 | nmdc:mga03n38_475377_c1_49_627 | 189 |
| 133 | 3300050493 | nmdc:mga0k408_36296_c1 | nmdc:mga0k408_36296_c1_321_899 | 189 |
| 134 | 3300050494 | nmdc:mga06z11_338565_c1 | nmdc:mga06z11_338565_c1_236_808 | 189 |
| 135 | 3300050496 | nmdc:mga07m45_2131_c1 | nmdc:mga07m45_2131_c1_3760_4338 | 189 |
| 136 | 3300053090 | Ga0500646_0003415 | Ga0500646_0003415_2232_2810 | 189 |
| 137 | 3300053092 | Ga0500583_0236525 | Ga0500583_0236525_139_717 | 189 |
| 138 | 3300053093 | Ga0500651_0019981 | Ga0500651_0019981_789_1367 | 189 |
| 139 | 3300053130 | Ga0500642_0211698 | Ga0500642_0211698_305_883 | 189 |
| 140 | 3300053139 | Ga0500568_0006612 | Ga0500568_0006612_3989_4570 | 189 |
| 141 | 3300053142 | Ga0500577_0256456 | Ga0500577_0256456_129_707 | 189 |
| 142 | 3300053151 | Ga0500604_0111810 | Ga0500604_0111810_299_877 | 189 |
| 143 | 3300053154 | Ga0500619_000167 | Ga0500619_000167_10008_10580 | 189 |
| 144 | 3300053156 | Ga0500622_0004817 | Ga0500622_0004817_7654_8232 | 189 |
| 145 | 3300053739 | Ga0500587_005050 | Ga0500587_005050_55_627 | 189 |
| 146 | iso_pu_bacteria | 2585428057 | 2587729032 | 189 |
| 147 | 3300003759 | Ga0055525_1000036 | Ga0055525_10000363 | 190 |
| 148 | 3300025230 | Ga0209563_100014 | Ga0209563_100014386 | 190 |
| 149 | 3300030522 | Ga0307512_10318118 | Ga0307512_103181181 | 190 |
| 150 | 3300045051 | Ga0451576_0016862 | Ga0451576_0016862_3170_3742 | 190 |
| 151 | 3300046492 | Ga0495585_0038945 | Ga0495585_0038945_1691_2266 | 191 |
| 152 | 3300049649 | Ga0501198_000003 | Ga0501198_000003_148033_148620 | 192 |
| 153 | 3300049662 | Ga0501222_000001 | Ga0501222_000001_242551_243138 | 192 |
| 154 | 3300005328 | Ga0070676_10081271 | Ga0070676_100812712 | 193 |
| 155 | 3300005331 | Ga0070670_100088504 | Ga0070670_1000885043 | 193 |
| 156 | 3300005355 | Ga0070671_100093150 | Ga0070671_1000931502 | 193 |
| 157 | 3300005459 | Ga0068867_100003698 | Ga0068867_10000369810 | 193 |
| 158 | 3300005578 | Ga0068854_100670327 | Ga0068854_1006703272 | 193 |
| 159 | 3300005616 | Ga0068852_100638690 | Ga0068852_1006386902 | 193 |
| 160 | 3300005718 | Ga0068866_10430185 | Ga0068866_104301851 | 193 |
| 161 | 3300005834 | Ga0068851_10054004 | Ga0068851_100540043 | 193 |
| 162 | 3300009174 | Ga0105241_10823517 | Ga0105241_108235172 | 193 |
| 163 | 3300009551 | Ga0105238_10265783 | Ga0105238_102657832 | 193 |
| 164 | 3300013297 | Ga0157378_10056348 | Ga0157378_100563482 | 193 |
| 165 | 3300013306 | Ga0163162_10548535 | Ga0163162_105485352 | 193 |
| 166 | 3300014326 | Ga0157380_10763056 | Ga0157380_107630561 | 193 |
| 167 | 3300025303 | Ga0209051_1012210 | Ga0209051_10122104 | 193 |
| 168 | 3300025907 | Ga0207645_10003152 | Ga0207645_1000315213 | 193 |
| 169 | 3300025931 | Ga0207644_10169933 | Ga0207644_101699332 | 193 |
| 170 | 3300025933 | Ga0207706_10000451 | Ga0207706_1000045137 | 193 |
| 171 | 3300025938 | Ga0207704_10592458 | Ga0207704_105924582 | 193 |
| 172 | 3300026089 | Ga0207648_10008460 | Ga0207648_100084608 | 193 |
| 173 | 3300026121 | Ga0207683_10547226 | Ga0207683_105472261 | 193 |
| 174 | 3300026142 | Ga0207698_10739932 | Ga0207698_107399322 | 193 |
| 175 | 3300028380 | Ga0268265_11455857 | Ga0268265_114558571 | 193 |
| 176 | 3300031616 | Ga0307508_10159179 | Ga0307508_101591792 | 193 |
| 177 | 3300044658 | Ga0466972_0001282 | Ga0466972_0001282_2018_2608 | 193 |
| 178 | 3300044658 | Ga0466972_0214106 | Ga0466972_0214106_258_854 | 193 |
| 179 | 3300044683 | Ga0466965_0002086 | Ga0466965_0002086_279_866 | 193 |
| 180 | 3300044683 | Ga0466965_0196211 | Ga0466965_0196211_382_972 | 193 |
| 181 | 3300044684 | Ga0466966_0000509 | Ga0466966_0000509_15223_15810 | 193 |
| 182 | 3300044693 | Ga0466961_0003273 | Ga0466961_0003273_4800_5387 | 193 |
| 183 | 3300044694 | Ga0466963_0051512 | Ga0466963_0051512_1315_1902 | 193 |
| 184 | 3300044694 | Ga0466963_0659951 | Ga0466963_0659951_90_677 | 193 |
| 185 | 3300044706 | Ga0466964_0000391 | Ga0466964_0000391_1706_2293 | 193 |
| 186 | 3300044706 | Ga0466964_0042501 | Ga0466964_0042501_149_739 | 193 |
| 187 | 3300044719 | Ga0466971_0051544 | Ga0466971_0051544_767_1354 | 193 |
| 188 | 3300044735 | Ga0466968_0017912 | Ga0466968_0017912_817_1404 | 193 |
| 189 | 3300044765 | Ga0466970_0003788 | Ga0466970_0003788_5858_6445 | 193 |
| 190 | 3300044901 | Ga0466960_0403731 | Ga0466960_0403731_71_667 | 193 |
| 191 | 3300045049 | Ga0466959_0007095 | Ga0466959_0007095_1215_1802 | 193 |
| 192 | 3300045836 | Ga0466958_0009637 | Ga0466958_0009637_3980_4567 | 193 |
| 193 | 3300045976 | Ga0466967_0039904 | Ga0466967_0039904_49_636 | 193 |
| 194 | 3300045976 | Ga0466967_0061637 | Ga0466967_0061637_1449_2036 | 193 |
| 195 | 3300045976 | Ga0466967_0534025 | Ga0466967_0534025_120_707 | 193 |
| 196 | 3300048907 | Ga0496104_0021304 | Ga0496104_0021304_1562_2143 | 193 |
| 197 | 3300048912 | Ga0496109_0317450 | Ga0496109_0317450_663_1244 | 193 |
| 198 | 3300002705 | JGI25156J39149_1000246 | JGI25156J39149_10002467 | 194 |
| 199 | 3300002738 | JGI25154J39366_1001217 | JGI25154J39366_10012175 | 194 |
| 200 | 3300002741 | JGI25157J39369_1000069 | JGI25157J39369_100006922 | 194 |
| 201 | 3300003756 | Ga0055533_1000026 | Ga0055533_100002662 | 194 |
| 202 | 3300003756 | Ga0055533_1000068 | Ga0055533_1000068144 | 194 |
| 203 | 3300003759 | Ga0055525_1002368 | Ga0055525_10023682 | 194 |
| 204 | 3300005329 | Ga0070683_100221342 | Ga0070683_1002213422 | 194 |
| 205 | 3300005334 | Ga0068869_100300704 | Ga0068869_1003007042 | 194 |
| 206 | 3300005364 | Ga0070673_100324567 | Ga0070673_1003245672 | 194 |
| 207 | 3300005535 | Ga0070684_100306594 | Ga0070684_1003065942 | 194 |
| 208 | 3300005539 | Ga0068853_100390107 | Ga0068853_1003901072 | 194 |
| 209 | 3300005563 | Ga0068855_100014082 | Ga0068855_1000140824 | 194 |
| 210 | 3300005577 | Ga0068857_100003113 | Ga0068857_10000311311 | 194 |
| 211 | 3300005578 | Ga0068854_100052500 | Ga0068854_1000525002 | 194 |
| 212 | 3300005614 | Ga0068856_100000521 | Ga0068856_10000052131 | 194 |
| 213 | 3300005616 | Ga0068852_100440177 | Ga0068852_1004401772 | 194 |
| 214 | 3300005719 | Ga0068861_100062863 | Ga0068861_1000628634 | 194 |
| 215 | 3300006353 | Ga0075370_10001815 | Ga0075370_100018159 | 194 |
| 216 | 3300009545 | Ga0105237_10204663 | Ga0105237_102046632 | 194 |
| 217 | 3300009551 | Ga0105238_10100394 | Ga0105238_101003943 | 194 |
| 218 | 3300010375 | Ga0105239_10574982 | Ga0105239_105749822 | 194 |
| 219 | 3300013104 | Ga0157370_10230362 | Ga0157370_102303623 | 194 |
| 220 | 3300013105 | Ga0157369_10016190 | Ga0157369_100161907 | 194 |
| 221 | 3300013307 | Ga0157372_10184372 | Ga0157372_101843722 | 194 |
| 222 | 3300025226 | Ga0209674_100024 | Ga0209674_100024235 | 194 |
| 223 | 3300025230 | Ga0209563_100101 | Ga0209563_100101145 | 194 |
| 224 | 3300025231 | Ga0207427_100885 | Ga0207427_10088515 | 194 |
| 225 | 3300025233 | Ga0209437_119778 | Ga0209437_1197781 | 194 |
| 226 | 3300025242 | Ga0209258_100589 | Ga0209258_1005891 | 194 |
| 227 | 3300025246 | Ga0209646_1000012 | Ga0209646_1000012273 | 194 |
| 228 | 3300025250 | Ga0209026_1000004 | Ga0209026_1000004346 | 194 |
| 229 | 3300025253 | Ga0209677_100048 | Ga0209677_100048124 | 194 |
| 230 | 3300025253 | Ga0209677_100857 | Ga0209677_10085713 | 194 |
| 231 | 3300025256 | Ga0209759_1000003 | Ga0209759_1000003381 | 194 |
| 232 | 3300025256 | Ga0209759_1000067 | Ga0209759_100006735 | 194 |
| 233 | 3300025256 | Ga0209759_1006784 | Ga0209759_10067842 | 194 |
| 234 | 3300025911 | Ga0207654_10675910 | Ga0207654_106759101 | 194 |
| 235 | 3300025913 | Ga0207695_10062918 | Ga0207695_100629182 | 194 |
| 236 | 3300025924 | Ga0207694_10019003 | Ga0207694_100190033 | 194 |
| 237 | 3300025944 | Ga0207661_10259313 | Ga0207661_102593132 | 194 |
| 238 | 3300025949 | Ga0207667_10208749 | Ga0207667_102087492 | 194 |
| 239 | 3300025960 | Ga0207651_10158606 | Ga0207651_101586062 | 194 |
| 240 | 3300025981 | Ga0207640_10035994 | Ga0207640_100359944 | 194 |
| 241 | 3300026078 | Ga0207702_10004674 | Ga0207702_100046745 | 194 |
| 242 | 3300026116 | Ga0207674_10008041 | Ga0207674_100080414 | 194 |
| 243 | 3300026118 | Ga0207675_100075719 | Ga0207675_1000757193 | 194 |
| 244 | 3300031903 | Ga0307407_10063081 | Ga0307407_100630813 | 194 |
| 245 | 3300037466 | Ga0395898_0079525 | Ga0395898_0079525_1874_2458 | 194 |
| 246 | 3300044842 | Ga0466957_0237210 | Ga0466957_0237210_32_616 | 194 |
| 247 | 3300046506 | Ga0495583_0000022 | Ga0495583_0000022_137274_137858 | 194 |
| 248 | 3300046507 | Ga0495606_0001282 | Ga0495606_0001282_26504_27088 | 194 |
| 249 | 3300046616 | Ga0495668_0006957 | Ga0495668_0006957_4239_4823 | 194 |
| 250 | 3300046660 | Ga0495625_0060537 | Ga0495625_0060537_1878_2462 | 194 |
| 251 | 3300046684 | Ga0495669_0017628 | Ga0495669_0017628_1198_1782 | 194 |
| 252 | 3300046694 | Ga0495649_0000099 | Ga0495649_0000099_43535_44119 | 194 |
| 253 | 3300046794 | Ga0495589_0019806 | Ga0495589_0019806_649_1233 | 194 |
| 254 | 3300048907 | Ga0496104_0286530 | Ga0496104_0286530_831_1415 | 194 |
| 255 | 3300050496 | nmdc:mga07m45_1268_c1 | nmdc:mga07m45_1268_c1_466_1050 | 194 |
| 256 | 3300053080 | Ga0500635_0000303 | Ga0500635_0000303_1738_2322 | 194 |
| 257 | 3300053131 | Ga0500652_088444 | Ga0500652_088444_63_647 | 194 |
| 258 | 3300055283 | Ga0500661_003583 | Ga0500661_003583_459_1043 | 194 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1k1e-assembly5.cif.gz_H | structure of the cobalt-bound form of the deoxy-d-mannose-octulosonate 8-phosphate phosphatase (yrbi) from haemophilus influenzae (hi1679) | 0.9674 | 24 | 180 |
| 3ij5-assembly1.cif.gz_A | 1.95 angstrom resolution crystal structure of 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from yersinia pestis | 0.9608 | 13 | 180 |
| 1k1e-assembly1.cif.gz_A | structure of the cobalt-bound form of the deoxy-d-mannose-octulosonate 8-phosphate phosphatase (yrbi) from haemophilus influenzae (hi1679) | 0.9565 | 16 | 180 |
| 3nrj-assembly3.cif.gz_I | crystal structure of probable yrbi family phosphatase from pseudomonas syringae pv.phaseolica 1448a complexed with magnesium | 0.9512 | 14 | 188 |
| 3hyc-assembly3.cif.gz_E | crystal structure of e. coli phosphatase yrbi, with mg, tetragonal form | 0.9475 | 10 | 182 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ij5D00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9588 | 13 | 180 | 3.40.50.1000 |
| 4um7A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9456 | 14 | 187 | 3.40.50.1000 |
| 4navA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9399 | 12 | 186 | 3.40.50.1000 |
| 1j8dB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.937 | 14 | 178 | 3.40.50.1000 |
| 3e81A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9225 | 25 | 184 | 3.40.50.1000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-D0IXF7-F1-model_v4 | deleted | 0.9846 | 16 | 186 |
|
| AF-A0A8B6LVD8-F1-model_v4 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC (EC 3.1.3.45) | 0.9832 | 9 | 186 |
GO:0008781
GO:0009103 GO:0016788 GO:0046872 |
| AF-A0A1F4KKM7-F1-model_v4 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase | 0.9818 | 5 | 188 |
GO:0008781
GO:0009103 GO:0019143 GO:0046872 |
| AF-A0A353Y8P1-F1-model_v4 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase | 0.9783 | 5 | 188 |
GO:0008781
GO:0009103 GO:0019143 GO:0046872 |
| AF-A0A522FWS5-F1-model_v4 | HAD-IIIA family hydrolase | 0.9772 | 29 | 178 |
GO:0008781
GO:0016788 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar