F367513

General Info

Members Datasets Scaffolds Average Seq Length
257 214 211 124

Family's Representative Sequence

Representative Sequence 3300044842|Ga0466957_0256491|Ga0466957_0256491_611_1006
Length 131
Sequence MPATLVNRNSARGGAAARRISRDRRHYRVRKHVAGTAERPRLVVTRSLRHIYAQVIDDSKGHTLASASTLDAALRSAEGDKSAQAREVGKLVAERAKAAGISAVVFDRGGNAYHGRVAALADAARAGGLEF

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
3 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
4 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
5 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
6 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
7 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
8 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
9 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
10 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
11 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
12 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
13 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
14 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
15 2855683550 Micromonospora sp. RP3T Isolate Unclassified
16 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
17 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
18 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
19 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
20 2858868258 Micromonospora sp. MH33 Isolate Unclassified
21 2858882152 Micromonospora noduli MED15 Isolate Nodule
22 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
23 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
24 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
25 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
26 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
27 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
28 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
29 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
30 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
31 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
32 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
33 2902582711 Micromonospora sp. AP08 Isolate Unclassified
34 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
35 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
36 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
37 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
38 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
82 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
85 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
87 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
109 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
110 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
111 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
112 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
118 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
121 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
122 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
123 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
124 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
125 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
126 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
127 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
132 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
133 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
136 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
137 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
138 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
139 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
140 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
141 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
154 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
155 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
156 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
157 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
197 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
206 649633069 Micromonospora sp. L5 Isolate Unclassified
207 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
208 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
209 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
210 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
211 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
212 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
213 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
214 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 69.26
Metatranscriptomes 12.84
Isolates 17.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 3.89
Rhizoplane 7
Rhizosphere 73.54
Stem 0
Stem Tuber 0
Unclassified 15.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10008865 3300002067 Bacteria 3244
2 Ga0070658_10139931 3300005327 Bacteria 2021
3 Ga0070658_10318058 3300005327 Bacteria 1329
4 Ga0068869_101376950 3300005334 Bacteria 624
5 Ga0070669_101092546 3300005353 Bacteria 687
6 Ga0070709_10056112 3300005434 Bacteria 2490
7 Ga0070714_100194472 3300005435 Bacteria 1853
8 Ga0070711_100452535 3300005439 Bacteria 1051
9 Ga0070684_100848751 3300005535 Bacteria 855
10 Ga0068855_100171548 3300005563 Bacteria 2456
11 Ga0068855_100791909 3300005563 Bacteria 1008
12 Ga0070664_100124723 3300005564 Bacteria 2258
13 Ga0070664_100492977 3300005564 Bacteria 1129
14 Ga0068857_100041137 3300005577 Bacteria 4099
15 Ga0068856_100271816 3300005614 Bacteria 1711
16 Ga0068856_100504013 3300005614 Bacteria 1231
17 Ga0068864_100016326 3300005618 Bacteria 6181
18 Ga0068863_100012964 3300005841 Bacteria 8037
19 Ga0068858_100644031 3300005842 Bacteria 1030
20 Ga0068860_100368151 3300005843 Bacteria 1417
21 Ga0081540_1059980 3300005983 Bacteria 1823
22 Ga0070716_101383049 3300006173 Bacteria 572
23 Ga0097621_101309293 3300006237 Bacteria 684
24 Ga0075428_100661488 3300006844 Bacteria 1114
25 Ga0075429_100978155 3300006880 Bacteria 740
26 Ga0105250_10177662 3300009092 Bacteria 892
27 Ga0105245_12239895 3300009098 Bacteria 600
28 Ga0105247_10000016 3300009101 Bacteria 263389
29 Ga0114129_10698501 3300009147 Bacteria 1304
30 Ga0105243_10138987 3300009148 Bacteria 2070
31 Ga0105243_10543924 3300009148 Bacteria 1108
32 Ga0105243_12690228 3300009148 Bacteria 538
33 Ga0105241_12606965 3300009174 Bacteria 508
34 Ga0105248_10002899 3300009177 Bacteria 19028
35 Ga0105248_10112831 3300009177 Bacteria 3066
36 Ga0105237_10000003 3300009545 Bacteria 556908
37 Ga0105237_10214328 3300009545 Bacteria 1925
38 Ga0105238_11048753 3300009551 Bacteria 837
39 Ga0105239_11727489 3300010375 Bacteria 725
40 Ga0157371_10183963 3300013102 Bacteria 1495
41 Ga0157370_10773485 3300013104 Bacteria 874
42 Ga0157369_10615805 3300013105 Bacteria 1120
43 Ga0157369_11297640 3300013105 Bacteria 742
44 Ga0157372_11708209 3300013307 Bacteria 724
45 Ga0157375_11008612 3300013308 Bacteria 972
46 Ga0157375_11621328 3300013308 Bacteria 765
47 Ga0163163_10014125 3300014325 Bacteria 7333
48 Ga0163163_10024877 3300014325 Bacteria 5701
49 Ga0163163_10503104 3300014325 Bacteria 1273
50 Ga0157380_12950586 3300014326 Bacteria 542
51 Ga0157379_10011242 3300014968 Bacteria 7798
52 Ga0157379_10358647 3300014968 Bacteria 1336
53 Ga0157376_11125448 3300014969 Bacteria 811
54 Ga0163161_11862488 3300017792 Bacteria 535
55 Ga0206352_10506297 3300020078 Bacteria 593
56 Ga0206352_11149454 3300020078 Bacteria 979
57 Ga0206354_11586477 3300020081 Bacteria 949
58 Ga0213873_10225366 3300021358 Bacteria 588
59 Ga0213872_10332296 3300021361 Bacteria 626
60 Ga0213876_10516546 3300021384 Bacteria 636
61 Ga0213871_10053880 3300021441 Bacteria 1108
62 Ga0213871_10055761 3300021441 Bacteria 1092
63 Ga0224712_10531906 3300022467 Bacteria 570
64 Ga0228598_1019191 3300024227 Bacteria 1348
65 Ga0207713_1059869 3300025735 Bacteria 1459
66 Ga0207713_1157861 3300025735 Bacteria 726
67 Ga0207710_10000017 3300025900 Bacteria 370962
68 Ga0207685_10270979 3300025905 Bacteria 829
69 Ga0207671_10000012 3300025914 Bacteria 519494
70 Ga0207671_10252251 3300025914 Bacteria 1387
71 Ga0207693_10028753 3300025915 Bacteria 4393
72 Ga0207681_11003255 3300025923 Bacteria 700
73 Ga0207664_10169646 3300025929 Bacteria 1867
74 Ga0207664_12013393 3300025929 Bacteria 501
75 Ga0207665_11181573 3300025939 Bacteria 610
76 Ga0207711_10002995 3300025941 Bacteria 14760
77 Ga0207711_10174131 3300025941 Bacteria 1954
78 Ga0207679_10423993 3300025945 Bacteria 1175
79 Ga0207667_10279576 3300025949 Bacteria 1706
80 Ga0207702_11216144 3300026078 Bacteria 747
81 Ga0207641_10066082 3300026088 Bacteria 3095
82 Ga0207676_10009618 3300026095 Bacteria 6880
83 Ga0265356_1000525 3300028017 Bacteria 6878
84 Ga0268264_11524190 3300028381 Bacteria 679
85 Ga0265326_10033682 3300028558 Bacteria 1458
86 Ga0265338_10001848 3300028800 Bacteria 33242
87 Ga0265763_1012663 3300030763 Bacteria 808
88 Ga0265770_1062228 3300030878 Bacteria 696
89 Ga0265760_10000904 3300031090 Bacteria 8569
90 Ga0265760_10048447 3300031090 Bacteria 1276
91 Ga0265320_10122167 3300031240 Bacteria 1187
92 Ga0307513_10178802 3300031456 Bacteria 1987
93 Ga0373960_0064482 3300035121 Bacteria 1119
94 Ga0373943_0118955 3300035170 Bacteria 1402
95 Ga0373946_0417694 3300035171 Bacteria 679
96 Ga0373935_0316510 3300035692 Bacteria 1106
97 Ga0373947_0427968 3300035725 Bacteria 895
98 Ga0373925_0475224 3300037068 Bacteria 1025
99 Ga0395905_0001385 3300037471 Bacteria 29377
100 Ga0395905_0025380 3300037471 Bacteria 5589
101 Ga0395905_0074891 3300037471 Bacteria 3173
102 Ga0395905_0212637 3300037471 Bacteria 1811
103 Ga0395905_1116486 3300037471 Bacteria 692
104 Ga0436364_0334344 3300037853 Unclassified 1370
105 Ga0400483_122812 3300039062 Bacteria 1939
106 Ga0400483_197183 3300039062 Bacteria 2002
107 Ga0436365_0419155 3300039437 Unclassified 522
108 Ga0436365_1589909 3300039437 Bacteria 826
109 Ga0436360_0103681 3300039438 Bacteria 920
110 Ga0436360_1218238 3300039438 Bacteria 8853
111 Ga0436361_0424973 3300039447 Bacteria 663
112 Ga0436363_0791505 3300039450 Bacteria 887
113 Ga0436362_0009697 3300039453 Bacteria 1284
114 Ga0436362_0997060 3300039453 Bacteria 3403
115 Ga0436362_1199268 3300039453 Bacteria 838
116 Ga0450903_015214 3300042138 Bacteria 1213
117 Ga0466972_0010313 3300044658 Bacteria 4691
118 Ga0466972_0187295 3300044658 Bacteria 970
119 Ga0466965_0174426 3300044683 Bacteria 1132
120 Ga0466965_0207552 3300044683 Bacteria 1041
121 Ga0466966_0380555 3300044684 Bacteria 848
122 Ga0466957_0256491 3300044842 Bacteria 1164
123 Ga0495629_0037443 3300046459 Bacteria 3419
124 Ga0495580_0185497 3300046472 Bacteria 1436
125 Ga0495582_0440911 3300046473 Bacteria 752
126 Ga0495662_0202236 3300046476 Bacteria 979
127 Ga0495594_0359067 3300046499 Bacteria 829
128 Ga0495667_0472225 3300046559 Bacteria 787
129 Ga0495588_0123699 3300046674 Bacteria 1364
130 Ga0495623_0217470 3300046679 Bacteria 1090
131 Ga0495600_0507692 3300046809 Bacteria 740
132 Ga0495604_0004624 3300047317 Bacteria 10906
133 Ga0495675_0001497 3300047444 Bacteria 14149
134 Ga0495685_048595 3300047447 Bacteria 1442
135 Ga0496100_0773698 3300048903 Bacteria 751
136 Ga0496102_0977101 3300048905 Bacteria 767
137 Ga0496104_0010095 3300048907 Bacteria 8432
138 Ga0496104_0628488 3300048907 Bacteria 983
139 Ga0496105_0079160 3300048908 Bacteria 2714
140 Ga0496105_0140977 3300048908 Bacteria 1984
141 Ga0496107_0124435 3300048910 Bacteria 1901
142 Ga0496108_1180614 3300048911 Bacteria 648
143 Ga0496109_0062528 3300048912 Bacteria 3404
144 Ga0496109_1302403 3300048912 Bacteria 663
145 Ga0496110_0130962 3300048913 Bacteria 2265
146 Ga0496111_0032303 3300048914 Bacteria 3731
147 Ga0496111_1120011 3300048914 Bacteria 560
148 Ga0496112_0406651 3300048915 Bacteria 1300
149 Ga0496112_0736853 3300048915 Bacteria 912
150 Ga0496113_0032935 3300048916 Bacteria 3769
151 Ga0496113_0883402 3300048916 Bacteria 708
152 Ga0496115_0026793 3300048918 Bacteria 4503
153 Ga0496119_0000855 3300048922 Bacteria 40135
154 Ga0496120_0000372 3300048923 Bacteria 72951
155 Ga0496123_0091568 3300048926 Bacteria 1803
156 Ga0496126_0039353 3300048929 Bacteria 4388
157 Ga0496126_0732688 3300048929 Bacteria 765
158 Ga0501306_001320 3300049127 Bacteria 2296
159 Ga0501309_003792 3300049129 Bacteria 1733
160 Ga0501310_000922 3300049130 Bacteria 2620
161 Ga0501305_000256 3300049161 Bacteria 3988
162 Ga0501311_001796 3300049527 Bacteria 1948
163 Ga0501312_003927 3300049528 Bacteria 1724
164 Ga0501313_000154 3300049529 Bacteria 3688
165 Ga0501315_000662 3300049531 Bacteria 2525
166 Ga0501316_000124 3300049532 Bacteria 4009
167 Ga0501317_002440 3300049533 Bacteria 1758
168 Ga0501318_000228 3300049534 Bacteria 3100
169 Ga0501319_000081 3300049535 Bacteria 3300
170 Ga0501320_001410 3300049536 Bacteria 1761
171 Ga0501323_000010 3300049539 Bacteria 9499
172 Ga0501324_000009 3300049540 Bacteria 7379
173 Ga0501325_000039 3300049541 Bacteria 3825
174 Ga0501329_00260 3300049545 Bacteria 1662
175 Ga0501031_0058599 3300049568 Bacteria 2509
176 Ga0501032_0043434 3300049569 Bacteria 3044
177 Ga0501034_0011194 3300049571 Bacteria 9312
178 Ga0501034_0073278 3300049571 Bacteria 3433
179 Ga0501034_0909170 3300049571 Bacteria 768
180 Ga0501036_0046642 3300049572 Bacteria 3669
181 Ga0501037_0015377 3300049573 Bacteria 5631
182 Ga0501038_0003477 3300049574 Bacteria 14673
183 Ga0501039_0020664 3300049575 Bacteria 5045
184 Ga0501040_1000834 3300049576 Bacteria 606
185 Ga0501043_0290793 3300049579 Bacteria 1251
186 Ga0501046_0055803 3300049580 Bacteria 3102
187 Ga0501047_0053457 3300049581 Bacteria 3905
188 Ga0501068_0074370 3300049584 Bacteria 2077
189 Ga0501068_0200445 3300049584 Bacteria 1266
190 Ga0501069_0034576 3300049585 Bacteria 2783
191 Ga0501070_0211446 3300049586 Bacteria 1592
192 Ga0501070_0348483 3300049586 Bacteria 1202
193 Ga0501072_0509969 3300049588 Bacteria 951
194 Ga0501072_0656964 3300049588 Bacteria 825
195 Ga0501074_0018515 3300049590 Bacteria 5060
196 Ga0501079_0855961 3300049741 Bacteria 716
197 Ga0501080_0025709 3300049742 Bacteria 5468
198 Ga0501035_0137730 3300049822 Bacteria 2124
199 Ga0501045_0342194 3300049824 Bacteria 1113
200 nmdc:mga05p37_1126392_c1 3300050507 Bacteria 819
201 nmdc:mga09592_122892_c1 3300050508 Bacteria 2230
202 Ga0501084_1856266 3300054114 Bacteria 503
203 Ga0587066_101290 3300059490 Bacteria 655
204 Ga0587082_002486 3300059504 Bacteria 2086
205 Ga0587085_128667 3300059506 Bacteria 564
206 Ga0587090_091373 3300059510 Bacteria 624
207 Ga0587068_161911 3300059641 Bacteria 512
208 Ga0587069_080355 3300059642 Bacteria 635
209 Ga0587072_045745 3300059643 Unclassified 863
210 Ga0587111_0000226 3300060346 Bacteria 4610
211 Ga0501082_0613370 3300060353 Bacteria 952

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009148 Ga0105243_10543924 Ga0105243_105439242 92
2 3300048926 Ga0496123_0091568 Ga0496123_0091568_69_440 101
3 3300022467 Ga0224712_10531906 Ga0224712_105319062 104
4 3300037471 Ga0395905_0074891 Ga0395905_0074891_2002_2319 105
5 3300025939 Ga0207665_11181573 Ga0207665_111815731 109
6 3300046499 Ga0495594_0359067 Ga0495594_0359067_116_511 109
7 3300059510 Ga0587090_091373 Ga0587090_091373_54_443 109
8 3300049571 Ga0501034_0073278 Ga0501034_0073278_1249_1608 112
9 3300028558 Ga0265326_10033682 Ga0265326_100336824 113
10 3300028800 Ga0265338_10001848 Ga0265338_1000184811 113
11 3300031240 Ga0265320_10122167 Ga0265320_101221672 113
12 3300037471 Ga0395905_0212637 Ga0395905_0212637_720_1079 113
13 3300044658 Ga0466972_0010313 Ga0466972_0010313_186_545 113
14 3300044683 Ga0466965_0174426 Ga0466965_0174426_622_981 113
15 3300044684 Ga0466966_0380555 Ga0466966_0380555_186_548 113
16 3300049584 Ga0501068_0200445 Ga0501068_0200445_96_455 113
17 3300005327 Ga0070658_10139931 Ga0070658_101399314 115
18 3300009545 Ga0105237_10000003 Ga0105237_1000000386 115
19 3300013102 Ga0157371_10183963 Ga0157371_101839634 115
20 3300013105 Ga0157369_11297640 Ga0157369_112976402 115
21 3300025914 Ga0207671_10000012 Ga0207671_10000012418 115
22 3300037471 Ga0395905_0001385 Ga0395905_0001385_1098_1451 115
23 3300049571 Ga0501034_0011194 Ga0501034_0011194_1827_2174 115
24 iso_pu_bacteria 2847670302 2847670805 116
25 iso_pu_bacteria 2856314179 2856316262 116
26 iso_pu_bacteria 2878035449 2878041585 116
27 iso_pu_bacteria 2906414383 2906416399 116
28 3300005334 Ga0068869_101376950 Ga0068869_1013769501 117
29 3300005353 Ga0070669_101092546 Ga0070669_1010925462 117
30 3300005434 Ga0070709_10056112 Ga0070709_100561125 117
31 3300005535 Ga0070684_100848751 Ga0070684_1008487511 117
32 3300005563 Ga0068855_100171548 Ga0068855_1001715482 117
33 3300005564 Ga0070664_100124723 Ga0070664_1001247233 117
34 3300005564 Ga0070664_100492977 Ga0070664_1004929772 117
35 3300005577 Ga0068857_100041137 Ga0068857_1000411373 117
36 3300005614 Ga0068856_100271816 Ga0068856_1002718161 117
37 3300005614 Ga0068856_100504013 Ga0068856_1005040132 117
38 3300005618 Ga0068864_100016326 Ga0068864_10001632610 117
39 3300005841 Ga0068863_100012964 Ga0068863_1000129644 117
40 3300005842 Ga0068858_100644031 Ga0068858_1006440312 117
41 3300005843 Ga0068860_100368151 Ga0068860_1003681512 117
42 3300005983 Ga0081540_1059980 Ga0081540_10599802 117
43 3300006173 Ga0070716_101383049 Ga0070716_1013830491 117
44 3300006844 Ga0075428_100661488 Ga0075428_1006614882 117
45 3300006880 Ga0075429_100978155 Ga0075429_1009781552 117
46 3300009092 Ga0105250_10177662 Ga0105250_101776622 117
47 3300009098 Ga0105245_12239895 Ga0105245_122398951 117
48 3300009101 Ga0105247_10000016 Ga0105247_10000016212 117
49 3300009147 Ga0114129_10698501 Ga0114129_106985013 117
50 3300009148 Ga0105243_10138987 Ga0105243_101389872 117
51 3300009148 Ga0105243_12690228 Ga0105243_126902282 117
52 3300009177 Ga0105248_10002899 Ga0105248_1000289916 117
53 3300009177 Ga0105248_10112831 Ga0105248_101128312 117
54 3300009551 Ga0105238_11048753 Ga0105238_110487532 117
55 3300013104 Ga0157370_10773485 Ga0157370_107734852 117
56 3300013307 Ga0157372_11708209 Ga0157372_117082092 117
57 3300013308 Ga0157375_11008612 Ga0157375_110086122 117
58 3300013308 Ga0157375_11621328 Ga0157375_116213282 117
59 3300014325 Ga0163163_10014125 Ga0163163_1001412512 117
60 3300014325 Ga0163163_10024877 Ga0163163_100248776 117
61 3300014325 Ga0163163_10503104 Ga0163163_105031042 117
62 3300014326 Ga0157380_12950586 Ga0157380_129505861 117
63 3300014968 Ga0157379_10011242 Ga0157379_100112427 117
64 3300014968 Ga0157379_10358647 Ga0157379_103586472 117
65 3300014969 Ga0157376_11125448 Ga0157376_111254482 117
66 3300017792 Ga0163161_11862488 Ga0163161_118624882 117
67 3300020078 Ga0206352_11149454 Ga0206352_111494542 117
68 3300020081 Ga0206354_11586477 Ga0206354_115864772 117
69 3300025735 Ga0207713_1059869 Ga0207713_10598693 117
70 3300025735 Ga0207713_1157861 Ga0207713_11578611 117
71 3300025900 Ga0207710_10000017 Ga0207710_10000017121 117
72 3300025905 Ga0207685_10270979 Ga0207685_102709792 117
73 3300025915 Ga0207693_10028753 Ga0207693_100287537 117
74 3300025923 Ga0207681_11003255 Ga0207681_110032552 117
75 3300025929 Ga0207664_12013393 Ga0207664_120133932 117
76 3300025941 Ga0207711_10002995 Ga0207711_1000299516 117
77 3300025941 Ga0207711_10174131 Ga0207711_101741313 117
78 3300025945 Ga0207679_10423993 Ga0207679_104239933 117
79 3300025949 Ga0207667_10279576 Ga0207667_102795762 117
80 3300026078 Ga0207702_11216144 Ga0207702_112161442 117
81 3300026088 Ga0207641_10066082 Ga0207641_100660825 117
82 3300026095 Ga0207676_10009618 Ga0207676_100096184 117
83 3300028381 Ga0268264_11524190 Ga0268264_115241902 117
84 3300031456 Ga0307513_10178802 Ga0307513_101788022 117
85 3300035121 Ga0373960_0064482 Ga0373960_0064482_47_436 117
86 3300035170 Ga0373943_0118955 Ga0373943_0118955_671_1060 117
87 3300035171 Ga0373946_0417694 Ga0373946_0417694_250_639 117
88 3300035692 Ga0373935_0316510 Ga0373935_0316510_549_938 117
89 3300035725 Ga0373947_0427968 Ga0373947_0427968_119_508 117
90 3300037068 Ga0373925_0475224 Ga0373925_0475224_514_903 117
91 3300042138 Ga0450903_015214 Ga0450903_015214_142_531 117
92 3300044658 Ga0466972_0187295 Ga0466972_0187295_33_416 117
93 3300044683 Ga0466965_0207552 Ga0466965_0207552_121_489 117
94 3300044842 Ga0466957_0256491 Ga0466957_0256491_611_1006 117
95 3300046459 Ga0495629_0037443 Ga0495629_0037443_704_1093 117
96 3300046472 Ga0495580_0185497 Ga0495580_0185497_181_570 117
97 3300046473 Ga0495582_0440911 Ga0495582_0440911_211_600 117
98 3300046476 Ga0495662_0202236 Ga0495662_0202236_402_791 117
99 3300046559 Ga0495667_0472225 Ga0495667_0472225_183_572 117
100 3300046674 Ga0495588_0123699 Ga0495588_0123699_538_927 117
101 3300046679 Ga0495623_0217470 Ga0495623_0217470_94_477 117
102 3300046809 Ga0495600_0507692 Ga0495600_0507692_38_421 117
103 3300047317 Ga0495604_0004624 Ga0495604_0004624_1294_1677 117
104 3300047444 Ga0495675_0001497 Ga0495675_0001497_13127_13510 117
105 3300047447 Ga0495685_048595 Ga0495685_048595_216_599 117
106 3300048903 Ga0496100_0773698 Ga0496100_0773698_200_568 117
107 3300048905 Ga0496102_0977101 Ga0496102_0977101_59_427 117
108 3300048907 Ga0496104_0010095 Ga0496104_0010095_5609_5998 117
109 3300048907 Ga0496104_0628488 Ga0496104_0628488_507_875 117
110 3300048908 Ga0496105_0079160 Ga0496105_0079160_682_1071 117
111 3300048908 Ga0496105_0140977 Ga0496105_0140977_1485_1853 117
112 3300048910 Ga0496107_0124435 Ga0496107_0124435_836_1210 117
113 3300048911 Ga0496108_1180614 Ga0496108_1180614_17_385 117
114 3300048912 Ga0496109_0062528 Ga0496109_0062528_817_1206 117
115 3300048912 Ga0496109_1302403 Ga0496109_1302403_59_427 117
116 3300048913 Ga0496110_0130962 Ga0496110_0130962_1607_1975 117
117 3300048914 Ga0496111_0032303 Ga0496111_0032303_2762_3151 117
118 3300048915 Ga0496112_0406651 Ga0496112_0406651_95_484 117
119 3300048915 Ga0496112_0736853 Ga0496112_0736853_440_808 117
120 3300048916 Ga0496113_0032935 Ga0496113_0032935_2736_3125 117
121 3300048916 Ga0496113_0883402 Ga0496113_0883402_103_486 117
122 3300048918 Ga0496115_0026793 Ga0496115_0026793_4112_4480 117
123 3300048922 Ga0496119_0000855 Ga0496119_0000855_32372_32746 117
124 3300048923 Ga0496120_0000372 Ga0496120_0000372_62813_63187 117
125 3300048929 Ga0496126_0039353 Ga0496126_0039353_582_971 117
126 3300048929 Ga0496126_0732688 Ga0496126_0732688_272_640 117
127 3300049127 Ga0501306_001320 Ga0501306_001320_259_642 117
128 3300049129 Ga0501309_003792 Ga0501309_003792_56_439 117
129 3300049130 Ga0501310_000922 Ga0501310_000922_2187_2570 117
130 3300049161 Ga0501305_000256 Ga0501305_000256_3547_3930 117
131 3300049527 Ga0501311_001796 Ga0501311_001796_1193_1576 117
132 3300049528 Ga0501312_003927 Ga0501312_003927_1314_1697 117
133 3300049529 Ga0501313_000154 Ga0501313_000154_3248_3631 117
134 3300049531 Ga0501315_000662 Ga0501315_000662_56_439 117
135 3300049532 Ga0501316_000124 Ga0501316_000124_3358_3741 117
136 3300049533 Ga0501317_002440 Ga0501317_002440_56_439 117
137 3300049534 Ga0501318_000228 Ga0501318_000228_2067_2450 117
138 3300049535 Ga0501319_000081 Ga0501319_000081_2859_3242 117
139 3300049536 Ga0501320_001410 Ga0501320_001410_36_419 117
140 3300049539 Ga0501323_000010 Ga0501323_000010_337_720 117
141 3300049540 Ga0501324_000009 Ga0501324_000009_3412_3795 117
142 3300049541 Ga0501325_000039 Ga0501325_000039_3420_3803 117
143 3300049545 Ga0501329_00260 Ga0501329_00260_1248_1631 117
144 3300049568 Ga0501031_0058599 Ga0501031_0058599_442_837 117
145 3300049569 Ga0501032_0043434 Ga0501032_0043434_1648_2043 117
146 3300049571 Ga0501034_0909170 Ga0501034_0909170_174_542 117
147 3300049572 Ga0501036_0046642 Ga0501036_0046642_1663_2058 117
148 3300049573 Ga0501037_0015377 Ga0501037_0015377_2071_2466 117
149 3300049574 Ga0501038_0003477 Ga0501038_0003477_2077_2472 117
150 3300049575 Ga0501039_0020664 Ga0501039_0020664_1696_2091 117
151 3300049576 Ga0501040_1000834 Ga0501040_1000834_21_410 117
152 3300049579 Ga0501043_0290793 Ga0501043_0290793_568_963 117
153 3300049580 Ga0501046_0055803 Ga0501046_0055803_900_1295 117
154 3300049581 Ga0501047_0053457 Ga0501047_0053457_3429_3824 117
155 3300049584 Ga0501068_0074370 Ga0501068_0074370_967_1356 117
156 3300049585 Ga0501069_0034576 Ga0501069_0034576_331_726 117
157 3300049586 Ga0501070_0211446 Ga0501070_0211446_45_440 117
158 3300049586 Ga0501070_0348483 Ga0501070_0348483_200_568 117
159 3300049590 Ga0501074_0018515 Ga0501074_0018515_2085_2480 117
160 3300049742 Ga0501080_0025709 Ga0501080_0025709_390_785 117
161 3300049822 Ga0501035_0137730 Ga0501035_0137730_82_477 117
162 3300049824 Ga0501045_0342194 Ga0501045_0342194_287_682 117
163 3300050507 nmdc:mga05p37_1126392_c1 nmdc:mga05p37_1126392_c1_376_765 117
164 3300050508 nmdc:mga09592_122892_c1 nmdc:mga09592_122892_c1_921_1310 117
165 3300059490 Ga0587066_101290 Ga0587066_101290_246_635 117
166 3300059506 Ga0587085_128667 Ga0587085_128667_158_547 117
167 3300059642 Ga0587069_080355 Ga0587069_080355_226_615 117
168 iso_pu_bacteria 2501939600 2501945897 117
169 iso_pu_bacteria 2515154088 2515496684 117
170 iso_pu_bacteria 2515154137 2515756923 117
171 iso_pu_bacteria 2515154203 2516089461 117
172 iso_pu_bacteria 2643221601 2644014439 117
173 iso_pu_bacteria 2643221631 2644175876 117
174 iso_pu_bacteria 2675903059 2676480137 117
175 iso_pu_bacteria 2772190715 2772644897 117
176 iso_pu_bacteria 2818991472 2819742272 117
177 iso_pu_bacteria 2831935698 2831941109 117
178 iso_pu_bacteria 2832004796 2832006200 117
179 iso_pu_bacteria 2855670206 2855673786 117
180 iso_pu_bacteria 2855676851 2855681684 117
181 iso_pu_bacteria 2855683550 2855684525 117
182 iso_pu_bacteria 2856858025 2856858860 117
183 iso_pu_bacteria 2857288857 2857290711 117
184 iso_pu_bacteria 2858848962 2858850649 117
185 iso_pu_bacteria 2858868258 2858875143 117
186 iso_pu_bacteria 2858882152 2858888054 117
187 iso_pu_bacteria 2858888857 2858890984 117
188 iso_pu_bacteria 2858895516 2858897637 117
189 iso_pu_bacteria 2858902515 2858902943 117
190 iso_pu_bacteria 2866065130 2866068637 117
191 iso_pu_bacteria 2867507094 2867510885 117
192 iso_pu_bacteria 2869048445 2869050053 117
193 iso_pu_bacteria 2869061728 2869063907 117
194 iso_pu_bacteria 2869068681 2869071861 117
195 iso_pu_bacteria 2880489317 2880495233 117
196 iso_pu_bacteria 2880495981 2880497112 117
197 iso_pu_bacteria 2902582711 2902583747 117
198 iso_pu_bacteria 2929219909 2929225711 117
199 iso_pu_bacteria 2929226422 2929231312 117
200 iso_pu_bacteria 2996221748 2996223716 117
201 iso_pu_bacteria 649633069 649810768 117
202 iso_pu_bacteria 8003830390 8003835111 117
203 iso_pu_bacteria 8003856774 8003862020 117
204 iso_pu_bacteria 8003870546 8003872930 117
205 iso_pu_bacteria 8054704163 8054706701 117
206 iso_pu_bacteria 8054727385 8054733692 117
207 iso_pu_bacteria 8054734606 8054740748 117
208 iso_pu_bacteria 8055412473 8055412836 117
209 iso_pu_bacteria 8056207758 8056208353 117
210 3300009545 Ga0105237_10214328 Ga0105237_102143283 118
211 3300025914 Ga0207671_10252251 Ga0207671_102522511 118
212 3300031090 Ga0265760_10000904 Ga0265760_100009044 118
213 3300049588 Ga0501072_0656964 Ga0501072_0656964_292_648 118
214 3300054114 Ga0501084_1856266 Ga0501084_1856266_45_401 118
215 3300005327 Ga0070658_10318058 Ga0070658_103180581 119
216 3300005435 Ga0070714_100194472 Ga0070714_1001944723 119
217 3300005439 Ga0070711_100452535 Ga0070711_1004525352 119
218 3300005563 Ga0068855_100791909 Ga0068855_1007919092 119
219 3300006237 Ga0097621_101309293 Ga0097621_1013092931 119
220 3300009174 Ga0105241_12606965 Ga0105241_126069652 119
221 3300010375 Ga0105239_11727489 Ga0105239_117274892 119
222 3300013105 Ga0157369_10615805 Ga0157369_106158051 119
223 3300020078 Ga0206352_10506297 Ga0206352_105062972 119
224 3300021358 Ga0213873_10225366 Ga0213873_102253662 119
225 3300021361 Ga0213872_10332296 Ga0213872_103322962 119
226 3300021384 Ga0213876_10516546 Ga0213876_105165462 119
227 3300021441 Ga0213871_10053880 Ga0213871_100538802 119
228 3300021441 Ga0213871_10055761 Ga0213871_100557612 119
229 3300024227 Ga0228598_1019191 Ga0228598_10191912 119
230 3300025929 Ga0207664_10169646 Ga0207664_101696463 119
231 3300028017 Ga0265356_1000525 Ga0265356_10005259 119
232 3300030763 Ga0265763_1012663 Ga0265763_10126631 119
233 3300030878 Ga0265770_1062228 Ga0265770_10622282 119
234 3300031090 Ga0265760_10048447 Ga0265760_100484472 119
235 3300037471 Ga0395905_0025380 Ga0395905_0025380_4723_5082 119
236 3300037471 Ga0395905_1116486 Ga0395905_1116486_89_448 119
237 3300037853 Ga0436364_0334344 Ga0436364_0334344_90_455 119
238 3300039062 Ga0400483_122812 Ga0400483_122812_924_1295 119
239 3300039062 Ga0400483_197183 Ga0400483_197183_654_1025 119
240 3300039437 Ga0436365_0419155 Ga0436365_0419155_65_430 119
241 3300039437 Ga0436365_1589909 Ga0436365_1589909_109_471 119
242 3300039438 Ga0436360_0103681 Ga0436360_0103681_48_410 119
243 3300039438 Ga0436360_1218238 Ga0436360_1218238_4695_5057 119
244 3300039447 Ga0436361_0424973 Ga0436361_0424973_58_420 119
245 3300039450 Ga0436363_0791505 Ga0436363_0791505_271_633 119
246 3300039453 Ga0436362_0009697 Ga0436362_0009697_412_774 119
247 3300039453 Ga0436362_0997060 Ga0436362_0997060_1818_2180 119
248 3300039453 Ga0436362_1199268 Ga0436362_1199268_130_495 119
249 3300048914 Ga0496111_1120011 Ga0496111_1120011_165_524 119
250 3300049588 Ga0501072_0509969 Ga0501072_0509969_249_617 119
251 3300049741 Ga0501079_0855961 Ga0501079_0855961_210_578 119
252 3300059504 Ga0587082_002486 Ga0587082_002486_141_500 119
253 3300059641 Ga0587068_161911 Ga0587068_161911_22_381 119
254 3300059643 Ga0587072_045745 Ga0587072_045745_273_632 119
255 3300060346 Ga0587111_0000226 Ga0587111_0000226_1667_2026 119
256 3300002067 JGI24735J21928_10008865 JGI24735J21928_100088657 120
257 3300060353 Ga0501082_0613370 Ga0501082_0613370_123_485 120

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00861

Ribosomal_L18p

Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast

16

131

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ily-assembly1.cif.gz_A solution structure of ribosomal protein l18 of thermus thermophilus 0.9112 26 120
1ily-assembly1.cif.gz_A solution structure of ribosomal protein l18 of thermus thermophilus 0.9019 26 120
4woi-assembly2.cif.gz_CO 4,5-linked aminoglycoside antibiotics regulate the bacterial ribosome by targeting dynamic conformational processes within intersubunit bridge b2 0.8949 14 120
5x8t-assembly1.cif.gz_P structure of the 50s large subunit of chloroplast ribosome from spinach 0.8938 23 120
6gaw-assembly1.cif.gz_BS unique features of mammalian mitochondrial translation initiation revealed by cryo-em. this file contains the complete 55s ribosome. 0.893 27 118
ID Description Score Start End Superfamily
5xymO01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9699 26 120 3.30.420.100
af_A0A0R0LFW1_76_177_3.30.420.100 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9611 27 105 3.30.420.100
af_B6SLT9_8_113_3.30.420.100 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9517 27 120 3.30.420.100
af_Q9LJA1_150_297_3.30.420.80 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 0.9513 27 119 3.30.420.80
6ddga01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9477 28 120 3.30.420.100
ID Description Score Start End GO Terms
AF-A0A3D3KKB6-F1-model_v4 Large ribosomal subunit protein uL18 (50S ribosomal protein L18) 0.9939 26 120 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-X0TWH5-F1-model_v4 50S ribosomal protein L18 0.9867 32 120 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A7X7F021-F1-model_v4 Large ribosomal subunit protein uL18 (50S ribosomal protein L18) 0.9852 33 119 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-B4VPM1-F1-model_v4 Large ribosomal subunit protein uL18 (50S ribosomal protein L18) 0.9846 41 120 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A3G2QZJ3-F1-model_v4 Large ribosomal subunit protein uL18c 0.9823 26 120 GO:0003735
GO:0005840
GO:0006412
GO:0008097
GO:0009536
GO:1990904

Feature Viewer

pLDDT pTM Quality
78.8 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map