F367788

General Info

Members Datasets Scaffolds Average Seq Length
258 214 251 191

Family's Representative Sequence

Representative Sequence 3300003775|Ga0055524_1000767|Ga0055524_100076717
Length 180
Sequence MATTLTPVLSFPPEVLLKAQGIRACIFDVDGVLTDGRIYIGANGEEFKAFNTLDGHGLKLLAQGGIEPLIITGRDSPAVRRRVADLGIRHAVYGAHDKLAAARGLLATLQLDWPQPLMTRTAFACAPANAHAEVLAVAHHVTQARGGYGAARECCDLLLTAVGAYARLLHGHLTTLDGTP

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
5 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
6 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
7 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
8 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
9 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
67 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
69 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
70 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
71 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
73 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
74 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
111 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
112 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
113 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
114 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
115 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
116 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
119 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
120 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
134 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
135 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
136 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
137 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
138 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
139 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
140 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
141 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
142 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
143 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
144 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
145 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
148 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
149 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
150 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
158 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
159 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
160 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
161 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
162 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
163 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
164 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
165 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
166 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
167 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
168 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
169 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
170 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
171 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
172 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
188 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
189 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
190 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
191 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
192 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
195 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
196 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
197 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
198 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
199 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
200 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
201 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
202 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
203 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
204 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
205 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
206 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
207 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
208 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
209 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
210 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
211 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
212 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
213 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
214 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.29
Metatranscriptomes 0
Isolates 2.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.48
Nodule 0
Rhizoplane 5.43
Rhizosphere 60.85
Stem 0
Stem Tuber 0
Unclassified 11.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000246 3300002705 Bacteria 37389
2 JGI25154J39366_1001217 3300002738 Bacteria 9742
3 JGI25157J39369_1000069 3300002741 Bacteria 93257
4 JGI25152J39213_1001209 3300002773 Bacteria 11840
5 JGI25153J46596_10004893 3300003215 Bacteria 7120
6 rootH1_10010532 3300003316 Bacteria 4738
7 rootL2_10035584 3300003322 Bacteria 4662
8 Ga0055533_1000026 3300003756 Bacteria 323407
9 Ga0055533_1000068 3300003756 Bacteria 155215
10 Ga0055525_1000036 3300003759 Bacteria 298878
11 Ga0055525_1002368 3300003759 Bacteria 1974
12 Ga0055524_1000767 3300003775 Bacteria 21616
13 Ga0065165_1000757 3300005262 Bacteria 43947
14 Ga0065707_10087586 3300005295 Bacteria 4967
15 Ga0070676_10081271 3300005328 Bacteria 1967
16 Ga0070683_100221342 3300005329 Bacteria 1799
17 Ga0070670_100088504 3300005331 Bacteria 2662
18 Ga0068869_100300704 3300005334 Bacteria 1295
19 Ga0070675_100102362 3300005354 Bacteria 2413
20 Ga0070671_100033697 3300005355 Bacteria 4238
21 Ga0070671_100093150 3300005355 Bacteria 2525
22 Ga0070674_100116253 3300005356 Bacteria 1973
23 Ga0070673_100324567 3300005364 Bacteria 1360
24 Ga0068867_100003698 3300005459 Bacteria 10761
25 Ga0070684_100306594 3300005535 Bacteria 1458
26 Ga0068853_100390107 3300005539 Bacteria 1302
27 Ga0068855_100014082 3300005563 Bacteria 9640
28 Ga0068857_100003113 3300005577 Bacteria 13728
29 Ga0068854_100052500 3300005578 Bacteria 2923
30 Ga0068854_100670327 3300005578 Bacteria 892
31 Ga0068856_100000521 3300005614 Bacteria 42463
32 Ga0068852_100440177 3300005616 Bacteria 1289
33 Ga0068852_100638690 3300005616 Bacteria 1071
34 Ga0068864_100072777 3300005618 Bacteria 2996
35 Ga0068866_10430185 3300005718 Bacteria 858
36 Ga0068861_100062863 3300005719 Bacteria 2852
37 Ga0068851_10054004 3300005834 Bacteria 2046
38 Ga0068863_100083601 3300005841 Bacteria 3025
39 Ga0075362_10225125 3300006177 Bacteria 917
40 Ga0075367_10076899 3300006178 Bacteria 2015
41 Ga0075366_10055635 3300006195 Bacteria 2350
42 Ga0075366_10098996 3300006195 Bacteria 1749
43 Ga0075366_10171567 3300006195 Bacteria 1316
44 Ga0075370_10001815 3300006353 Bacteria 9555
45 Ga0075370_10021591 3300006353 Bacteria 3527
46 Ga0075370_10052162 3300006353 Bacteria 2320
47 Ga0075430_100306175 3300006846 Bacteria 1314
48 Ga0075429_100003990 3300006880 Bacteria 12633
49 Ga0114129_10644403 3300009147 Bacteria 1368
50 Ga0105243_10028502 3300009148 Bacteria 4287
51 Ga0105241_10823517 3300009174 Bacteria 857
52 Ga0105242_11045471 3300009176 Bacteria 827
53 Ga0105248_10125640 3300009177 Bacteria 2894
54 Ga0105237_10204663 3300009545 Bacteria 1974
55 Ga0105238_10100394 3300009551 Bacteria 2877
56 Ga0105238_10265783 3300009551 Bacteria 1695
57 Ga0105239_10574982 3300010375 Bacteria 1284
58 Ga0157370_10230362 3300013104 Bacteria 1715
59 Ga0157369_10016190 3300013105 Bacteria 8393
60 Ga0157378_10008020 3300013297 Bacteria 9219
61 Ga0157378_10056348 3300013297 Bacteria 3502
62 Ga0163162_10548535 3300013306 Bacteria 1284
63 Ga0157372_10184372 3300013307 Bacteria 2417
64 Ga0157380_10004986 3300014326 Bacteria 9248
65 Ga0157380_10763056 3300014326 Bacteria 980
66 Ga0157377_10000010 3300014745 Bacteria 380929
67 Ga0163161_10083569 3300017792 Bacteria 2353
68 Ga0209674_100024 3300025226 Bacteria 535481
69 Ga0209563_100014 3300025230 Bacteria 940582
70 Ga0209563_100101 3300025230 Bacteria 152297
71 Ga0207427_100885 3300025231 Bacteria 13072
72 Ga0209437_119778 3300025233 Bacteria 840
73 Ga0209258_100589 3300025242 Bacteria 30120
74 Ga0207425_1000986 3300025245 Bacteria 13369
75 Ga0209646_1000012 3300025246 Bacteria 573300
76 Ga0209026_1000004 3300025250 Bacteria 949012
77 Ga0209677_100048 3300025253 Bacteria 183563
78 Ga0209677_100857 3300025253 Bacteria 15038
79 Ga0209759_1000003 3300025256 Bacteria 792130
80 Ga0209759_1000067 3300025256 Bacteria 183764
81 Ga0209759_1006784 3300025256 Bacteria 3795
82 Ga0209129_1000038 3300025258 Bacteria 322778
83 Ga0209565_1027065 3300025263 Bacteria 1144
84 Ga0209673_1021270 3300025273 Bacteria 2274
85 Ga0209675_1035675 3300025291 Bacteria 1132
86 Ga0209564_1000129 3300025295 Bacteria 195163
87 Ga0209758_1000197 3300025297 Bacteria 133706
88 Ga0209050_1000720 3300025298 Bacteria 48448
89 Ga0209050_1033664 3300025298 Bacteria 1549
90 Ga0209256_1000627 3300025299 Bacteria 48553
91 Ga0209051_1012210 3300025303 Bacteria 4167
92 Ga0207688_10120937 3300025901 Bacteria 1528
93 Ga0207645_10003152 3300025907 Bacteria 12630
94 Ga0207654_10675910 3300025911 Bacteria 741
95 Ga0207695_10062918 3300025913 Bacteria 3827
96 Ga0207671_10332364 3300025914 Bacteria 1203
97 Ga0207694_10019003 3300025924 Bacteria 5194
98 Ga0207659_10068893 3300025926 Bacteria 2575
99 Ga0207644_10169933 3300025931 Bacteria 1701
100 Ga0207690_10166462 3300025932 Bacteria 1648
101 Ga0207706_10000451 3300025933 Bacteria 43919
102 Ga0207709_10015440 3300025935 Bacteria 4234
103 Ga0207704_10592458 3300025938 Bacteria 906
104 Ga0207711_10019160 3300025941 Bacteria 5696
105 Ga0207661_10259313 3300025944 Bacteria 1548
106 Ga0207667_10208749 3300025949 Bacteria 2002
107 Ga0207651_10158606 3300025960 Bacteria 1771
108 Ga0207640_10035994 3300025981 Bacteria 3103
109 Ga0207678_10001133 3300026067 Bacteria 24407
110 Ga0207702_10004674 3300026078 Bacteria 12100
111 Ga0207641_10158412 3300026088 Bacteria 2056
112 Ga0207648_10000002 3300026089 Bacteria 307909
113 Ga0207648_10008460 3300026089 Bacteria 9961
114 Ga0207676_10023387 3300026095 Bacteria 4559
115 Ga0207674_10008041 3300026116 Bacteria 12227
116 Ga0207675_100075719 3300026118 Bacteria 3150
117 Ga0207683_10547226 3300026121 Bacteria 1070
118 Ga0207698_10739932 3300026142 Bacteria 981
119 Ga0209974_10003338 3300027876 Bacteria 5799
120 Ga0268265_11455857 3300028380 Bacteria 688
121 Ga0307515_10000567 3300028794 Bacteria 87086
122 Ga0307515_10007744 3300028794 Bacteria 21142
123 Ga0307515_10036002 3300028794 Bacteria 8025
124 Ga0307512_10065192 3300030522 Bacteria 2765
125 Ga0307512_10318118 3300030522 Bacteria 710
126 Ga0265328_10002198 3300031239 Bacteria 8806
127 Ga0265327_10000143 3300031251 Bacteria 156870
128 Ga0265316_10000069 3300031344 Bacteria 104235
129 Ga0307513_10005283 3300031456 Bacteria 17092
130 Ga0307513_10051534 3300031456 Bacteria 4439
131 Ga0307509_10103547 3300031507 Bacteria 2874
132 Ga0307509_10623977 3300031507 Bacteria 749
133 Ga0307408_100561846 3300031548 Bacteria 1008
134 Ga0307508_10159179 3300031616 Bacteria 1862
135 Ga0307514_10001199 3300031649 Bacteria 34587
136 Ga0307514_10171681 3300031649 Bacteria 1415
137 Ga0307516_10004964 3300031730 Bacteria 16154
138 Ga0307516_10529487 3300031730 Bacteria 832
139 Ga0307405_10423360 3300031731 Bacteria 1048
140 Ga0307413_10069263 3300031824 Bacteria 2213
141 Ga0307410_10052196 3300031852 Bacteria 2760
142 Ga0307406_10716145 3300031901 Bacteria 837
143 Ga0307407_10048254 3300031903 Bacteria 2422
144 Ga0307407_10063081 3300031903 Bacteria 2173
145 Ga0307409_100034371 3300031995 Bacteria 3702
146 Ga0307416_100035253 3300032002 Bacteria 3819
147 Ga0307416_100046863 3300032002 Bacteria 3416
148 Ga0307414_10240910 3300032004 Bacteria 1497
149 Ga0307411_10017190 3300032005 Bacteria 4112
150 Ga0307415_100264733 3300032126 Bacteria 1405
151 Ga0395898_0079525 3300037466 Bacteria 3163
152 Ga0395905_0000181 3300037471 Bacteria 100569
153 Ga0395905_0071498 3300037471 Bacteria 3252
154 Ga0395905_0276369 3300037471 Bacteria 1565
155 Ga0395905_0429095 3300037471 Bacteria 1218
156 Ga0439439_0096445 3300041406 Bacteria 811
157 Ga0451793_1229966 3300041452 Bacteria 1896
158 Ga0451798_0338171 3300041458 Bacteria 989
159 Ga0451807_1322174 3300041486 Bacteria 1547
160 Ga0451841_0872396 3300041498 Bacteria 1738
161 Ga0451853_3365336 3300041512 Bacteria 1316
162 Ga0439457_022498 3300042014 Bacteria 1396
163 Ga0450898_045183 3300042134 Bacteria 841
164 Ga0451577_0248545 3300042876 Bacteria 1610
165 Ga0466972_0001282 3300044658 Bacteria 12137
166 Ga0466972_0214106 3300044658 Bacteria 901
167 Ga0466965_0002086 3300044683 Bacteria 8378
168 Ga0466965_0196211 3300044683 Bacteria 1069
169 Ga0466966_0000509 3300044684 Bacteria 24742
170 Ga0466961_0003273 3300044693 Bacteria 10085
171 Ga0466963_0051512 3300044694 Bacteria 2729
172 Ga0466963_0659951 3300044694 Bacteria 738
173 Ga0466964_0000391 3300044706 Bacteria 13325
174 Ga0466964_0042501 3300044706 Bacteria 1841
175 Ga0466971_0051544 3300044719 Bacteria 1852
176 Ga0466968_0017912 3300044735 Bacteria 2837
177 Ga0466970_0003788 3300044765 Bacteria 7403
178 Ga0466957_0237210 3300044842 Bacteria 1209
179 Ga0466960_0403731 3300044901 Bacteria 787
180 Ga0466959_0007095 3300045049 Bacteria 7838
181 Ga0451576_0016862 3300045051 Bacteria 8048
182 Ga0466958_0009637 3300045836 Bacteria 5387
183 Ga0466967_0039904 3300045976 Bacteria 4039
184 Ga0466967_0061637 3300045976 Bacteria 3328
185 Ga0466967_0534025 3300045976 Bacteria 1153
186 Ga0495638_0133020 3300046460 Bacteria 1459
187 Ga0495585_0038945 3300046492 Bacteria 2674
188 Ga0495583_0000022 3300046506 Bacteria 282544
189 Ga0495606_0001282 3300046507 Bacteria 34808
190 Ga0495610_0009549 3300046512 Bacteria 6119
191 Ga0495620_0153419 3300046515 Bacteria 897
192 Ga0495632_0011887 3300046519 Bacteria 5057
193 Ga0495632_0017797 3300046519 Bacteria 3914
194 Ga0495643_0105008 3300046522 Bacteria 1443
195 Ga0495642_0339226 3300046528 Bacteria 660
196 Ga0495668_0006957 3300046616 Bacteria 7318
197 Ga0495625_0007448 3300046660 Bacteria 9518
198 Ga0495625_0060537 3300046660 Bacteria 2682
199 Ga0495669_0017628 3300046684 Bacteria 3067
200 Ga0495671_0304215 3300046692 Bacteria 767
201 Ga0495649_0000099 3300046694 Bacteria 75713
202 Ga0495589_0019806 3300046794 Bacteria 3443
203 Ga0495686_0000992 3300047472 Bacteria 34617
204 Ga0496102_0001753 3300048905 Bacteria 18929
205 Ga0496104_0021304 3300048907 Bacteria 5949
206 Ga0496104_0041626 3300048907 Bacteria 4309
207 Ga0496104_0286530 3300048907 Bacteria 1560
208 Ga0496105_0056883 3300048908 Bacteria 3229
209 Ga0496108_0093421 3300048911 Bacteria 2559
210 Ga0496109_0317450 3300048912 Bacteria 1470
211 Ga0496110_0515250 3300048913 Bacteria 1088
212 Ga0496112_0002750 3300048915 Bacteria 14255
213 Ga0496113_0029266 3300048916 Bacteria 3975
214 Ga0496114_0001249 3300048917 Bacteria 19250
215 Ga0501032_0046196 3300049569 Bacteria 2943
216 Ga0501043_0000024 3300049579 Bacteria 154045
217 Ga0501046_0000173 3300049580 Bacteria 65571
218 Ga0501047_0000051 3300049581 Bacteria 154281
219 Ga0501048_0000650 3300049582 Bacteria 25020
220 Ga0501075_0314811 3300049591 Bacteria 1193
221 Ga0501198_000003 3300049649 Bacteria 175301
222 Ga0501206_019416 3300049653 Bacteria 962
223 Ga0501222_000001 3300049662 Bacteria 307689
224 Ga0501083_0122189 3300049744 Bacteria 1708
225 Ga0501265_006960 3300049762 Bacteria 1324
226 Ga0501045_0003244 3300049824 Bacteria 11107
227 nmdc:mga03n38_475377_c1 3300050490 Bacteria 698
228 nmdc:mga0k408_142636_c1 3300050493 Bacteria 1425
229 nmdc:mga0k408_36296_c1 3300050493 Bacteria 2829
230 nmdc:mga06z11_338565_c1 3300050494 Bacteria 899
231 nmdc:mga07m45_1268_c1 3300050496 Bacteria 11491
232 nmdc:mga07m45_2131_c1 3300050496 Bacteria 9210
233 nmdc:mga07m45_99700_c1 3300050496 Bacteria 1668
234 nmdc:mga09592_98893_c1 3300050508 Bacteria 2498
235 nmdc:mga0qj67_291339_c1 3300050509 Bacteria 1323
236 Ga0500635_0000303 3300053080 Bacteria 17222
237 Ga0500635_0008472 3300053080 Bacteria 2821
238 Ga0500578_0000393 3300053086 Bacteria 53719
239 Ga0500646_0003415 3300053090 Bacteria 4075
240 Ga0500583_0236525 3300053092 Bacteria 904
241 Ga0500651_0019981 3300053093 Bacteria 4168
242 Ga0500642_0211698 3300053130 Bacteria 899
243 Ga0500652_088444 3300053131 Bacteria 1293
244 Ga0500568_0006612 3300053139 Bacteria 5798
245 Ga0500577_0256456 3300053142 Bacteria 760
246 Ga0500604_0111810 3300053151 Bacteria 907
247 Ga0500619_000167 3300053154 Bacteria 16030
248 Ga0500622_0004817 3300053156 Bacteria 8285
249 Ga0500636_0017211 3300053177 Bacteria 4265
250 Ga0500587_005050 3300053739 Bacteria 1790
251 Ga0500661_003583 3300055283 Bacteria 2918

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006195 Ga0075366_10055635 Ga0075366_100556352 165
2 3300053086 Ga0500578_0000393 Ga0500578_0000393_41165_41743 169
3 3300014745 Ga0157377_10000010 Ga0157377_1000001083 172
4 3300006846 Ga0075430_100306175 Ga0075430_1003061752 173
5 3300006880 Ga0075429_100003990 Ga0075429_1000039904 173
6 3300009147 Ga0114129_10644403 Ga0114129_106444032 173
7 3300050508 nmdc:mga09592_98893_c1 nmdc:mga09592_98893_c1_104_691 173
8 3300050509 nmdc:mga0qj67_291339_c1 nmdc:mga0qj67_291339_c1_477_1064 173
9 3300006353 Ga0075370_10021591 Ga0075370_100215914 174
10 3300009148 Ga0105243_10028502 Ga0105243_100285023 174
11 3300025935 Ga0207709_10015440 Ga0207709_100154403 174
12 3300026089 Ga0207648_10000002 Ga0207648_1000000219 174
13 3300042876 Ga0451577_0248545 Ga0451577_0248545_169_738 176
14 3300003775 Ga0055524_1000767 Ga0055524_100076717 177
15 3300025263 Ga0209565_1027065 Ga0209565_10270652 177
16 3300025291 Ga0209675_1035675 Ga0209675_10356752 177
17 3300025298 Ga0209050_1033664 Ga0209050_10336641 177
18 3300025299 Ga0209256_1000627 Ga0209256_10006274 177
19 3300048917 Ga0496114_0001249 Ga0496114_0001249_1560_2135 177
20 3300005262 Ga0065165_1000757 Ga0065165_100075728 178
21 3300025298 Ga0209050_1000720 Ga0209050_10007205 178
22 3300025914 Ga0207671_10332364 Ga0207671_103323642 178
23 3300031548 Ga0307408_100561846 Ga0307408_1005618462 178
24 3300041406 Ga0439439_0096445 Ga0439439_0096445_170_748 178
25 3300042014 Ga0439457_022498 Ga0439457_022498_321_899 178
26 3300049653 Ga0501206_019416 Ga0501206_019416_37_615 178
27 3300049762 Ga0501265_006960 Ga0501265_006960_456_1034 178
28 3300046528 Ga0495642_0339226 Ga0495642_0339226_103_642 179
29 3300032126 Ga0307415_100264733 Ga0307415_1002647332 180
30 3300031731 Ga0307405_10423360 Ga0307405_104233601 181
31 3300031824 Ga0307413_10069263 Ga0307413_100692632 181
32 3300031852 Ga0307410_10052196 Ga0307410_100521963 181
33 3300031903 Ga0307407_10048254 Ga0307407_100482544 181
34 3300031995 Ga0307409_100034371 Ga0307409_1000343714 181
35 3300032002 Ga0307416_100035253 Ga0307416_1000352533 181
36 3300032004 Ga0307414_10240910 Ga0307414_102409102 181
37 3300032005 Ga0307411_10017190 Ga0307411_100171903 181
38 3300037471 Ga0395905_0276369 Ga0395905_0276369_977_1522 181
39 3300049591 Ga0501075_0314811 Ga0501075_0314811_289_840 182
40 3300005295 Ga0065707_10087586 Ga0065707_100875863 185
41 3300017792 Ga0163161_10083569 Ga0163161_100835691 185
42 3300025901 Ga0207688_10120937 Ga0207688_101209372 185
43 3300037471 Ga0395905_0071498 Ga0395905_0071498_2104_2667 185
44 iso_pu_bacteria 2585428062 2587757978 185
45 3300025932 Ga0207690_10166462 Ga0207690_101664621 186
46 3300053080 Ga0500635_0008472 Ga0500635_0008472_1541_2101 186
47 3300053177 Ga0500636_0017211 Ga0500636_0017211_1524_2084 186
48 3300031507 Ga0307509_10623977 Ga0307509_106239772 187
49 3300047472 Ga0495686_0000992 Ga0495686_0000992_14673_15242 187
50 iso_pu_bacteria 2585428058 2587733599 187
51 iso_pu_bacteria 2588253510 2588293998 187
52 iso_pu_bacteria 2643221592 2643967103 187
53 iso_pu_bacteria 2643221625 2644139933 187
54 iso_pu_bacteria 2643221648 2644271173 187
55 3300006195 Ga0075366_10171567 Ga0075366_101715672 188
56 3300006353 Ga0075370_10052162 Ga0075370_100521623 188
57 3300013297 Ga0157378_10008020 Ga0157378_100080207 188
58 3300014326 Ga0157380_10004986 Ga0157380_100049863 188
59 3300042134 Ga0450898_045183 Ga0450898_045183_189_758 188
60 3300050493 nmdc:mga0k408_142636_c1 nmdc:mga0k408_142636_c1_147_719 188
61 3300050496 nmdc:mga07m45_99700_c1 nmdc:mga07m45_99700_c1_55_627 188
62 3300002773 JGI25152J39213_1001209 JGI25152J39213_10012099 189
63 3300003215 JGI25153J46596_10004893 JGI25153J46596_100048932 189
64 3300003316 rootH1_10010532 rootH1_100105323 189
65 3300003322 rootL2_10035584 rootL2_100355842 189
66 3300005354 Ga0070675_100102362 Ga0070675_1001023622 189
67 3300005355 Ga0070671_100033697 Ga0070671_1000336973 189
68 3300005356 Ga0070674_100116253 Ga0070674_1001162532 189
69 3300005618 Ga0068864_100072777 Ga0068864_1000727773 189
70 3300005841 Ga0068863_100083601 Ga0068863_1000836012 189
71 3300006177 Ga0075362_10225125 Ga0075362_102251252 189
72 3300006178 Ga0075367_10076899 Ga0075367_100768992 189
73 3300006195 Ga0075366_10098996 Ga0075366_100989962 189
74 3300009176 Ga0105242_11045471 Ga0105242_110454712 189
75 3300009177 Ga0105248_10125640 Ga0105248_101256402 189
76 3300025245 Ga0207425_1000986 Ga0207425_10009863 189
77 3300025258 Ga0209129_1000038 Ga0209129_1000038151 189
78 3300025273 Ga0209673_1021270 Ga0209673_10212703 189
79 3300025295 Ga0209564_1000129 Ga0209564_100012936 189
80 3300025297 Ga0209758_1000197 Ga0209758_100019736 189
81 3300025926 Ga0207659_10068893 Ga0207659_100688932 189
82 3300025941 Ga0207711_10019160 Ga0207711_100191604 189
83 3300026067 Ga0207678_10001133 Ga0207678_100011339 189
84 3300026088 Ga0207641_10158412 Ga0207641_101584122 189
85 3300026095 Ga0207676_10023387 Ga0207676_100233873 189
86 3300027876 Ga0209974_10003338 Ga0209974_100033383 189
87 3300028794 Ga0307515_10000567 Ga0307515_1000056770 189
88 3300028794 Ga0307515_10007744 Ga0307515_1000774412 189
89 3300028794 Ga0307515_10036002 Ga0307515_100360025 189
90 3300030522 Ga0307512_10065192 Ga0307512_100651923 189
91 3300031239 Ga0265328_10002198 Ga0265328_100021989 189
92 3300031251 Ga0265327_10000143 Ga0265327_10000143100 189
93 3300031344 Ga0265316_10000069 Ga0265316_1000006928 189
94 3300031456 Ga0307513_10005283 Ga0307513_1000528312 189
95 3300031456 Ga0307513_10051534 Ga0307513_100515342 189
96 3300031507 Ga0307509_10103547 Ga0307509_101035471 189
97 3300031649 Ga0307514_10001199 Ga0307514_1000119927 189
98 3300031649 Ga0307514_10171681 Ga0307514_101716812 189
99 3300031730 Ga0307516_10004964 Ga0307516_100049644 189
100 3300031730 Ga0307516_10529487 Ga0307516_105294872 189
101 3300031901 Ga0307406_10716145 Ga0307406_107161452 189
102 3300032002 Ga0307416_100046863 Ga0307416_1000468632 189
103 3300037471 Ga0395905_0000181 Ga0395905_0000181_8021_8620 189
104 3300037471 Ga0395905_0429095 Ga0395905_0429095_90_668 189
105 3300041452 Ga0451793_1229966 Ga0451793_1229966_651_1223 189
106 3300041458 Ga0451798_0338171 Ga0451798_0338171_291_869 189
107 3300041486 Ga0451807_1322174 Ga0451807_1322174_380_952 189
108 3300041498 Ga0451841_0872396 Ga0451841_0872396_149_721 189
109 3300041512 Ga0451853_3365336 Ga0451853_3365336_87_659 189
110 3300046460 Ga0495638_0133020 Ga0495638_0133020_782_1360 189
111 3300046512 Ga0495610_0009549 Ga0495610_0009549_2022_2594 189
112 3300046515 Ga0495620_0153419 Ga0495620_0153419_284_862 189
113 3300046519 Ga0495632_0011887 Ga0495632_0011887_2413_2991 189
114 3300046519 Ga0495632_0017797 Ga0495632_0017797_988_1560 189
115 3300046522 Ga0495643_0105008 Ga0495643_0105008_821_1393 189
116 3300046660 Ga0495625_0007448 Ga0495625_0007448_7014_7586 189
117 3300046692 Ga0495671_0304215 Ga0495671_0304215_85_657 189
118 3300048905 Ga0496102_0001753 Ga0496102_0001753_2502_3074 189
119 3300048907 Ga0496104_0041626 Ga0496104_0041626_1174_1755 189
120 3300048908 Ga0496105_0056883 Ga0496105_0056883_921_1502 189
121 3300048911 Ga0496108_0093421 Ga0496108_0093421_1536_2117 189
122 3300048913 Ga0496110_0515250 Ga0496110_0515250_342_935 189
123 3300048915 Ga0496112_0002750 Ga0496112_0002750_2881_3462 189
124 3300048916 Ga0496113_0029266 Ga0496113_0029266_3247_3828 189
125 3300049569 Ga0501032_0046196 Ga0501032_0046196_2060_2638 189
126 3300049579 Ga0501043_0000024 Ga0501043_0000024_37382_37960 189
127 3300049580 Ga0501046_0000173 Ga0501046_0000173_37382_37960 189
128 3300049581 Ga0501047_0000051 Ga0501047_0000051_116322_116900 189
129 3300049582 Ga0501048_0000650 Ga0501048_0000650_20230_20808 189
130 3300049744 Ga0501083_0122189 Ga0501083_0122189_979_1557 189
131 3300049824 Ga0501045_0003244 Ga0501045_0003244_4250_4828 189
132 3300050490 nmdc:mga03n38_475377_c1 nmdc:mga03n38_475377_c1_49_627 189
133 3300050493 nmdc:mga0k408_36296_c1 nmdc:mga0k408_36296_c1_321_899 189
134 3300050494 nmdc:mga06z11_338565_c1 nmdc:mga06z11_338565_c1_236_808 189
135 3300050496 nmdc:mga07m45_2131_c1 nmdc:mga07m45_2131_c1_3760_4338 189
136 3300053090 Ga0500646_0003415 Ga0500646_0003415_2232_2810 189
137 3300053092 Ga0500583_0236525 Ga0500583_0236525_139_717 189
138 3300053093 Ga0500651_0019981 Ga0500651_0019981_789_1367 189
139 3300053130 Ga0500642_0211698 Ga0500642_0211698_305_883 189
140 3300053139 Ga0500568_0006612 Ga0500568_0006612_3989_4570 189
141 3300053142 Ga0500577_0256456 Ga0500577_0256456_129_707 189
142 3300053151 Ga0500604_0111810 Ga0500604_0111810_299_877 189
143 3300053154 Ga0500619_000167 Ga0500619_000167_10008_10580 189
144 3300053156 Ga0500622_0004817 Ga0500622_0004817_7654_8232 189
145 3300053739 Ga0500587_005050 Ga0500587_005050_55_627 189
146 iso_pu_bacteria 2585428057 2587729032 189
147 3300003759 Ga0055525_1000036 Ga0055525_10000363 190
148 3300025230 Ga0209563_100014 Ga0209563_100014386 190
149 3300030522 Ga0307512_10318118 Ga0307512_103181181 190
150 3300045051 Ga0451576_0016862 Ga0451576_0016862_3170_3742 190
151 3300046492 Ga0495585_0038945 Ga0495585_0038945_1691_2266 191
152 3300049649 Ga0501198_000003 Ga0501198_000003_148033_148620 192
153 3300049662 Ga0501222_000001 Ga0501222_000001_242551_243138 192
154 3300005328 Ga0070676_10081271 Ga0070676_100812712 193
155 3300005331 Ga0070670_100088504 Ga0070670_1000885043 193
156 3300005355 Ga0070671_100093150 Ga0070671_1000931502 193
157 3300005459 Ga0068867_100003698 Ga0068867_10000369810 193
158 3300005578 Ga0068854_100670327 Ga0068854_1006703272 193
159 3300005616 Ga0068852_100638690 Ga0068852_1006386902 193
160 3300005718 Ga0068866_10430185 Ga0068866_104301851 193
161 3300005834 Ga0068851_10054004 Ga0068851_100540043 193
162 3300009174 Ga0105241_10823517 Ga0105241_108235172 193
163 3300009551 Ga0105238_10265783 Ga0105238_102657832 193
164 3300013297 Ga0157378_10056348 Ga0157378_100563482 193
165 3300013306 Ga0163162_10548535 Ga0163162_105485352 193
166 3300014326 Ga0157380_10763056 Ga0157380_107630561 193
167 3300025303 Ga0209051_1012210 Ga0209051_10122104 193
168 3300025907 Ga0207645_10003152 Ga0207645_1000315213 193
169 3300025931 Ga0207644_10169933 Ga0207644_101699332 193
170 3300025933 Ga0207706_10000451 Ga0207706_1000045137 193
171 3300025938 Ga0207704_10592458 Ga0207704_105924582 193
172 3300026089 Ga0207648_10008460 Ga0207648_100084608 193
173 3300026121 Ga0207683_10547226 Ga0207683_105472261 193
174 3300026142 Ga0207698_10739932 Ga0207698_107399322 193
175 3300028380 Ga0268265_11455857 Ga0268265_114558571 193
176 3300031616 Ga0307508_10159179 Ga0307508_101591792 193
177 3300044658 Ga0466972_0001282 Ga0466972_0001282_2018_2608 193
178 3300044658 Ga0466972_0214106 Ga0466972_0214106_258_854 193
179 3300044683 Ga0466965_0002086 Ga0466965_0002086_279_866 193
180 3300044683 Ga0466965_0196211 Ga0466965_0196211_382_972 193
181 3300044684 Ga0466966_0000509 Ga0466966_0000509_15223_15810 193
182 3300044693 Ga0466961_0003273 Ga0466961_0003273_4800_5387 193
183 3300044694 Ga0466963_0051512 Ga0466963_0051512_1315_1902 193
184 3300044694 Ga0466963_0659951 Ga0466963_0659951_90_677 193
185 3300044706 Ga0466964_0000391 Ga0466964_0000391_1706_2293 193
186 3300044706 Ga0466964_0042501 Ga0466964_0042501_149_739 193
187 3300044719 Ga0466971_0051544 Ga0466971_0051544_767_1354 193
188 3300044735 Ga0466968_0017912 Ga0466968_0017912_817_1404 193
189 3300044765 Ga0466970_0003788 Ga0466970_0003788_5858_6445 193
190 3300044901 Ga0466960_0403731 Ga0466960_0403731_71_667 193
191 3300045049 Ga0466959_0007095 Ga0466959_0007095_1215_1802 193
192 3300045836 Ga0466958_0009637 Ga0466958_0009637_3980_4567 193
193 3300045976 Ga0466967_0039904 Ga0466967_0039904_49_636 193
194 3300045976 Ga0466967_0061637 Ga0466967_0061637_1449_2036 193
195 3300045976 Ga0466967_0534025 Ga0466967_0534025_120_707 193
196 3300048907 Ga0496104_0021304 Ga0496104_0021304_1562_2143 193
197 3300048912 Ga0496109_0317450 Ga0496109_0317450_663_1244 193
198 3300002705 JGI25156J39149_1000246 JGI25156J39149_10002467 194
199 3300002738 JGI25154J39366_1001217 JGI25154J39366_10012175 194
200 3300002741 JGI25157J39369_1000069 JGI25157J39369_100006922 194
201 3300003756 Ga0055533_1000026 Ga0055533_100002662 194
202 3300003756 Ga0055533_1000068 Ga0055533_1000068144 194
203 3300003759 Ga0055525_1002368 Ga0055525_10023682 194
204 3300005329 Ga0070683_100221342 Ga0070683_1002213422 194
205 3300005334 Ga0068869_100300704 Ga0068869_1003007042 194
206 3300005364 Ga0070673_100324567 Ga0070673_1003245672 194
207 3300005535 Ga0070684_100306594 Ga0070684_1003065942 194
208 3300005539 Ga0068853_100390107 Ga0068853_1003901072 194
209 3300005563 Ga0068855_100014082 Ga0068855_1000140824 194
210 3300005577 Ga0068857_100003113 Ga0068857_10000311311 194
211 3300005578 Ga0068854_100052500 Ga0068854_1000525002 194
212 3300005614 Ga0068856_100000521 Ga0068856_10000052131 194
213 3300005616 Ga0068852_100440177 Ga0068852_1004401772 194
214 3300005719 Ga0068861_100062863 Ga0068861_1000628634 194
215 3300006353 Ga0075370_10001815 Ga0075370_100018159 194
216 3300009545 Ga0105237_10204663 Ga0105237_102046632 194
217 3300009551 Ga0105238_10100394 Ga0105238_101003943 194
218 3300010375 Ga0105239_10574982 Ga0105239_105749822 194
219 3300013104 Ga0157370_10230362 Ga0157370_102303623 194
220 3300013105 Ga0157369_10016190 Ga0157369_100161907 194
221 3300013307 Ga0157372_10184372 Ga0157372_101843722 194
222 3300025226 Ga0209674_100024 Ga0209674_100024235 194
223 3300025230 Ga0209563_100101 Ga0209563_100101145 194
224 3300025231 Ga0207427_100885 Ga0207427_10088515 194
225 3300025233 Ga0209437_119778 Ga0209437_1197781 194
226 3300025242 Ga0209258_100589 Ga0209258_1005891 194
227 3300025246 Ga0209646_1000012 Ga0209646_1000012273 194
228 3300025250 Ga0209026_1000004 Ga0209026_1000004346 194
229 3300025253 Ga0209677_100048 Ga0209677_100048124 194
230 3300025253 Ga0209677_100857 Ga0209677_10085713 194
231 3300025256 Ga0209759_1000003 Ga0209759_1000003381 194
232 3300025256 Ga0209759_1000067 Ga0209759_100006735 194
233 3300025256 Ga0209759_1006784 Ga0209759_10067842 194
234 3300025911 Ga0207654_10675910 Ga0207654_106759101 194
235 3300025913 Ga0207695_10062918 Ga0207695_100629182 194
236 3300025924 Ga0207694_10019003 Ga0207694_100190033 194
237 3300025944 Ga0207661_10259313 Ga0207661_102593132 194
238 3300025949 Ga0207667_10208749 Ga0207667_102087492 194
239 3300025960 Ga0207651_10158606 Ga0207651_101586062 194
240 3300025981 Ga0207640_10035994 Ga0207640_100359944 194
241 3300026078 Ga0207702_10004674 Ga0207702_100046745 194
242 3300026116 Ga0207674_10008041 Ga0207674_100080414 194
243 3300026118 Ga0207675_100075719 Ga0207675_1000757193 194
244 3300031903 Ga0307407_10063081 Ga0307407_100630813 194
245 3300037466 Ga0395898_0079525 Ga0395898_0079525_1874_2458 194
246 3300044842 Ga0466957_0237210 Ga0466957_0237210_32_616 194
247 3300046506 Ga0495583_0000022 Ga0495583_0000022_137274_137858 194
248 3300046507 Ga0495606_0001282 Ga0495606_0001282_26504_27088 194
249 3300046616 Ga0495668_0006957 Ga0495668_0006957_4239_4823 194
250 3300046660 Ga0495625_0060537 Ga0495625_0060537_1878_2462 194
251 3300046684 Ga0495669_0017628 Ga0495669_0017628_1198_1782 194
252 3300046694 Ga0495649_0000099 Ga0495649_0000099_43535_44119 194
253 3300046794 Ga0495589_0019806 Ga0495589_0019806_649_1233 194
254 3300048907 Ga0496104_0286530 Ga0496104_0286530_831_1415 194
255 3300050496 nmdc:mga07m45_1268_c1 nmdc:mga07m45_1268_c1_466_1050 194
256 3300053080 Ga0500635_0000303 Ga0500635_0000303_1738_2322 194
257 3300053131 Ga0500652_088444 Ga0500652_088444_63_647 194
258 3300055283 Ga0500661_003583 Ga0500661_003583_459_1043 194

Structural Annotation

Top 5 Hits

ID Description Score Start End
1k1e-assembly5.cif.gz_H structure of the cobalt-bound form of the deoxy-d-mannose-octulosonate 8-phosphate phosphatase (yrbi) from haemophilus influenzae (hi1679) 0.9674 24 180
3ij5-assembly1.cif.gz_A 1.95 angstrom resolution crystal structure of 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from yersinia pestis 0.9608 13 180
1k1e-assembly1.cif.gz_A structure of the cobalt-bound form of the deoxy-d-mannose-octulosonate 8-phosphate phosphatase (yrbi) from haemophilus influenzae (hi1679) 0.9565 16 180
3nrj-assembly3.cif.gz_I crystal structure of probable yrbi family phosphatase from pseudomonas syringae pv.phaseolica 1448a complexed with magnesium 0.9512 14 188
3hyc-assembly3.cif.gz_E crystal structure of e. coli phosphatase yrbi, with mg, tetragonal form 0.9475 10 182
ID Description Score Start End Superfamily
3ij5D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9588 13 180 3.40.50.1000
4um7A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9456 14 187 3.40.50.1000
4navA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9399 12 186 3.40.50.1000
1j8dB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.937 14 178 3.40.50.1000
3e81A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9225 25 184 3.40.50.1000
ID Description Score Start End GO Terms
AF-D0IXF7-F1-model_v4 deleted 0.9846 16 186
AF-A0A8B6LVD8-F1-model_v4 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC (EC 3.1.3.45) 0.9832 9 186 GO:0008781
GO:0009103
GO:0016788
GO:0046872
AF-A0A1F4KKM7-F1-model_v4 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase 0.9818 5 188 GO:0008781
GO:0009103
GO:0019143
GO:0046872
AF-A0A353Y8P1-F1-model_v4 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase 0.9783 5 188 GO:0008781
GO:0009103
GO:0019143
GO:0046872
AF-A0A522FWS5-F1-model_v4 HAD-IIIA family hydrolase 0.9772 29 178 GO:0008781
GO:0016788
GO:0046872

Feature Viewer

pLDDT pTM Quality
91.83 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map