F367513
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 257 | 214 | 211 | 124 |
Family's Representative Sequence
| Representative Sequence | 3300044842|Ga0466957_0256491|Ga0466957_0256491_611_1006 |
| Length | 131 |
| Sequence | MPATLVNRNSARGGAAARRISRDRRHYRVRKHVAGTAERPRLVVTRSLRHIYAQVIDDSKGHTLASASTLDAALRSAEGDKSAQAREVGKLVAERAKAAGISAVVFDRGGNAYHGRVAALADAARAGGLEF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 2 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 3 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 4 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 5 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 6 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 7 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 8 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 9 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 10 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 11 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 12 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 13 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 14 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 15 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 16 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 17 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 18 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 19 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 20 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 21 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 22 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 23 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 24 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 25 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 26 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 27 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 28 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 29 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 30 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 31 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 32 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 33 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 34 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 35 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 36 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 37 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 38 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 39 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 55 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 58 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 59 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 82 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 83 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 84 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 85 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 87 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 102 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 104 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 105 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 106 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 107 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 108 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 109 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 110 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 111 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 112 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 113 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 114 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 115 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 116 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 117 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 118 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 119 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 120 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 121 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 122 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 123 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 124 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 125 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 126 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 127 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 128 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 129 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 142 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 143 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 144 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 145 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 146 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 147 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 149 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 150 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 151 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 152 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 153 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 154 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 155 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 156 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 157 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 158 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 159 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 160 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 161 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 162 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 163 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 164 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 165 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 166 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 167 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 168 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 169 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 170 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 171 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 172 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 173 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 174 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 198 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 199 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 200 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 201 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 202 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 203 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 204 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 205 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 206 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 207 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 208 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 209 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 210 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 211 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 212 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 213 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
| 214 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 69.26 |
| Metatranscriptomes | 12.84 |
| Isolates | 17.9 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 3.89 |
| Rhizoplane | 7 |
| Rhizosphere | 73.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10008865 | 3300002067 | Bacteria | 3244 |
| 2 | Ga0070658_10139931 | 3300005327 | Bacteria | 2021 |
| 3 | Ga0070658_10318058 | 3300005327 | Bacteria | 1329 |
| 4 | Ga0068869_101376950 | 3300005334 | Bacteria | 624 |
| 5 | Ga0070669_101092546 | 3300005353 | Bacteria | 687 |
| 6 | Ga0070709_10056112 | 3300005434 | Bacteria | 2490 |
| 7 | Ga0070714_100194472 | 3300005435 | Bacteria | 1853 |
| 8 | Ga0070711_100452535 | 3300005439 | Bacteria | 1051 |
| 9 | Ga0070684_100848751 | 3300005535 | Bacteria | 855 |
| 10 | Ga0068855_100171548 | 3300005563 | Bacteria | 2456 |
| 11 | Ga0068855_100791909 | 3300005563 | Bacteria | 1008 |
| 12 | Ga0070664_100124723 | 3300005564 | Bacteria | 2258 |
| 13 | Ga0070664_100492977 | 3300005564 | Bacteria | 1129 |
| 14 | Ga0068857_100041137 | 3300005577 | Bacteria | 4099 |
| 15 | Ga0068856_100271816 | 3300005614 | Bacteria | 1711 |
| 16 | Ga0068856_100504013 | 3300005614 | Bacteria | 1231 |
| 17 | Ga0068864_100016326 | 3300005618 | Bacteria | 6181 |
| 18 | Ga0068863_100012964 | 3300005841 | Bacteria | 8037 |
| 19 | Ga0068858_100644031 | 3300005842 | Bacteria | 1030 |
| 20 | Ga0068860_100368151 | 3300005843 | Bacteria | 1417 |
| 21 | Ga0081540_1059980 | 3300005983 | Bacteria | 1823 |
| 22 | Ga0070716_101383049 | 3300006173 | Bacteria | 572 |
| 23 | Ga0097621_101309293 | 3300006237 | Bacteria | 684 |
| 24 | Ga0075428_100661488 | 3300006844 | Bacteria | 1114 |
| 25 | Ga0075429_100978155 | 3300006880 | Bacteria | 740 |
| 26 | Ga0105250_10177662 | 3300009092 | Bacteria | 892 |
| 27 | Ga0105245_12239895 | 3300009098 | Bacteria | 600 |
| 28 | Ga0105247_10000016 | 3300009101 | Bacteria | 263389 |
| 29 | Ga0114129_10698501 | 3300009147 | Bacteria | 1304 |
| 30 | Ga0105243_10138987 | 3300009148 | Bacteria | 2070 |
| 31 | Ga0105243_10543924 | 3300009148 | Bacteria | 1108 |
| 32 | Ga0105243_12690228 | 3300009148 | Bacteria | 538 |
| 33 | Ga0105241_12606965 | 3300009174 | Bacteria | 508 |
| 34 | Ga0105248_10002899 | 3300009177 | Bacteria | 19028 |
| 35 | Ga0105248_10112831 | 3300009177 | Bacteria | 3066 |
| 36 | Ga0105237_10000003 | 3300009545 | Bacteria | 556908 |
| 37 | Ga0105237_10214328 | 3300009545 | Bacteria | 1925 |
| 38 | Ga0105238_11048753 | 3300009551 | Bacteria | 837 |
| 39 | Ga0105239_11727489 | 3300010375 | Bacteria | 725 |
| 40 | Ga0157371_10183963 | 3300013102 | Bacteria | 1495 |
| 41 | Ga0157370_10773485 | 3300013104 | Bacteria | 874 |
| 42 | Ga0157369_10615805 | 3300013105 | Bacteria | 1120 |
| 43 | Ga0157369_11297640 | 3300013105 | Bacteria | 742 |
| 44 | Ga0157372_11708209 | 3300013307 | Bacteria | 724 |
| 45 | Ga0157375_11008612 | 3300013308 | Bacteria | 972 |
| 46 | Ga0157375_11621328 | 3300013308 | Bacteria | 765 |
| 47 | Ga0163163_10014125 | 3300014325 | Bacteria | 7333 |
| 48 | Ga0163163_10024877 | 3300014325 | Bacteria | 5701 |
| 49 | Ga0163163_10503104 | 3300014325 | Bacteria | 1273 |
| 50 | Ga0157380_12950586 | 3300014326 | Bacteria | 542 |
| 51 | Ga0157379_10011242 | 3300014968 | Bacteria | 7798 |
| 52 | Ga0157379_10358647 | 3300014968 | Bacteria | 1336 |
| 53 | Ga0157376_11125448 | 3300014969 | Bacteria | 811 |
| 54 | Ga0163161_11862488 | 3300017792 | Bacteria | 535 |
| 55 | Ga0206352_10506297 | 3300020078 | Bacteria | 593 |
| 56 | Ga0206352_11149454 | 3300020078 | Bacteria | 979 |
| 57 | Ga0206354_11586477 | 3300020081 | Bacteria | 949 |
| 58 | Ga0213873_10225366 | 3300021358 | Bacteria | 588 |
| 59 | Ga0213872_10332296 | 3300021361 | Bacteria | 626 |
| 60 | Ga0213876_10516546 | 3300021384 | Bacteria | 636 |
| 61 | Ga0213871_10053880 | 3300021441 | Bacteria | 1108 |
| 62 | Ga0213871_10055761 | 3300021441 | Bacteria | 1092 |
| 63 | Ga0224712_10531906 | 3300022467 | Bacteria | 570 |
| 64 | Ga0228598_1019191 | 3300024227 | Bacteria | 1348 |
| 65 | Ga0207713_1059869 | 3300025735 | Bacteria | 1459 |
| 66 | Ga0207713_1157861 | 3300025735 | Bacteria | 726 |
| 67 | Ga0207710_10000017 | 3300025900 | Bacteria | 370962 |
| 68 | Ga0207685_10270979 | 3300025905 | Bacteria | 829 |
| 69 | Ga0207671_10000012 | 3300025914 | Bacteria | 519494 |
| 70 | Ga0207671_10252251 | 3300025914 | Bacteria | 1387 |
| 71 | Ga0207693_10028753 | 3300025915 | Bacteria | 4393 |
| 72 | Ga0207681_11003255 | 3300025923 | Bacteria | 700 |
| 73 | Ga0207664_10169646 | 3300025929 | Bacteria | 1867 |
| 74 | Ga0207664_12013393 | 3300025929 | Bacteria | 501 |
| 75 | Ga0207665_11181573 | 3300025939 | Bacteria | 610 |
| 76 | Ga0207711_10002995 | 3300025941 | Bacteria | 14760 |
| 77 | Ga0207711_10174131 | 3300025941 | Bacteria | 1954 |
| 78 | Ga0207679_10423993 | 3300025945 | Bacteria | 1175 |
| 79 | Ga0207667_10279576 | 3300025949 | Bacteria | 1706 |
| 80 | Ga0207702_11216144 | 3300026078 | Bacteria | 747 |
| 81 | Ga0207641_10066082 | 3300026088 | Bacteria | 3095 |
| 82 | Ga0207676_10009618 | 3300026095 | Bacteria | 6880 |
| 83 | Ga0265356_1000525 | 3300028017 | Bacteria | 6878 |
| 84 | Ga0268264_11524190 | 3300028381 | Bacteria | 679 |
| 85 | Ga0265326_10033682 | 3300028558 | Bacteria | 1458 |
| 86 | Ga0265338_10001848 | 3300028800 | Bacteria | 33242 |
| 87 | Ga0265763_1012663 | 3300030763 | Bacteria | 808 |
| 88 | Ga0265770_1062228 | 3300030878 | Bacteria | 696 |
| 89 | Ga0265760_10000904 | 3300031090 | Bacteria | 8569 |
| 90 | Ga0265760_10048447 | 3300031090 | Bacteria | 1276 |
| 91 | Ga0265320_10122167 | 3300031240 | Bacteria | 1187 |
| 92 | Ga0307513_10178802 | 3300031456 | Bacteria | 1987 |
| 93 | Ga0373960_0064482 | 3300035121 | Bacteria | 1119 |
| 94 | Ga0373943_0118955 | 3300035170 | Bacteria | 1402 |
| 95 | Ga0373946_0417694 | 3300035171 | Bacteria | 679 |
| 96 | Ga0373935_0316510 | 3300035692 | Bacteria | 1106 |
| 97 | Ga0373947_0427968 | 3300035725 | Bacteria | 895 |
| 98 | Ga0373925_0475224 | 3300037068 | Bacteria | 1025 |
| 99 | Ga0395905_0001385 | 3300037471 | Bacteria | 29377 |
| 100 | Ga0395905_0025380 | 3300037471 | Bacteria | 5589 |
| 101 | Ga0395905_0074891 | 3300037471 | Bacteria | 3173 |
| 102 | Ga0395905_0212637 | 3300037471 | Bacteria | 1811 |
| 103 | Ga0395905_1116486 | 3300037471 | Bacteria | 692 |
| 104 | Ga0436364_0334344 | 3300037853 | Unclassified | 1370 |
| 105 | Ga0400483_122812 | 3300039062 | Bacteria | 1939 |
| 106 | Ga0400483_197183 | 3300039062 | Bacteria | 2002 |
| 107 | Ga0436365_0419155 | 3300039437 | Unclassified | 522 |
| 108 | Ga0436365_1589909 | 3300039437 | Bacteria | 826 |
| 109 | Ga0436360_0103681 | 3300039438 | Bacteria | 920 |
| 110 | Ga0436360_1218238 | 3300039438 | Bacteria | 8853 |
| 111 | Ga0436361_0424973 | 3300039447 | Bacteria | 663 |
| 112 | Ga0436363_0791505 | 3300039450 | Bacteria | 887 |
| 113 | Ga0436362_0009697 | 3300039453 | Bacteria | 1284 |
| 114 | Ga0436362_0997060 | 3300039453 | Bacteria | 3403 |
| 115 | Ga0436362_1199268 | 3300039453 | Bacteria | 838 |
| 116 | Ga0450903_015214 | 3300042138 | Bacteria | 1213 |
| 117 | Ga0466972_0010313 | 3300044658 | Bacteria | 4691 |
| 118 | Ga0466972_0187295 | 3300044658 | Bacteria | 970 |
| 119 | Ga0466965_0174426 | 3300044683 | Bacteria | 1132 |
| 120 | Ga0466965_0207552 | 3300044683 | Bacteria | 1041 |
| 121 | Ga0466966_0380555 | 3300044684 | Bacteria | 848 |
| 122 | Ga0466957_0256491 | 3300044842 | Bacteria | 1164 |
| 123 | Ga0495629_0037443 | 3300046459 | Bacteria | 3419 |
| 124 | Ga0495580_0185497 | 3300046472 | Bacteria | 1436 |
| 125 | Ga0495582_0440911 | 3300046473 | Bacteria | 752 |
| 126 | Ga0495662_0202236 | 3300046476 | Bacteria | 979 |
| 127 | Ga0495594_0359067 | 3300046499 | Bacteria | 829 |
| 128 | Ga0495667_0472225 | 3300046559 | Bacteria | 787 |
| 129 | Ga0495588_0123699 | 3300046674 | Bacteria | 1364 |
| 130 | Ga0495623_0217470 | 3300046679 | Bacteria | 1090 |
| 131 | Ga0495600_0507692 | 3300046809 | Bacteria | 740 |
| 132 | Ga0495604_0004624 | 3300047317 | Bacteria | 10906 |
| 133 | Ga0495675_0001497 | 3300047444 | Bacteria | 14149 |
| 134 | Ga0495685_048595 | 3300047447 | Bacteria | 1442 |
| 135 | Ga0496100_0773698 | 3300048903 | Bacteria | 751 |
| 136 | Ga0496102_0977101 | 3300048905 | Bacteria | 767 |
| 137 | Ga0496104_0010095 | 3300048907 | Bacteria | 8432 |
| 138 | Ga0496104_0628488 | 3300048907 | Bacteria | 983 |
| 139 | Ga0496105_0079160 | 3300048908 | Bacteria | 2714 |
| 140 | Ga0496105_0140977 | 3300048908 | Bacteria | 1984 |
| 141 | Ga0496107_0124435 | 3300048910 | Bacteria | 1901 |
| 142 | Ga0496108_1180614 | 3300048911 | Bacteria | 648 |
| 143 | Ga0496109_0062528 | 3300048912 | Bacteria | 3404 |
| 144 | Ga0496109_1302403 | 3300048912 | Bacteria | 663 |
| 145 | Ga0496110_0130962 | 3300048913 | Bacteria | 2265 |
| 146 | Ga0496111_0032303 | 3300048914 | Bacteria | 3731 |
| 147 | Ga0496111_1120011 | 3300048914 | Bacteria | 560 |
| 148 | Ga0496112_0406651 | 3300048915 | Bacteria | 1300 |
| 149 | Ga0496112_0736853 | 3300048915 | Bacteria | 912 |
| 150 | Ga0496113_0032935 | 3300048916 | Bacteria | 3769 |
| 151 | Ga0496113_0883402 | 3300048916 | Bacteria | 708 |
| 152 | Ga0496115_0026793 | 3300048918 | Bacteria | 4503 |
| 153 | Ga0496119_0000855 | 3300048922 | Bacteria | 40135 |
| 154 | Ga0496120_0000372 | 3300048923 | Bacteria | 72951 |
| 155 | Ga0496123_0091568 | 3300048926 | Bacteria | 1803 |
| 156 | Ga0496126_0039353 | 3300048929 | Bacteria | 4388 |
| 157 | Ga0496126_0732688 | 3300048929 | Bacteria | 765 |
| 158 | Ga0501306_001320 | 3300049127 | Bacteria | 2296 |
| 159 | Ga0501309_003792 | 3300049129 | Bacteria | 1733 |
| 160 | Ga0501310_000922 | 3300049130 | Bacteria | 2620 |
| 161 | Ga0501305_000256 | 3300049161 | Bacteria | 3988 |
| 162 | Ga0501311_001796 | 3300049527 | Bacteria | 1948 |
| 163 | Ga0501312_003927 | 3300049528 | Bacteria | 1724 |
| 164 | Ga0501313_000154 | 3300049529 | Bacteria | 3688 |
| 165 | Ga0501315_000662 | 3300049531 | Bacteria | 2525 |
| 166 | Ga0501316_000124 | 3300049532 | Bacteria | 4009 |
| 167 | Ga0501317_002440 | 3300049533 | Bacteria | 1758 |
| 168 | Ga0501318_000228 | 3300049534 | Bacteria | 3100 |
| 169 | Ga0501319_000081 | 3300049535 | Bacteria | 3300 |
| 170 | Ga0501320_001410 | 3300049536 | Bacteria | 1761 |
| 171 | Ga0501323_000010 | 3300049539 | Bacteria | 9499 |
| 172 | Ga0501324_000009 | 3300049540 | Bacteria | 7379 |
| 173 | Ga0501325_000039 | 3300049541 | Bacteria | 3825 |
| 174 | Ga0501329_00260 | 3300049545 | Bacteria | 1662 |
| 175 | Ga0501031_0058599 | 3300049568 | Bacteria | 2509 |
| 176 | Ga0501032_0043434 | 3300049569 | Bacteria | 3044 |
| 177 | Ga0501034_0011194 | 3300049571 | Bacteria | 9312 |
| 178 | Ga0501034_0073278 | 3300049571 | Bacteria | 3433 |
| 179 | Ga0501034_0909170 | 3300049571 | Bacteria | 768 |
| 180 | Ga0501036_0046642 | 3300049572 | Bacteria | 3669 |
| 181 | Ga0501037_0015377 | 3300049573 | Bacteria | 5631 |
| 182 | Ga0501038_0003477 | 3300049574 | Bacteria | 14673 |
| 183 | Ga0501039_0020664 | 3300049575 | Bacteria | 5045 |
| 184 | Ga0501040_1000834 | 3300049576 | Bacteria | 606 |
| 185 | Ga0501043_0290793 | 3300049579 | Bacteria | 1251 |
| 186 | Ga0501046_0055803 | 3300049580 | Bacteria | 3102 |
| 187 | Ga0501047_0053457 | 3300049581 | Bacteria | 3905 |
| 188 | Ga0501068_0074370 | 3300049584 | Bacteria | 2077 |
| 189 | Ga0501068_0200445 | 3300049584 | Bacteria | 1266 |
| 190 | Ga0501069_0034576 | 3300049585 | Bacteria | 2783 |
| 191 | Ga0501070_0211446 | 3300049586 | Bacteria | 1592 |
| 192 | Ga0501070_0348483 | 3300049586 | Bacteria | 1202 |
| 193 | Ga0501072_0509969 | 3300049588 | Bacteria | 951 |
| 194 | Ga0501072_0656964 | 3300049588 | Bacteria | 825 |
| 195 | Ga0501074_0018515 | 3300049590 | Bacteria | 5060 |
| 196 | Ga0501079_0855961 | 3300049741 | Bacteria | 716 |
| 197 | Ga0501080_0025709 | 3300049742 | Bacteria | 5468 |
| 198 | Ga0501035_0137730 | 3300049822 | Bacteria | 2124 |
| 199 | Ga0501045_0342194 | 3300049824 | Bacteria | 1113 |
| 200 | nmdc:mga05p37_1126392_c1 | 3300050507 | Bacteria | 819 |
| 201 | nmdc:mga09592_122892_c1 | 3300050508 | Bacteria | 2230 |
| 202 | Ga0501084_1856266 | 3300054114 | Bacteria | 503 |
| 203 | Ga0587066_101290 | 3300059490 | Bacteria | 655 |
| 204 | Ga0587082_002486 | 3300059504 | Bacteria | 2086 |
| 205 | Ga0587085_128667 | 3300059506 | Bacteria | 564 |
| 206 | Ga0587090_091373 | 3300059510 | Bacteria | 624 |
| 207 | Ga0587068_161911 | 3300059641 | Bacteria | 512 |
| 208 | Ga0587069_080355 | 3300059642 | Bacteria | 635 |
| 209 | Ga0587072_045745 | 3300059643 | Unclassified | 863 |
| 210 | Ga0587111_0000226 | 3300060346 | Bacteria | 4610 |
| 211 | Ga0501082_0613370 | 3300060353 | Bacteria | 952 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009148 | Ga0105243_10543924 | Ga0105243_105439242 | 92 |
| 2 | 3300048926 | Ga0496123_0091568 | Ga0496123_0091568_69_440 | 101 |
| 3 | 3300022467 | Ga0224712_10531906 | Ga0224712_105319062 | 104 |
| 4 | 3300037471 | Ga0395905_0074891 | Ga0395905_0074891_2002_2319 | 105 |
| 5 | 3300025939 | Ga0207665_11181573 | Ga0207665_111815731 | 109 |
| 6 | 3300046499 | Ga0495594_0359067 | Ga0495594_0359067_116_511 | 109 |
| 7 | 3300059510 | Ga0587090_091373 | Ga0587090_091373_54_443 | 109 |
| 8 | 3300049571 | Ga0501034_0073278 | Ga0501034_0073278_1249_1608 | 112 |
| 9 | 3300028558 | Ga0265326_10033682 | Ga0265326_100336824 | 113 |
| 10 | 3300028800 | Ga0265338_10001848 | Ga0265338_1000184811 | 113 |
| 11 | 3300031240 | Ga0265320_10122167 | Ga0265320_101221672 | 113 |
| 12 | 3300037471 | Ga0395905_0212637 | Ga0395905_0212637_720_1079 | 113 |
| 13 | 3300044658 | Ga0466972_0010313 | Ga0466972_0010313_186_545 | 113 |
| 14 | 3300044683 | Ga0466965_0174426 | Ga0466965_0174426_622_981 | 113 |
| 15 | 3300044684 | Ga0466966_0380555 | Ga0466966_0380555_186_548 | 113 |
| 16 | 3300049584 | Ga0501068_0200445 | Ga0501068_0200445_96_455 | 113 |
| 17 | 3300005327 | Ga0070658_10139931 | Ga0070658_101399314 | 115 |
| 18 | 3300009545 | Ga0105237_10000003 | Ga0105237_1000000386 | 115 |
| 19 | 3300013102 | Ga0157371_10183963 | Ga0157371_101839634 | 115 |
| 20 | 3300013105 | Ga0157369_11297640 | Ga0157369_112976402 | 115 |
| 21 | 3300025914 | Ga0207671_10000012 | Ga0207671_10000012418 | 115 |
| 22 | 3300037471 | Ga0395905_0001385 | Ga0395905_0001385_1098_1451 | 115 |
| 23 | 3300049571 | Ga0501034_0011194 | Ga0501034_0011194_1827_2174 | 115 |
| 24 | iso_pu_bacteria | 2847670302 | 2847670805 | 116 |
| 25 | iso_pu_bacteria | 2856314179 | 2856316262 | 116 |
| 26 | iso_pu_bacteria | 2878035449 | 2878041585 | 116 |
| 27 | iso_pu_bacteria | 2906414383 | 2906416399 | 116 |
| 28 | 3300005334 | Ga0068869_101376950 | Ga0068869_1013769501 | 117 |
| 29 | 3300005353 | Ga0070669_101092546 | Ga0070669_1010925462 | 117 |
| 30 | 3300005434 | Ga0070709_10056112 | Ga0070709_100561125 | 117 |
| 31 | 3300005535 | Ga0070684_100848751 | Ga0070684_1008487511 | 117 |
| 32 | 3300005563 | Ga0068855_100171548 | Ga0068855_1001715482 | 117 |
| 33 | 3300005564 | Ga0070664_100124723 | Ga0070664_1001247233 | 117 |
| 34 | 3300005564 | Ga0070664_100492977 | Ga0070664_1004929772 | 117 |
| 35 | 3300005577 | Ga0068857_100041137 | Ga0068857_1000411373 | 117 |
| 36 | 3300005614 | Ga0068856_100271816 | Ga0068856_1002718161 | 117 |
| 37 | 3300005614 | Ga0068856_100504013 | Ga0068856_1005040132 | 117 |
| 38 | 3300005618 | Ga0068864_100016326 | Ga0068864_10001632610 | 117 |
| 39 | 3300005841 | Ga0068863_100012964 | Ga0068863_1000129644 | 117 |
| 40 | 3300005842 | Ga0068858_100644031 | Ga0068858_1006440312 | 117 |
| 41 | 3300005843 | Ga0068860_100368151 | Ga0068860_1003681512 | 117 |
| 42 | 3300005983 | Ga0081540_1059980 | Ga0081540_10599802 | 117 |
| 43 | 3300006173 | Ga0070716_101383049 | Ga0070716_1013830491 | 117 |
| 44 | 3300006844 | Ga0075428_100661488 | Ga0075428_1006614882 | 117 |
| 45 | 3300006880 | Ga0075429_100978155 | Ga0075429_1009781552 | 117 |
| 46 | 3300009092 | Ga0105250_10177662 | Ga0105250_101776622 | 117 |
| 47 | 3300009098 | Ga0105245_12239895 | Ga0105245_122398951 | 117 |
| 48 | 3300009101 | Ga0105247_10000016 | Ga0105247_10000016212 | 117 |
| 49 | 3300009147 | Ga0114129_10698501 | Ga0114129_106985013 | 117 |
| 50 | 3300009148 | Ga0105243_10138987 | Ga0105243_101389872 | 117 |
| 51 | 3300009148 | Ga0105243_12690228 | Ga0105243_126902282 | 117 |
| 52 | 3300009177 | Ga0105248_10002899 | Ga0105248_1000289916 | 117 |
| 53 | 3300009177 | Ga0105248_10112831 | Ga0105248_101128312 | 117 |
| 54 | 3300009551 | Ga0105238_11048753 | Ga0105238_110487532 | 117 |
| 55 | 3300013104 | Ga0157370_10773485 | Ga0157370_107734852 | 117 |
| 56 | 3300013307 | Ga0157372_11708209 | Ga0157372_117082092 | 117 |
| 57 | 3300013308 | Ga0157375_11008612 | Ga0157375_110086122 | 117 |
| 58 | 3300013308 | Ga0157375_11621328 | Ga0157375_116213282 | 117 |
| 59 | 3300014325 | Ga0163163_10014125 | Ga0163163_1001412512 | 117 |
| 60 | 3300014325 | Ga0163163_10024877 | Ga0163163_100248776 | 117 |
| 61 | 3300014325 | Ga0163163_10503104 | Ga0163163_105031042 | 117 |
| 62 | 3300014326 | Ga0157380_12950586 | Ga0157380_129505861 | 117 |
| 63 | 3300014968 | Ga0157379_10011242 | Ga0157379_100112427 | 117 |
| 64 | 3300014968 | Ga0157379_10358647 | Ga0157379_103586472 | 117 |
| 65 | 3300014969 | Ga0157376_11125448 | Ga0157376_111254482 | 117 |
| 66 | 3300017792 | Ga0163161_11862488 | Ga0163161_118624882 | 117 |
| 67 | 3300020078 | Ga0206352_11149454 | Ga0206352_111494542 | 117 |
| 68 | 3300020081 | Ga0206354_11586477 | Ga0206354_115864772 | 117 |
| 69 | 3300025735 | Ga0207713_1059869 | Ga0207713_10598693 | 117 |
| 70 | 3300025735 | Ga0207713_1157861 | Ga0207713_11578611 | 117 |
| 71 | 3300025900 | Ga0207710_10000017 | Ga0207710_10000017121 | 117 |
| 72 | 3300025905 | Ga0207685_10270979 | Ga0207685_102709792 | 117 |
| 73 | 3300025915 | Ga0207693_10028753 | Ga0207693_100287537 | 117 |
| 74 | 3300025923 | Ga0207681_11003255 | Ga0207681_110032552 | 117 |
| 75 | 3300025929 | Ga0207664_12013393 | Ga0207664_120133932 | 117 |
| 76 | 3300025941 | Ga0207711_10002995 | Ga0207711_1000299516 | 117 |
| 77 | 3300025941 | Ga0207711_10174131 | Ga0207711_101741313 | 117 |
| 78 | 3300025945 | Ga0207679_10423993 | Ga0207679_104239933 | 117 |
| 79 | 3300025949 | Ga0207667_10279576 | Ga0207667_102795762 | 117 |
| 80 | 3300026078 | Ga0207702_11216144 | Ga0207702_112161442 | 117 |
| 81 | 3300026088 | Ga0207641_10066082 | Ga0207641_100660825 | 117 |
| 82 | 3300026095 | Ga0207676_10009618 | Ga0207676_100096184 | 117 |
| 83 | 3300028381 | Ga0268264_11524190 | Ga0268264_115241902 | 117 |
| 84 | 3300031456 | Ga0307513_10178802 | Ga0307513_101788022 | 117 |
| 85 | 3300035121 | Ga0373960_0064482 | Ga0373960_0064482_47_436 | 117 |
| 86 | 3300035170 | Ga0373943_0118955 | Ga0373943_0118955_671_1060 | 117 |
| 87 | 3300035171 | Ga0373946_0417694 | Ga0373946_0417694_250_639 | 117 |
| 88 | 3300035692 | Ga0373935_0316510 | Ga0373935_0316510_549_938 | 117 |
| 89 | 3300035725 | Ga0373947_0427968 | Ga0373947_0427968_119_508 | 117 |
| 90 | 3300037068 | Ga0373925_0475224 | Ga0373925_0475224_514_903 | 117 |
| 91 | 3300042138 | Ga0450903_015214 | Ga0450903_015214_142_531 | 117 |
| 92 | 3300044658 | Ga0466972_0187295 | Ga0466972_0187295_33_416 | 117 |
| 93 | 3300044683 | Ga0466965_0207552 | Ga0466965_0207552_121_489 | 117 |
| 94 | 3300044842 | Ga0466957_0256491 | Ga0466957_0256491_611_1006 | 117 |
| 95 | 3300046459 | Ga0495629_0037443 | Ga0495629_0037443_704_1093 | 117 |
| 96 | 3300046472 | Ga0495580_0185497 | Ga0495580_0185497_181_570 | 117 |
| 97 | 3300046473 | Ga0495582_0440911 | Ga0495582_0440911_211_600 | 117 |
| 98 | 3300046476 | Ga0495662_0202236 | Ga0495662_0202236_402_791 | 117 |
| 99 | 3300046559 | Ga0495667_0472225 | Ga0495667_0472225_183_572 | 117 |
| 100 | 3300046674 | Ga0495588_0123699 | Ga0495588_0123699_538_927 | 117 |
| 101 | 3300046679 | Ga0495623_0217470 | Ga0495623_0217470_94_477 | 117 |
| 102 | 3300046809 | Ga0495600_0507692 | Ga0495600_0507692_38_421 | 117 |
| 103 | 3300047317 | Ga0495604_0004624 | Ga0495604_0004624_1294_1677 | 117 |
| 104 | 3300047444 | Ga0495675_0001497 | Ga0495675_0001497_13127_13510 | 117 |
| 105 | 3300047447 | Ga0495685_048595 | Ga0495685_048595_216_599 | 117 |
| 106 | 3300048903 | Ga0496100_0773698 | Ga0496100_0773698_200_568 | 117 |
| 107 | 3300048905 | Ga0496102_0977101 | Ga0496102_0977101_59_427 | 117 |
| 108 | 3300048907 | Ga0496104_0010095 | Ga0496104_0010095_5609_5998 | 117 |
| 109 | 3300048907 | Ga0496104_0628488 | Ga0496104_0628488_507_875 | 117 |
| 110 | 3300048908 | Ga0496105_0079160 | Ga0496105_0079160_682_1071 | 117 |
| 111 | 3300048908 | Ga0496105_0140977 | Ga0496105_0140977_1485_1853 | 117 |
| 112 | 3300048910 | Ga0496107_0124435 | Ga0496107_0124435_836_1210 | 117 |
| 113 | 3300048911 | Ga0496108_1180614 | Ga0496108_1180614_17_385 | 117 |
| 114 | 3300048912 | Ga0496109_0062528 | Ga0496109_0062528_817_1206 | 117 |
| 115 | 3300048912 | Ga0496109_1302403 | Ga0496109_1302403_59_427 | 117 |
| 116 | 3300048913 | Ga0496110_0130962 | Ga0496110_0130962_1607_1975 | 117 |
| 117 | 3300048914 | Ga0496111_0032303 | Ga0496111_0032303_2762_3151 | 117 |
| 118 | 3300048915 | Ga0496112_0406651 | Ga0496112_0406651_95_484 | 117 |
| 119 | 3300048915 | Ga0496112_0736853 | Ga0496112_0736853_440_808 | 117 |
| 120 | 3300048916 | Ga0496113_0032935 | Ga0496113_0032935_2736_3125 | 117 |
| 121 | 3300048916 | Ga0496113_0883402 | Ga0496113_0883402_103_486 | 117 |
| 122 | 3300048918 | Ga0496115_0026793 | Ga0496115_0026793_4112_4480 | 117 |
| 123 | 3300048922 | Ga0496119_0000855 | Ga0496119_0000855_32372_32746 | 117 |
| 124 | 3300048923 | Ga0496120_0000372 | Ga0496120_0000372_62813_63187 | 117 |
| 125 | 3300048929 | Ga0496126_0039353 | Ga0496126_0039353_582_971 | 117 |
| 126 | 3300048929 | Ga0496126_0732688 | Ga0496126_0732688_272_640 | 117 |
| 127 | 3300049127 | Ga0501306_001320 | Ga0501306_001320_259_642 | 117 |
| 128 | 3300049129 | Ga0501309_003792 | Ga0501309_003792_56_439 | 117 |
| 129 | 3300049130 | Ga0501310_000922 | Ga0501310_000922_2187_2570 | 117 |
| 130 | 3300049161 | Ga0501305_000256 | Ga0501305_000256_3547_3930 | 117 |
| 131 | 3300049527 | Ga0501311_001796 | Ga0501311_001796_1193_1576 | 117 |
| 132 | 3300049528 | Ga0501312_003927 | Ga0501312_003927_1314_1697 | 117 |
| 133 | 3300049529 | Ga0501313_000154 | Ga0501313_000154_3248_3631 | 117 |
| 134 | 3300049531 | Ga0501315_000662 | Ga0501315_000662_56_439 | 117 |
| 135 | 3300049532 | Ga0501316_000124 | Ga0501316_000124_3358_3741 | 117 |
| 136 | 3300049533 | Ga0501317_002440 | Ga0501317_002440_56_439 | 117 |
| 137 | 3300049534 | Ga0501318_000228 | Ga0501318_000228_2067_2450 | 117 |
| 138 | 3300049535 | Ga0501319_000081 | Ga0501319_000081_2859_3242 | 117 |
| 139 | 3300049536 | Ga0501320_001410 | Ga0501320_001410_36_419 | 117 |
| 140 | 3300049539 | Ga0501323_000010 | Ga0501323_000010_337_720 | 117 |
| 141 | 3300049540 | Ga0501324_000009 | Ga0501324_000009_3412_3795 | 117 |
| 142 | 3300049541 | Ga0501325_000039 | Ga0501325_000039_3420_3803 | 117 |
| 143 | 3300049545 | Ga0501329_00260 | Ga0501329_00260_1248_1631 | 117 |
| 144 | 3300049568 | Ga0501031_0058599 | Ga0501031_0058599_442_837 | 117 |
| 145 | 3300049569 | Ga0501032_0043434 | Ga0501032_0043434_1648_2043 | 117 |
| 146 | 3300049571 | Ga0501034_0909170 | Ga0501034_0909170_174_542 | 117 |
| 147 | 3300049572 | Ga0501036_0046642 | Ga0501036_0046642_1663_2058 | 117 |
| 148 | 3300049573 | Ga0501037_0015377 | Ga0501037_0015377_2071_2466 | 117 |
| 149 | 3300049574 | Ga0501038_0003477 | Ga0501038_0003477_2077_2472 | 117 |
| 150 | 3300049575 | Ga0501039_0020664 | Ga0501039_0020664_1696_2091 | 117 |
| 151 | 3300049576 | Ga0501040_1000834 | Ga0501040_1000834_21_410 | 117 |
| 152 | 3300049579 | Ga0501043_0290793 | Ga0501043_0290793_568_963 | 117 |
| 153 | 3300049580 | Ga0501046_0055803 | Ga0501046_0055803_900_1295 | 117 |
| 154 | 3300049581 | Ga0501047_0053457 | Ga0501047_0053457_3429_3824 | 117 |
| 155 | 3300049584 | Ga0501068_0074370 | Ga0501068_0074370_967_1356 | 117 |
| 156 | 3300049585 | Ga0501069_0034576 | Ga0501069_0034576_331_726 | 117 |
| 157 | 3300049586 | Ga0501070_0211446 | Ga0501070_0211446_45_440 | 117 |
| 158 | 3300049586 | Ga0501070_0348483 | Ga0501070_0348483_200_568 | 117 |
| 159 | 3300049590 | Ga0501074_0018515 | Ga0501074_0018515_2085_2480 | 117 |
| 160 | 3300049742 | Ga0501080_0025709 | Ga0501080_0025709_390_785 | 117 |
| 161 | 3300049822 | Ga0501035_0137730 | Ga0501035_0137730_82_477 | 117 |
| 162 | 3300049824 | Ga0501045_0342194 | Ga0501045_0342194_287_682 | 117 |
| 163 | 3300050507 | nmdc:mga05p37_1126392_c1 | nmdc:mga05p37_1126392_c1_376_765 | 117 |
| 164 | 3300050508 | nmdc:mga09592_122892_c1 | nmdc:mga09592_122892_c1_921_1310 | 117 |
| 165 | 3300059490 | Ga0587066_101290 | Ga0587066_101290_246_635 | 117 |
| 166 | 3300059506 | Ga0587085_128667 | Ga0587085_128667_158_547 | 117 |
| 167 | 3300059642 | Ga0587069_080355 | Ga0587069_080355_226_615 | 117 |
| 168 | iso_pu_bacteria | 2501939600 | 2501945897 | 117 |
| 169 | iso_pu_bacteria | 2515154088 | 2515496684 | 117 |
| 170 | iso_pu_bacteria | 2515154137 | 2515756923 | 117 |
| 171 | iso_pu_bacteria | 2515154203 | 2516089461 | 117 |
| 172 | iso_pu_bacteria | 2643221601 | 2644014439 | 117 |
| 173 | iso_pu_bacteria | 2643221631 | 2644175876 | 117 |
| 174 | iso_pu_bacteria | 2675903059 | 2676480137 | 117 |
| 175 | iso_pu_bacteria | 2772190715 | 2772644897 | 117 |
| 176 | iso_pu_bacteria | 2818991472 | 2819742272 | 117 |
| 177 | iso_pu_bacteria | 2831935698 | 2831941109 | 117 |
| 178 | iso_pu_bacteria | 2832004796 | 2832006200 | 117 |
| 179 | iso_pu_bacteria | 2855670206 | 2855673786 | 117 |
| 180 | iso_pu_bacteria | 2855676851 | 2855681684 | 117 |
| 181 | iso_pu_bacteria | 2855683550 | 2855684525 | 117 |
| 182 | iso_pu_bacteria | 2856858025 | 2856858860 | 117 |
| 183 | iso_pu_bacteria | 2857288857 | 2857290711 | 117 |
| 184 | iso_pu_bacteria | 2858848962 | 2858850649 | 117 |
| 185 | iso_pu_bacteria | 2858868258 | 2858875143 | 117 |
| 186 | iso_pu_bacteria | 2858882152 | 2858888054 | 117 |
| 187 | iso_pu_bacteria | 2858888857 | 2858890984 | 117 |
| 188 | iso_pu_bacteria | 2858895516 | 2858897637 | 117 |
| 189 | iso_pu_bacteria | 2858902515 | 2858902943 | 117 |
| 190 | iso_pu_bacteria | 2866065130 | 2866068637 | 117 |
| 191 | iso_pu_bacteria | 2867507094 | 2867510885 | 117 |
| 192 | iso_pu_bacteria | 2869048445 | 2869050053 | 117 |
| 193 | iso_pu_bacteria | 2869061728 | 2869063907 | 117 |
| 194 | iso_pu_bacteria | 2869068681 | 2869071861 | 117 |
| 195 | iso_pu_bacteria | 2880489317 | 2880495233 | 117 |
| 196 | iso_pu_bacteria | 2880495981 | 2880497112 | 117 |
| 197 | iso_pu_bacteria | 2902582711 | 2902583747 | 117 |
| 198 | iso_pu_bacteria | 2929219909 | 2929225711 | 117 |
| 199 | iso_pu_bacteria | 2929226422 | 2929231312 | 117 |
| 200 | iso_pu_bacteria | 2996221748 | 2996223716 | 117 |
| 201 | iso_pu_bacteria | 649633069 | 649810768 | 117 |
| 202 | iso_pu_bacteria | 8003830390 | 8003835111 | 117 |
| 203 | iso_pu_bacteria | 8003856774 | 8003862020 | 117 |
| 204 | iso_pu_bacteria | 8003870546 | 8003872930 | 117 |
| 205 | iso_pu_bacteria | 8054704163 | 8054706701 | 117 |
| 206 | iso_pu_bacteria | 8054727385 | 8054733692 | 117 |
| 207 | iso_pu_bacteria | 8054734606 | 8054740748 | 117 |
| 208 | iso_pu_bacteria | 8055412473 | 8055412836 | 117 |
| 209 | iso_pu_bacteria | 8056207758 | 8056208353 | 117 |
| 210 | 3300009545 | Ga0105237_10214328 | Ga0105237_102143283 | 118 |
| 211 | 3300025914 | Ga0207671_10252251 | Ga0207671_102522511 | 118 |
| 212 | 3300031090 | Ga0265760_10000904 | Ga0265760_100009044 | 118 |
| 213 | 3300049588 | Ga0501072_0656964 | Ga0501072_0656964_292_648 | 118 |
| 214 | 3300054114 | Ga0501084_1856266 | Ga0501084_1856266_45_401 | 118 |
| 215 | 3300005327 | Ga0070658_10318058 | Ga0070658_103180581 | 119 |
| 216 | 3300005435 | Ga0070714_100194472 | Ga0070714_1001944723 | 119 |
| 217 | 3300005439 | Ga0070711_100452535 | Ga0070711_1004525352 | 119 |
| 218 | 3300005563 | Ga0068855_100791909 | Ga0068855_1007919092 | 119 |
| 219 | 3300006237 | Ga0097621_101309293 | Ga0097621_1013092931 | 119 |
| 220 | 3300009174 | Ga0105241_12606965 | Ga0105241_126069652 | 119 |
| 221 | 3300010375 | Ga0105239_11727489 | Ga0105239_117274892 | 119 |
| 222 | 3300013105 | Ga0157369_10615805 | Ga0157369_106158051 | 119 |
| 223 | 3300020078 | Ga0206352_10506297 | Ga0206352_105062972 | 119 |
| 224 | 3300021358 | Ga0213873_10225366 | Ga0213873_102253662 | 119 |
| 225 | 3300021361 | Ga0213872_10332296 | Ga0213872_103322962 | 119 |
| 226 | 3300021384 | Ga0213876_10516546 | Ga0213876_105165462 | 119 |
| 227 | 3300021441 | Ga0213871_10053880 | Ga0213871_100538802 | 119 |
| 228 | 3300021441 | Ga0213871_10055761 | Ga0213871_100557612 | 119 |
| 229 | 3300024227 | Ga0228598_1019191 | Ga0228598_10191912 | 119 |
| 230 | 3300025929 | Ga0207664_10169646 | Ga0207664_101696463 | 119 |
| 231 | 3300028017 | Ga0265356_1000525 | Ga0265356_10005259 | 119 |
| 232 | 3300030763 | Ga0265763_1012663 | Ga0265763_10126631 | 119 |
| 233 | 3300030878 | Ga0265770_1062228 | Ga0265770_10622282 | 119 |
| 234 | 3300031090 | Ga0265760_10048447 | Ga0265760_100484472 | 119 |
| 235 | 3300037471 | Ga0395905_0025380 | Ga0395905_0025380_4723_5082 | 119 |
| 236 | 3300037471 | Ga0395905_1116486 | Ga0395905_1116486_89_448 | 119 |
| 237 | 3300037853 | Ga0436364_0334344 | Ga0436364_0334344_90_455 | 119 |
| 238 | 3300039062 | Ga0400483_122812 | Ga0400483_122812_924_1295 | 119 |
| 239 | 3300039062 | Ga0400483_197183 | Ga0400483_197183_654_1025 | 119 |
| 240 | 3300039437 | Ga0436365_0419155 | Ga0436365_0419155_65_430 | 119 |
| 241 | 3300039437 | Ga0436365_1589909 | Ga0436365_1589909_109_471 | 119 |
| 242 | 3300039438 | Ga0436360_0103681 | Ga0436360_0103681_48_410 | 119 |
| 243 | 3300039438 | Ga0436360_1218238 | Ga0436360_1218238_4695_5057 | 119 |
| 244 | 3300039447 | Ga0436361_0424973 | Ga0436361_0424973_58_420 | 119 |
| 245 | 3300039450 | Ga0436363_0791505 | Ga0436363_0791505_271_633 | 119 |
| 246 | 3300039453 | Ga0436362_0009697 | Ga0436362_0009697_412_774 | 119 |
| 247 | 3300039453 | Ga0436362_0997060 | Ga0436362_0997060_1818_2180 | 119 |
| 248 | 3300039453 | Ga0436362_1199268 | Ga0436362_1199268_130_495 | 119 |
| 249 | 3300048914 | Ga0496111_1120011 | Ga0496111_1120011_165_524 | 119 |
| 250 | 3300049588 | Ga0501072_0509969 | Ga0501072_0509969_249_617 | 119 |
| 251 | 3300049741 | Ga0501079_0855961 | Ga0501079_0855961_210_578 | 119 |
| 252 | 3300059504 | Ga0587082_002486 | Ga0587082_002486_141_500 | 119 |
| 253 | 3300059641 | Ga0587068_161911 | Ga0587068_161911_22_381 | 119 |
| 254 | 3300059643 | Ga0587072_045745 | Ga0587072_045745_273_632 | 119 |
| 255 | 3300060346 | Ga0587111_0000226 | Ga0587111_0000226_1667_2026 | 119 |
| 256 | 3300002067 | JGI24735J21928_10008865 | JGI24735J21928_100088657 | 120 |
| 257 | 3300060353 | Ga0501082_0613370 | Ga0501082_0613370_123_485 | 120 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ily-assembly1.cif.gz_A | solution structure of ribosomal protein l18 of thermus thermophilus | 0.9112 | 26 | 120 |
| 1ily-assembly1.cif.gz_A | solution structure of ribosomal protein l18 of thermus thermophilus | 0.9019 | 26 | 120 |
| 4woi-assembly2.cif.gz_CO | 4,5-linked aminoglycoside antibiotics regulate the bacterial ribosome by targeting dynamic conformational processes within intersubunit bridge b2 | 0.8949 | 14 | 120 |
| 5x8t-assembly1.cif.gz_P | structure of the 50s large subunit of chloroplast ribosome from spinach | 0.8938 | 23 | 120 |
| 6gaw-assembly1.cif.gz_BS | unique features of mammalian mitochondrial translation initiation revealed by cryo-em. this file contains the complete 55s ribosome. | 0.893 | 27 | 118 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5xymO01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.9699 | 26 | 120 | 3.30.420.100 |
| af_A0A0R0LFW1_76_177_3.30.420.100 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.9611 | 27 | 105 | 3.30.420.100 |
| af_B6SLT9_8_113_3.30.420.100 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.9517 | 27 | 120 | 3.30.420.100 |
| af_Q9LJA1_150_297_3.30.420.80 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 | 0.9513 | 27 | 119 | 3.30.420.80 |
| 6ddga01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; | 0.9477 | 28 | 120 | 3.30.420.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D3KKB6-F1-model_v4 | Large ribosomal subunit protein uL18 (50S ribosomal protein L18) | 0.9939 | 26 | 120 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
| AF-X0TWH5-F1-model_v4 | 50S ribosomal protein L18 | 0.9867 | 32 | 120 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
| AF-A0A7X7F021-F1-model_v4 | Large ribosomal subunit protein uL18 (50S ribosomal protein L18) | 0.9852 | 33 | 119 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
| AF-B4VPM1-F1-model_v4 | Large ribosomal subunit protein uL18 (50S ribosomal protein L18) | 0.9846 | 41 | 120 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
| AF-A0A3G2QZJ3-F1-model_v4 | Large ribosomal subunit protein uL18c | 0.9823 | 26 | 120 |
GO:0003735
GO:0005840 GO:0006412 GO:0008097 GO:0009536 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar