F367702

General Info

Members Datasets Scaffolds Average Seq Length
257 191 514 441

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2579778521|2579854632
Length 475
Sequence GYDNVSRYGPRSACASRAGQTGGMPSAPSSSPDPTGGIRLPVTAPDAEGEVVELCRDLLRFESVNRGNGDGHERPIAEYVAAKLAEVGIEPTILESEPGRTSVVARIEGTDPSRAPLLIHGHLDVVPADASQWRVPPFSGEEVDGCLWGRGAVDMKDMDAMTLAVVRDLARSGRKPPRDLVVAFLADEEAGGVLGARWLVEHHPDLFADCSEAIGEVGGFSYTVSDDLRLYLIETAEKGLAWMKLTASGRAGHGSMISDDNAVTALCEAVARLGRHEFPLVLTPTVRVFLNELGEALGVEFDLDDLQTTVSKLGPVARMIGATLRNTVNPTQLQAGEKVNVIPGEATAYVDGRYLPGQEEEFIRQLDEILGPDIRREWVVHDGAVETGFDGALVEAMGASLRAEDPIARPVPYMLSGGTDAKSFSRLGIRCFGFSPLLLPADLDFSGMFHGVDERVPVESLRFGVRVLDRFLRAC

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
87 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
90 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
91 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
92 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
103 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
104 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
105 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
106 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
111 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
112 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
113 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
114 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
115 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
116 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
117 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
118 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
119 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
120 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
121 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
122 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
123 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
124 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
127 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
128 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
129 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
130 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
131 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
132 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
133 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
134 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
135 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
136 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
137 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
138 2506783011 Frankia datiscae Dg1 Isolate Nodule
139 2527291627 Frankia casuarinae Thr Isolate Nodule
140 2527291629 Frankia sp. BMG5.23 Isolate Nodule
141 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
142 2576861822 Frankia sp. CeD Isolate Nodule
143 2619618881 Frankia sp. ACN1ag Isolate Unclassified
144 2619619003 Frankia sp. CpI1-P Isolate Nodule
145 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
146 2626541554 Frankia sp. AvcI.1 Isolate Nodule
147 2671180195 Frankia sp. CcI49 Isolate Nodule
148 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
149 2684623036 Frankia sp. CgIM4 Isolate Nodule
150 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
151 2710264753 Frankia sp. KB5 Isolate Nodule
152 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
153 2773857922 Frankia sp. CcI49 Isolate Nodule
154 2773857924 Frankia sp. CgIS1 Isolate Nodule
155 2773857933 Frankia sp. BMG5.30 Isolate Nodule
156 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
157 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
158 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
159 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
160 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
161 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
162 2858868258 Micromonospora sp. MH33 Isolate Unclassified
163 2858882152 Micromonospora noduli MED15 Isolate Nodule
164 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
165 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
166 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
167 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
168 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
169 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
170 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
171 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
172 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
173 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
174 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
175 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
176 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
177 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
178 2902582711 Micromonospora sp. AP08 Isolate Unclassified
179 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
180 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
181 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
182 637000116 Frankia casuarinae CcI3 Isolate Nodule
183 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
184 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
185 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
186 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
187 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
188 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
189 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
190 8054920844 Frankia tisae Agncl-8 Isolate Nodule
191 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.6
Metatranscriptomes 0
Isolates 21.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.17
Nodule 8.56
Rhizoplane 7.39
Rhizosphere 66.54
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10001830 3300003203 Bacteria 9981
2 Ga0070683_100014538 3300005329 Bacteria 6890
3 Ga0070690_100001031 3300005330 Bacteria 14262
4 Ga0070670_100141459 3300005331 Bacteria 2081
5 Ga0070666_10000715 3300005335 Bacteria 20109
6 Ga0068868_100097576 3300005338 Bacteria 2375
7 Ga0070660_100036616 3300005339 Bacteria 3717
8 Ga0070689_100010246 3300005340 Bacteria 6679
9 Ga0070689_100093040 3300005340 Bacteria 2379
10 Ga0070661_100016183 3300005344 Bacteria 5267
11 Ga0070668_100005932 3300005347 Bacteria 9054
12 Ga0070675_100001399 3300005354 Bacteria 17695
13 Ga0070667_100040881 3300005367 Bacteria 3889
14 Ga0070667_100261120 3300005367 Bacteria 1551
15 Ga0070714_100028628 3300005435 Bacteria 4625
16 Ga0070713_100004166 3300005436 Bacteria 9646
17 Ga0070701_10043890 3300005438 Bacteria 2289
18 Ga0070700_100012685 3300005441 Bacteria 4713
19 Ga0070663_100005250 3300005455 Bacteria 7679
20 Ga0070663_100025932 3300005455 Bacteria 3963
21 Ga0070662_100003062 3300005457 Bacteria 10379
22 Ga0068867_100038379 3300005459 Bacteria 3487
23 Ga0070706_100006762 3300005467 Bacteria 10826
24 Ga0070707_100124906 3300005468 Bacteria 2500
25 Ga0070684_100045624 3300005535 Bacteria 3795
26 Ga0070672_100005321 3300005543 Bacteria 8522
27 Ga0070693_100026084 3300005547 Bacteria 3152
28 Ga0070693_100077302 3300005547 Bacteria 1975
29 Ga0070665_100039272 3300005548 Bacteria 4760
30 Ga0070664_100000450 3300005564 Bacteria 31114
31 Ga0068857_100018216 3300005577 Bacteria 6159
32 Ga0068856_100000928 3300005614 Bacteria 31425
33 Ga0070702_100006620 3300005615 Bacteria 5499
34 Ga0068852_100144076 3300005616 Bacteria 2208
35 Ga0068859_100002734 3300005617 Bacteria 17892
36 Ga0068859_100190962 3300005617 Bacteria 2132
37 Ga0068864_100096303 3300005618 Bacteria 2619
38 Ga0068863_100050989 3300005841 Bacteria 3922
39 Ga0068858_100000021 3300005842 Bacteria 172933
40 Ga0068858_100000024 3300005842 Bacteria 166473
41 Ga0068858_100003400 3300005842 Bacteria 15824
42 Ga0068858_100012892 3300005842 Bacteria 7882
43 Ga0068860_100014500 3300005843 Bacteria 7714
44 Ga0068862_100006479 3300005844 Bacteria 9720
45 Ga0068862_100024930 3300005844 Bacteria 5020
46 Ga0081455_10000054 3300005937 Bacteria 121980
47 Ga0081540_1007437 3300005983 Bacteria 7805
48 Ga0081539_10000135 3300005985 Bacteria 172789
49 Ga0081539_10001164 3300005985 Bacteria 47583
50 Ga0081539_10003347 3300005985 Bacteria 19904
51 Ga0081539_10007040 3300005985 Bacteria 10414
52 Ga0081539_10008660 3300005985 Bacteria 8765
53 Ga0081539_10023808 3300005985 Bacteria 3997
54 Ga0068871_100099892 3300006358 Bacteria 2430
55 Ga0075428_100004243 3300006844 Bacteria 15785
56 Ga0075428_100234066 3300006844 Bacteria 1982
57 Ga0075430_100003684 3300006846 Bacteria 12866
58 Ga0075430_100015818 3300006846 Bacteria 6425
59 Ga0075430_100210270 3300006846 Bacteria 1614
60 Ga0075431_100007586 3300006847 Bacteria 10802
61 Ga0075431_100075348 3300006847 Bacteria 3482
62 Ga0075429_100011681 3300006880 Bacteria 7615
63 Ga0075429_100055459 3300006880 Bacteria 3448
64 Ga0068865_100054965 3300006881 Bacteria 2769
65 Ga0068865_100111453 3300006881 Bacteria 2019
66 Ga0097620_100002734 3300006931 Bacteria 17892
67 Ga0097620_100190966 3300006931 Bacteria 2132
68 Ga0105245_10004640 3300009098 Bacteria 12138
69 Ga0105245_10198484 3300009098 Bacteria 1926
70 Ga0105247_10000336 3300009101 Bacteria 41065
71 Ga0105247_10001995 3300009101 Bacteria 14147
72 Ga0114129_10001039 3300009147 Bacteria 36304
73 Ga0114129_10083844 3300009147 Bacteria 4425
74 Ga0114129_10095329 3300009147 Bacteria 4121
75 Ga0114129_10134361 3300009147 Bacteria 3395
76 Ga0105248_10000239 3300009177 Bacteria 63565
77 Ga0105248_10003418 3300009177 Bacteria 17638
78 Ga0105248_10004498 3300009177 Bacteria 15424
79 Ga0105248_10007860 3300009177 Bacteria 11715
80 Ga0105248_10042783 3300009177 Bacteria 5080
81 Ga0105248_10374665 3300009177 Bacteria 1602
82 Ga0157378_10003625 3300013297 Bacteria 13666
83 Ga0157375_10000609 3300013308 Bacteria 31758
84 Ga0163163_10002856 3300014325 Bacteria 14600
85 Ga0163163_10053915 3300014325 Bacteria 3971
86 Ga0157377_10008727 3300014745 Bacteria 4953
87 Ga0157379_10000005 3300014968 Bacteria 172948
88 Ga0157379_10000203 3300014968 Bacteria 46082
89 Ga0157379_10008612 3300014968 Bacteria 8879
90 Ga0157376_10012000 3300014969 Bacteria 6410
91 Ga0157376_10012016 3300014969 Bacteria 6408
92 Ga0207710_10000109 3300025900 Bacteria 104351
93 Ga0207710_10000110 3300025900 Bacteria 104170
94 Ga0207680_10000824 3300025903 Bacteria 14635
95 Ga0207684_10034778 3300025910 Bacteria 4280
96 Ga0207657_10065528 3300025919 Bacteria 3096
97 Ga0207649_10011895 3300025920 Bacteria 4815
98 Ga0207687_10004000 3300025927 Bacteria 9880
99 Ga0207687_10147365 3300025927 Bacteria 1792
100 Ga0207700_10019208 3300025928 Bacteria 4612
101 Ga0207700_10294792 3300025928 Bacteria 1399
102 Ga0207664_10023707 3300025929 Bacteria 4602
103 Ga0207706_10006985 3300025933 Bacteria 10435
104 Ga0207670_10006470 3300025936 Bacteria 6501
105 Ga0207691_10008355 3300025940 Bacteria 9945
106 Ga0207711_10000321 3300025941 Bacteria 51456
107 Ga0207711_10000653 3300025941 Bacteria 34563
108 Ga0207711_10013205 3300025941 Bacteria 6860
109 Ga0207711_10031223 3300025941 Bacteria 4496
110 Ga0207661_10020064 3300025944 Bacteria 4992
111 Ga0207679_10009664 3300025945 Bacteria 6183
112 Ga0207640_10127265 3300025981 Bacteria 1836
113 Ga0207658_10017560 3300025986 Bacteria 4932
114 Ga0207677_10014308 3300026023 Bacteria 4630
115 Ga0207703_10000001 3300026035 Bacteria 822925
116 Ga0207703_10000005 3300026035 Bacteria 506356
117 Ga0207703_10003225 3300026035 Bacteria 13713
118 Ga0207703_10115547 3300026035 Bacteria 2296
119 Ga0207639_10199099 3300026041 Bacteria 1716
120 Ga0207678_10043626 3300026067 Bacteria 3880
121 Ga0207708_10013041 3300026075 Bacteria 6202
122 Ga0207702_10022590 3300026078 Bacteria 5216
123 Ga0207641_10031692 3300026088 Bacteria 4385
124 Ga0207641_10192943 3300026088 Bacteria 1873
125 Ga0207648_10045758 3300026089 Bacteria 3837
126 Ga0207676_10075265 3300026095 Bacteria 2723
127 Ga0207674_10026514 3300026116 Bacteria 6151
128 Ga0268266_10026083 3300028379 Bacteria 4972
129 Ga0268265_10127007 3300028380 Bacteria 2112
130 Ga0268265_10151365 3300028380 Bacteria 1957
131 Ga0268264_10001643 3300028381 Bacteria 20648
132 Ga0307515_10000526 3300028794 Bacteria 91263
133 Ga0307515_10009039 3300028794 Bacteria 19336
134 Ga0307512_10049466 3300030522 Bacteria 3389
135 Ga0307513_10002940 3300031456 Bacteria 23307
136 Ga0307513_10018835 3300031456 Bacteria 8237
137 Ga0307509_10020270 3300031507 Bacteria 7548
138 Ga0307508_10018404 3300031616 Bacteria 6352
139 Ga0316578_10054021 3300031728 Bacteria 2355
140 Ga0307516_10001067 3300031730 Bacteria 38191
141 Ga0307516_10056673 3300031730 Bacteria 3820
142 Ga0307516_10095430 3300031730 Bacteria 2796
143 Ga0307405_10011361 3300031731 Bacteria 4662
144 Ga0307405_10070465 3300031731 Bacteria 2246
145 Ga0307413_10040678 3300031824 Bacteria 2715
146 Ga0307410_10004475 3300031852 Bacteria 7235
147 Ga0307406_10008865 3300031901 Bacteria 5623
148 Ga0307406_10009188 3300031901 Bacteria 5537
149 Ga0307407_10032561 3300031903 Bacteria 2836
150 Ga0307409_100000054 3300031995 Bacteria 40959
151 Ga0307409_100013911 3300031995 Bacteria 5205
152 Ga0307416_100000817 3300032002 Bacteria 16313
153 Ga0307416_100006207 3300032002 Bacteria 7457
154 Ga0307414_10169846 3300032004 Bacteria 1742
155 Ga0307415_100000174 3300032126 Bacteria 28683
156 Ga0307415_100019581 3300032126 Bacteria 4112
157 Ga0373951_0000015 3300035091 Bacteria 69872
158 Ga0373942_0000135 3300035207 Bacteria 17532
159 Ga0373962_0001772 3300035242 Bacteria 5139
160 Ga0316574_0017190 3300035398 Bacteria 4228
161 Ga0373935_0015918 3300035692 Bacteria 4551
162 Ga0395898_0073875 3300037466 Bacteria 3294
163 Ga0395905_0193015 3300037471 Bacteria 1910
164 Ga0395901_0006876 3300038443 Bacteria 11492
165 Ga0395901_0015397 3300038443 Bacteria 7786
166 Ga0451791_0322869 3300041451 Bacteria 3319
167 Ga0451853_1251745 3300041512 Bacteria 8989
168 Ga0495658_0026810 3300046683 Bacteria 3093
169 Ga0495581_0048490 3300047315 Bacteria 2453
170 Ga0496100_0036316 3300048903 Bacteria 3107
171 Ga0496101_0016427 3300048904 Bacteria 5000
172 Ga0496102_0004043 3300048905 Bacteria 12432
173 Ga0496104_0130222 3300048907 Bacteria 2417
174 Ga0496105_0113314 3300048908 Bacteria 2238
175 Ga0496106_0011724 3300048909 Bacteria 6471
176 Ga0496107_0040550 3300048910 Bacteria 3342
177 Ga0496108_0000124 3300048911 Bacteria 76319
178 Ga0496108_0019075 3300048911 Bacteria 5627
179 Ga0496108_0118947 3300048911 Bacteria 2265
180 Ga0496109_0050743 3300048912 Bacteria 3778
181 Ga0496110_0006136 3300048913 Bacteria 9477
182 Ga0496110_0104878 3300048913 Bacteria 2536
183 Ga0496110_0118834 3300048913 Bacteria 2380
184 Ga0496111_0001565 3300048914 Bacteria 13203
185 Ga0496111_0095510 3300048914 Bacteria 2181
186 Ga0496113_0003136 3300048916 Bacteria 9838
187 Ga0496119_0000853 3300048922 Bacteria 40200
188 Ga0496119_0044351 3300048922 Bacteria 2801
189 Ga0496120_0000203 3300048923 Bacteria 101935
190 Ga0496121_0016751 3300048924 Bacteria 7541
191 Ga0496126_0000036 3300048929 Bacteria 354901
192 Ga0496126_0103004 3300048929 Bacteria 2495
193 nmdc:mga05p37_149437_c1 3300050507 Bacteria 2859
194 nmdc:mga05p37_193943_c1 3300050507 Bacteria 2464
195 nmdc:mga05p37_790_c1 3300050507 Bacteria 35216
196 nmdc:mga09592_3_c1 3300050508 Bacteria 144376
197 nmdc:mga0qj67_17_c1 3300050509 Bacteria 121673
198 nmdc:mga0qj67_2329_c1 3300050509 Bacteria 13501
199 nmdc:mga06r32_2073_c1 3300050510 Bacteria 17941
200 Ga0500646_0000251 3300053090 Bacteria 16440
201 Ga0500651_0035171 3300053093 Bacteria 3158
202 Ga0500641_0078188 3300053096 Bacteria 1401
203 2579854632 2579778521 Bacteria 7624758
204 2506866949 2506783011 Bacteria 5323186
205 2528203960 2527291627 Bacteria 5309833
206 2528214086 2527291629 Bacteria 5267418
207 2546949485 2546825537 Bacteria 5389291
208 2579749214 2576861822 Bacteria 5004595
209 2619856697 2619618881 Bacteria 7521104
210 2620349253 2619619003 Bacteria 7619552
211 2623588633 2622736626 Bacteria 7181580
212 2626636435 2626541554 Bacteria 7741902
213 2671837078 2671180195 Bacteria 9757215
214 2686537104 2684623035 Bacteria 8032739
215 2686544562 2684623036 Bacteria 5199090
216 2689991969 2687453743 Bacteria 8361025
217 2710603357 2710264753 Bacteria 5455564
218 2753263641 2751185782 Bacteria 11227053
219 2774855234 2773857922 Bacteria 9757215
220 2774865390 2773857924 Bacteria 5256821
221 2774903694 2773857933 Bacteria 5818019
222 2795786970 2795385470 Bacteria 8317180
223 2832009364 2832004796 Bacteria 6538017
224 2855673452 2855670206 Bacteria 7120389
225 2855680302 2855676851 Bacteria 7063653
226 2857294600 2857288857 Bacteria 7189066
227 2858852581 2858848962 Bacteria 6963058
228 2858875093 2858868258 Bacteria 7683772
229 2858887413 2858882152 Bacteria 7230291
230 2858892532 2858888857 Bacteria 7060307
231 2858897227 2858895516 Bacteria 7378898
232 2858904438 2858902515 Bacteria 7086037
233 2866066899 2866065130 Bacteria 6518152
234 2867303283 2867302475 Bacteria 7087181
235 2867318294 2867312974 Bacteria 7058875
236 2867319533 2867319477 Bacteria 7069771
237 2867511593 2867507094 Bacteria 6506033
238 2869051221 2869048445 Bacteria 6875584
239 2869064366 2869061728 Bacteria 7112407
240 2869075249 2869068681 Bacteria 7205615
241 2880491589 2880489317 Bacteria 7096270
242 2880500886 2880495981 Bacteria 7340502
243 2895890071 2895880812 Bacteria 11255272
244 2902584781 2902582711 Bacteria 6187705
245 2929223061 2929219909 Bacteria 6984360
246 2929229399 2929226422 Bacteria 7248583
247 2996226460 2996221748 Bacteria 6799777
248 637879979 637000116 Bacteria 5433628
249 8001784418 8001781756 Bacteria 9586736
250 8003859919 8003856774 Bacteria 7675274
251 8003875289 8003870546 Bacteria 7396674
252 8054706293 8054704163 Bacteria 7247792
253 8054732649 8054727385 Bacteria 7558670
254 8054737836 8054734606 Bacteria 6947278
255 8054918936 8054913762 Bacteria 7713009
256 8054921974 8054920844 Bacteria 7068637
257 8055159159 8055157932 Bacteria 6429399
258 JGI25406J46586_10001830
259 Ga0070683_100014538
260 Ga0070690_100001031
261 Ga0070670_100141459
262 Ga0070666_10000715
263 Ga0068868_100097576
264 Ga0070660_100036616
265 Ga0070689_100010246
266 Ga0070689_100093040
267 Ga0070661_100016183
268 Ga0070668_100005932
269 Ga0070675_100001399
270 Ga0070667_100040881
271 Ga0070667_100261120
272 Ga0070714_100028628
273 Ga0070713_100004166
274 Ga0070701_10043890
275 Ga0070700_100012685
276 Ga0070663_100005250
277 Ga0070663_100025932
278 Ga0070662_100003062
279 Ga0068867_100038379
280 Ga0070706_100006762
281 Ga0070707_100124906
282 Ga0070684_100045624
283 Ga0070672_100005321
284 Ga0070693_100026084
285 Ga0070693_100077302
286 Ga0070665_100039272
287 Ga0070664_100000450
288 Ga0068857_100018216
289 Ga0068856_100000928
290 Ga0070702_100006620
291 Ga0068852_100144076
292 Ga0068859_100002734
293 Ga0068859_100190962
294 Ga0068864_100096303
295 Ga0068863_100050989
296 Ga0068858_100000021
297 Ga0068858_100000024
298 Ga0068858_100003400
299 Ga0068858_100012892
300 Ga0068860_100014500
301 Ga0068862_100006479
302 Ga0068862_100024930
303 Ga0081455_10000054
304 Ga0081540_1007437
305 Ga0081539_10000135
306 Ga0081539_10001164
307 Ga0081539_10003347
308 Ga0081539_10007040
309 Ga0081539_10008660
310 Ga0081539_10023808
311 Ga0068871_100099892
312 Ga0075428_100004243
313 Ga0075428_100234066
314 Ga0075430_100003684
315 Ga0075430_100015818
316 Ga0075430_100210270
317 Ga0075431_100007586
318 Ga0075431_100075348
319 Ga0075429_100011681
320 Ga0075429_100055459
321 Ga0068865_100054965
322 Ga0068865_100111453
323 Ga0097620_100002734
324 Ga0097620_100190966
325 Ga0105245_10004640
326 Ga0105245_10198484
327 Ga0105247_10000336
328 Ga0105247_10001995
329 Ga0114129_10001039
330 Ga0114129_10083844
331 Ga0114129_10095329
332 Ga0114129_10134361
333 Ga0105248_10000239
334 Ga0105248_10003418
335 Ga0105248_10004498
336 Ga0105248_10007860
337 Ga0105248_10042783
338 Ga0105248_10374665
339 Ga0157378_10003625
340 Ga0157375_10000609
341 Ga0163163_10002856
342 Ga0163163_10053915
343 Ga0157377_10008727
344 Ga0157379_10000005
345 Ga0157379_10000203
346 Ga0157379_10008612
347 Ga0157376_10012000
348 Ga0157376_10012016
349 Ga0207710_10000109
350 Ga0207710_10000110
351 Ga0207680_10000824
352 Ga0207684_10034778
353 Ga0207657_10065528
354 Ga0207649_10011895
355 Ga0207687_10004000
356 Ga0207687_10147365
357 Ga0207700_10019208
358 Ga0207700_10294792
359 Ga0207664_10023707
360 Ga0207706_10006985
361 Ga0207670_10006470
362 Ga0207691_10008355
363 Ga0207711_10000321
364 Ga0207711_10000653
365 Ga0207711_10013205
366 Ga0207711_10031223
367 Ga0207661_10020064
368 Ga0207679_10009664
369 Ga0207640_10127265
370 Ga0207658_10017560
371 Ga0207677_10014308
372 Ga0207703_10000001
373 Ga0207703_10000005
374 Ga0207703_10003225
375 Ga0207703_10115547
376 Ga0207639_10199099
377 Ga0207678_10043626
378 Ga0207708_10013041
379 Ga0207702_10022590
380 Ga0207641_10031692
381 Ga0207641_10192943
382 Ga0207648_10045758
383 Ga0207676_10075265
384 Ga0207674_10026514
385 Ga0268266_10026083
386 Ga0268265_10127007
387 Ga0268265_10151365
388 Ga0268264_10001643
389 Ga0307515_10000526
390 Ga0307515_10009039
391 Ga0307512_10049466
392 Ga0307513_10002940
393 Ga0307513_10018835
394 Ga0307509_10020270
395 Ga0307508_10018404
396 Ga0316578_10054021
397 Ga0307516_10001067
398 Ga0307516_10056673
399 Ga0307516_10095430
400 Ga0307405_10011361
401 Ga0307405_10070465
402 Ga0307413_10040678
403 Ga0307410_10004475
404 Ga0307406_10008865
405 Ga0307406_10009188
406 Ga0307407_10032561
407 Ga0307409_100000054
408 Ga0307409_100013911
409 Ga0307416_100000817
410 Ga0307416_100006207
411 Ga0307414_10169846
412 Ga0307415_100000174
413 Ga0307415_100019581
414 Ga0373951_0000015
415 Ga0373942_0000135
416 Ga0373962_0001772
417 Ga0316574_0017190
418 Ga0373935_0015918
419 Ga0395898_0073875
420 Ga0395905_0193015
421 Ga0395901_0006876
422 Ga0395901_0015397
423 Ga0451791_0322869
424 Ga0451853_1251745
425 Ga0495658_0026810
426 Ga0495581_0048490
427 Ga0496100_0036316
428 Ga0496101_0016427
429 Ga0496102_0004043
430 Ga0496104_0130222
431 Ga0496105_0113314
432 Ga0496106_0011724
433 Ga0496107_0040550
434 Ga0496108_0000124
435 Ga0496108_0019075
436 Ga0496108_0118947
437 Ga0496109_0050743
438 Ga0496110_0006136
439 Ga0496110_0104878
440 Ga0496110_0118834
441 Ga0496111_0001565
442 Ga0496111_0095510
443 Ga0496113_0003136
444 Ga0496119_0000853
445 Ga0496119_0044351
446 Ga0496120_0000203
447 Ga0496121_0016751
448 Ga0496126_0000036
449 Ga0496126_0103004
450 nmdc:mga05p37_149437_c1
451 nmdc:mga05p37_193943_c1
452 nmdc:mga05p37_790_c1
453 nmdc:mga09592_3_c1
454 nmdc:mga0qj67_17_c1
455 nmdc:mga0qj67_2329_c1
456 nmdc:mga06r32_2073_c1
457 Ga0500646_0000251
458 Ga0500651_0035171
459 Ga0500641_0078188
460 2579854632
461 2506866949
462 2528203960
463 2528214086
464 2546949485
465 2579749214
466 2619856697
467 2620349253
468 2623588633
469 2626636435
470 2671837078
471 2686537104
472 2686544562
473 2689991969
474 2710603357
475 2753263641
476 2774855234
477 2774865390
478 2774903694
479 2795786970
480 2832009364
481 2855673452
482 2855680302
483 2857294600
484 2858852581
485 2858875093
486 2858887413
487 2858892532
488 2858897227
489 2858904438
490 2866066899
491 2867303283
492 2867318294
493 2867319533
494 2867511593
495 2869051221
496 2869064366
497 2869075249
498 2880491589
499 2880500886
500 2895890071
501 2902584781
502 2929223061
503 2929229399
504 2996226460
505 637879979
506 8001784418
507 8003859919
508 8003875289
509 8054706293
510 8054732649
511 8054737836
512 8054918936
513 8054921974
514 8055159159

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

118

474

0.92

PF07687

M20_dimer

Peptidase dimerisation domain

235

375

0.92

PF04389

Peptidase_M28

Peptidase family M28

102

213

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1q7l-assembly1.cif.gz_A zn-binding domain of the t347g mutant of human aminoacylase-i 0.8853 9 176
4h2k-assembly2.cif.gz_B crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae 0.8706 6 434
4h2k-assembly2.cif.gz_B crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae 0.8546 6 434
4h2k-assembly1.cif.gz_A crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae 0.8516 5 434
5vo3-assembly1.cif.gz_A-2 crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) 0.8514 5 434
ID Description Score Start End Superfamily
af_L7N684_5_212_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9497 2 191 3.40.630.10
af_Q2FWN8_3_180_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9334 8 176 3.40.630.10
1q7lC00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8819 9 176 3.40.630.10
af_Q4CR09_10_160_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8715 13 165 3.40.630.10
5xoyB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8681 9 434 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A0D8BI52-F1-model_v4 Acetylornithine deacetylase/succinyldiaminopimelate desuccinylase-like deacylase 0.9795 1 435 GO:0016787
GO:0046872
AF-A0A4D4K3B6-F1-model_v4 Peptidase M20 0.9746 1 404 GO:0016787
GO:0046872
AF-K0EQV1-F1-model_v4 Peptidase M20 dimerisation domain-containing protein 0.9734 10 435 GO:0016787
GO:0046872
AF-A0A0D8BI52-F1-model_v4 Acetylornithine deacetylase/succinyldiaminopimelate desuccinylase-like deacylase 0.9728 1 435 GO:0016787
GO:0046872
AF-A0A4V3F7K4-F1-model_v4 deleted 0.9722 1 434

Map