F367407

General Info

Members Datasets Scaffolds Average Seq Length
257 189 514 62

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100005765|Ga0307408_10000576510
Length 72
Sequence VKRVDLLRHLERHGYEFLREGGSHTVYVNRAARKVSTVPRHREINELLARKICRDLEIPRPDVQRGAAADRA

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
114 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
124 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
130 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
131 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
132 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
133 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
134 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
137 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
150 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
164 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
165 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
166 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
169 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
170 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
171 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
172 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
173 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
174 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
178 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
188 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
189 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 6.61
Rhizosphere 92.22
Stem 0
Stem Tuber 0
Unclassified 36.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100005765 3300031548 Bacteria 8251
2 ARcpr5yngRDRAFT_c025550 3300000043 Unclassified 507
3 Ga0065704_10518931 3300005289 Unclassified 641
4 Ga0065715_10203005 3300005293 Bacteria 1351
5 Ga0065707_11005217 3300005295 Unclassified 538
6 Ga0070683_100523817 3300005329 Bacteria 1133
7 Ga0068869_100351030 3300005334 Unclassified 1202
8 Ga0070689_100658841 3300005340 Bacteria 911
9 Ga0070661_101747370 3300005344 Bacteria 527
10 Ga0070668_100595647 3300005347 Bacteria 966
11 Ga0070668_101140163 3300005347 Unclassified 705
12 Ga0070669_101066845 3300005353 Unclassified 695
13 Ga0070675_100295050 3300005354 Bacteria 1427
14 Ga0070675_102143521 3300005354 Unclassified 515
15 Ga0070667_101234806 3300005367 Unclassified 700
16 Ga0070703_10049668 3300005406 Bacteria 1336
17 Ga0070713_100977468 3300005436 Bacteria 816
18 Ga0070710_11139973 3300005437 Unclassified 574
19 Ga0070701_10071514 3300005438 Unclassified 1856
20 Ga0070711_100227543 3300005439 Bacteria 1453
21 Ga0070705_100085559 3300005440 Bacteria 1949
22 Ga0070705_100477067 3300005440 Bacteria 942
23 Ga0070705_101127333 3300005440 Unclassified 643
24 Ga0070700_100136721 3300005441 Unclassified 1660
25 Ga0070694_100184983 3300005444 Bacteria 1543
26 Ga0070694_100778304 3300005444 Bacteria 783
27 Ga0070694_100857467 3300005444 Unclassified 748
28 Ga0070708_100533572 3300005445 Bacteria 1107
29 Ga0070708_100605589 3300005445 Bacteria 1033
30 Ga0070706_100104020 3300005467 Bacteria 2640
31 Ga0070706_101049444 3300005467 Unclassified 751
32 Ga0070707_100283215 3300005468 Bacteria 1611
33 Ga0070707_101546591 3300005468 Bacteria 630
34 Ga0070698_100796777 3300005471 Unclassified 889
35 Ga0070699_100000018 3300005518 Bacteria 190128
36 Ga0070679_102078938 3300005530 Unclassified 517
37 Ga0070672_100240975 3300005543 Bacteria 1521
38 Ga0070686_100139394 3300005544 Unclassified 1686
39 Ga0070695_100077144 3300005545 Bacteria 2195
40 Ga0070696_100000011 3300005546 Bacteria 82210
41 Ga0070696_100096364 3300005546 Unclassified 2114
42 Ga0070693_100588385 3300005547 Bacteria 802
43 Ga0070665_100103810 3300005548 Bacteria 2845
44 Ga0070704_100028004 3300005549 Bacteria 3744
45 Ga0070704_100350546 3300005549 Bacteria 1246
46 Ga0070704_101208110 3300005549 Bacteria 690
47 Ga0070704_101647558 3300005549 Unclassified 592
48 Ga0068855_100117179 3300005563 Bacteria 3052
49 Ga0070664_100518388 3300005564 Bacteria 1100
50 Ga0068857_100693605 3300005577 Unclassified 967
51 Ga0068857_100765697 3300005577 Bacteria 920
52 Ga0068856_100420228 3300005614 Bacteria 1357
53 Ga0068852_101487663 3300005616 Unclassified 699
54 Ga0068852_102854828 3300005616 Unclassified 501
55 Ga0068859_100008248 3300005617 Bacteria 10565
56 Ga0068864_100880131 3300005618 Unclassified 884
57 Ga0068861_100399468 3300005719 Bacteria 1219
58 Ga0068861_101103836 3300005719 Unclassified 762
59 Ga0068870_11050757 3300005840 Unclassified 583
60 Ga0068863_100030270 3300005841 Bacteria 5170
61 Ga0068863_101042044 3300005841 Unclassified 822
62 Ga0068858_101384985 3300005842 Bacteria 693
63 Ga0068860_101402326 3300005843 Unclassified 720
64 Ga0068860_101414905 3300005843 Unclassified 717
65 Ga0068862_100381672 3300005844 Unclassified 1314
66 Ga0068862_100761537 3300005844 Bacteria 943
67 Ga0081455_10754844 3300005937 Unclassified 614
68 Ga0081538_10045244 3300005981 Unclassified 2732
69 Ga0070712_100199772 3300006175 Unclassified 1570
70 Ga0097621_101348493 3300006237 Bacteria 674
71 Ga0068871_100523056 3300006358 Bacteria 1071
72 Ga0075428_101103404 3300006844 Unclassified 838
73 Ga0075430_100115469 3300006846 Bacteria 2237
74 Ga0075431_101576190 3300006847 Unclassified 615
75 Ga0075434_100266121 3300006871 Bacteria 1733
76 Ga0075434_100706592 3300006871 Bacteria 1025
77 Ga0075434_100798890 3300006871 Unclassified 960
78 Ga0075434_101169075 3300006871 Bacteria 782
79 Ga0075434_101743161 3300006871 Unclassified 630
80 Ga0097620_100008248 3300006931 Bacteria 10565
81 Ga0075435_100760435 3300007076 Bacteria 843
82 Ga0075435_101075871 3300007076 Unclassified 703
83 Ga0099794_10253749 3300007265 Unclassified 907
84 Ga0111539_10502322 3300009094 Bacteria 1412
85 Ga0105247_10012599 3300009101 Bacteria 5077
86 Ga0105247_10268565 3300009101 Unclassified 1172
87 Ga0114129_10201869 3300009147 Unclassified 2692
88 Ga0105241_12220777 3300009174 Unclassified 545
89 Ga0105242_11806754 3300009176 Unclassified 650
90 Ga0105248_11793472 3300009177 Unclassified 696
91 Ga0105237_10174480 3300009545 Unclassified 2150
92 Ga0105237_11091058 3300009545 Bacteria 805
93 Ga0105249_12112759 3300009553 Unclassified 636
94 Ga0105249_12369104 3300009553 Bacteria 603
95 Ga0105249_13506364 3300009553 Unclassified 505
96 Ga0105239_10135575 3300010375 Bacteria 2740
97 Ga0105239_10411584 3300010375 Bacteria 1531
98 Ga0105239_12183264 3300010375 Unclassified 644
99 Ga0105246_10973886 3300011119 Bacteria 766
100 Ga0105246_11154727 3300011119 Unclassified 710
101 Ga0157374_11524264 3300013296 Bacteria 692
102 Ga0157374_12292578 3300013296 Unclassified 567
103 Ga0157378_10088913 3300013297 Bacteria 2804
104 Ga0157372_11353369 3300013307 Unclassified 821
105 Ga0157372_12543664 3300013307 Bacteria 588
106 Ga0157375_10474327 3300013308 Unclassified 1416
107 Ga0157375_13169265 3300013308 Unclassified 549
108 Ga0163163_10916011 3300014325 Bacteria 940
109 Ga0157380_10085623 3300014326 Bacteria 2587
110 Ga0157380_10123043 3300014326 Bacteria 2200
111 Ga0157379_10990949 3300014968 Bacteria 801
112 Ga0157376_10426100 3300014969 Bacteria 1289
113 Ga0163161_12091241 3300017792 Unclassified 503
114 Ga0213876_10000222 3300021384 Bacteria 56831
115 Ga0207697_10039010 3300025315 Bacteria 1949
116 Ga0207653_10012174 3300025885 Unclassified 2686
117 Ga0207710_10003582 3300025900 Bacteria 6893
118 Ga0207643_10736747 3300025908 Unclassified 638
119 Ga0207684_10179427 3300025910 Bacteria 1826
120 Ga0207671_10158604 3300025914 Bacteria 1751
121 Ga0207671_11263398 3300025914 Bacteria 576
122 Ga0207663_10098099 3300025916 Bacteria 1961
123 Ga0207646_10248770 3300025922 Bacteria 1606
124 Ga0207646_10871704 3300025922 Bacteria 800
125 Ga0207681_10359955 3300025923 Bacteria 1167
126 Ga0207659_10264122 3300025926 Bacteria 1402
127 Ga0207700_11262790 3300025928 Bacteria 658
128 Ga0207690_11702819 3300025932 Bacteria 527
129 Ga0207670_10915724 3300025936 Bacteria 735
130 Ga0207691_10618296 3300025940 Unclassified 916
131 Ga0207679_10474274 3300025945 Bacteria 1113
132 Ga0207667_10111243 3300025949 Bacteria 2825
133 Ga0207712_11260462 3300025961 Unclassified 660
134 Ga0207712_11396887 3300025961 Unclassified 626
135 Ga0207668_10009263 3300025972 Bacteria 5893
136 Ga0207668_11652817 3300025972 Unclassified 578
137 Ga0207703_11353798 3300026035 Bacteria 685
138 Ga0207708_10145809 3300026075 Unclassified 1860
139 Ga0207676_11124549 3300026095 Bacteria 777
140 Ga0207674_10763874 3300026116 Unclassified 933
141 Ga0207675_101416742 3300026118 Bacteria 716
142 Ga0207675_101436290 3300026118 Bacteria 711
143 Ga0207675_101657694 3300026118 Bacteria 660
144 Ga0207683_11684239 3300026121 Bacteria 583
145 Ga0209967_1029163 3300027364 Bacteria 823
146 Ga0209996_1021928 3300027395 Bacteria 902
147 Ga0209999_1048372 3300027543 Bacteria 801
148 Ga0209982_1034981 3300027552 Unclassified 795
149 Ga0268266_10000001 3300028379 Bacteria 4040580
150 Ga0268266_10029232 3300028379 Bacteria 4686
151 Ga0268265_10421385 3300028380 Unclassified 1239
152 Ga0268264_10054915 3300028381 Bacteria 3327
153 Ga0265338_10132259 3300028800 Unclassified 1968
154 Ga0307408_100093581 3300031548 Bacteria 2274
155 Ga0307405_10000431 3300031731 Bacteria 15673
156 Ga0307413_10000611 3300031824 Bacteria 12000
157 Ga0307413_11606911 3300031824 Unclassified 577
158 Ga0307410_10005679 3300031852 Bacteria 6638
159 Ga0307406_10002382 3300031901 Bacteria 10212
160 Ga0307406_10550177 3300031901 Unclassified 944
161 Ga0307407_10000511 3300031903 Bacteria 12005
162 Ga0307407_10627079 3300031903 Unclassified 803
163 Ga0307407_11545045 3300031903 Bacteria 526
164 Ga0307412_10001715 3300031911 Bacteria 12127
165 Ga0307409_100005592 3300031995 Bacteria 7268
166 Ga0307409_102811250 3300031995 Unclassified 514
167 Ga0307416_100019752 3300032002 Bacteria 4786
168 Ga0307414_10544379 3300032004 Unclassified 1033
169 Ga0307411_10002273 3300032005 Bacteria 8406
170 Ga0307415_100003353 3300032126 Bacteria 8133
171 Ga0307415_100530007 3300032126 Bacteria 1035
172 Ga0373944_0071144 3300035089 Unclassified 1133
173 Ga0373943_0144654 3300035170 Bacteria 1284
174 Ga0373927_0132774 3300035695 Bacteria 1627
175 Ga0373947_0505296 3300035725 Unclassified 822
176 Ga0373925_0119460 3300037068 Bacteria 2045
177 Ga0395905_1035143 3300037471 Bacteria 724
178 Ga0436365_0344253 3300039437 Bacteria 119698
179 Ga0436362_1017895 3300039453 Unclassified 868
180 Ga0451577_0048029 3300042876 Bacteria 3814
181 Ga0451577_0418470 3300042876 Bacteria 1217
182 Ga0453683_0828986 3300044673 Unclassified 610
183 Ga0453684_1192986 3300044712 Bacteria 799
184 Ga0466971_0582109 3300044719 Unclassified 557
185 Ga0466967_1705782 3300045976 Bacteria 627
186 Ga0496100_0261851 3300048903 Bacteria 1283
187 Ga0496101_0341033 3300048904 Bacteria 1177
188 Ga0496102_0047474 3300048905 Bacteria 3902
189 Ga0496103_0176820 3300048906 Unclassified 1371
190 Ga0496104_0253865 3300048907 Unclassified 1671
191 Ga0496105_0090447 3300048908 Bacteria 2528
192 Ga0496106_0475970 3300048909 Bacteria 1003
193 Ga0496106_0723422 3300048909 Bacteria 792
194 Ga0496108_0046314 3300048911 Unclassified 3633
195 Ga0496108_0868710 3300048911 Unclassified 775
196 Ga0496109_0197039 3300048912 Unclassified 1893
197 Ga0496110_1206843 3300048913 Bacteria 665
198 Ga0496111_0257947 3300048914 Bacteria 1293
199 Ga0496112_0107415 3300048915 Unclassified 2761
200 Ga0496113_0034314 3300048916 Bacteria 3702
201 Ga0496115_0564842 3300048918 Bacteria 908
202 Ga0496115_1381334 3300048918 Bacteria 521
203 Ga0501032_0003860 3300049569 Bacteria 11378
204 Ga0501033_0000720 3300049570 Bacteria 30337
205 Ga0501034_0004188 3300049571 Bacteria 16100
206 Ga0501036_0004881 3300049572 Bacteria 10832
207 Ga0501036_1094879 3300049572 Unclassified 651
208 Ga0501037_0002331 3300049573 Bacteria 13712
209 Ga0501038_0004437 3300049574 Bacteria 13039
210 Ga0501039_0002430 3300049575 Bacteria 13866
211 Ga0501039_1076037 3300049575 Unclassified 624
212 Ga0501040_0602841 3300049576 Bacteria 793
213 Ga0501041_0480266 3300049577 Unclassified 790
214 Ga0501043_0046982 3300049579 Bacteria 3393
215 Ga0501046_0006002 3300049580 Bacteria 10805
216 Ga0501047_0031434 3300049581 Bacteria 5120
217 Ga0501047_1263097 3300049581 Unclassified 552
218 Ga0501048_0416529 3300049582 Bacteria 961
219 Ga0501048_0809653 3300049582 Bacteria 673
220 Ga0501068_0015958 3300049584 Bacteria 4326
221 Ga0501069_0050267 3300049585 Bacteria 2318
222 Ga0501070_1170862 3300049586 Unclassified 591
223 Ga0501071_0165849 3300049587 Bacteria 1653
224 Ga0501071_0661013 3300049587 Bacteria 804
225 Ga0501072_0003977 3300049588 Bacteria 11181
226 Ga0501072_0379808 3300049588 Bacteria 1121
227 Ga0501072_0725169 3300049588 Bacteria 781
228 Ga0501073_0003125 3300049589 Bacteria 12413
229 Ga0501074_0018891 3300049590 Bacteria 5006
230 Ga0501075_0474177 3300049591 Bacteria 955
231 Ga0501076_0164057 3300049592 Bacteria 1811
232 Ga0501077_0414048 3300049593 Bacteria 862
233 Ga0501201_025764 3300049651 Unclassified 646
234 Ga0501233_233939 3300049668 Unclassified 547
235 Ga0501079_0228563 3300049741 Bacteria 1453
236 Ga0501079_0767663 3300049741 Bacteria 759
237 Ga0501080_0002682 3300049742 Bacteria 15585
238 Ga0501080_0881850 3300049742 Unclassified 781
239 Ga0501080_0999618 3300049742 Unclassified 725
240 Ga0501080_1607910 3300049742 Bacteria 550
241 Ga0501081_0900542 3300049743 Bacteria 667
242 Ga0501273_035738 3300049770 Bacteria 721
243 Ga0501035_0084326 3300049822 Bacteria 2802
244 Ga0501035_1491504 3300049822 Unclassified 516
245 Ga0501044_0726154 3300049823 Bacteria 877
246 nmdc:mga05p37_72918_c1 3300050507 Bacteria 4225
247 nmdc:mga0qj67_105365_c1 3300050509 Bacteria 2275
248 nmdc:mga06r32_210468_c1 3300050510 Bacteria 1932
249 nmdc:mga06r32_836811_c1 3300050510 Unclassified 879
250 nmdc:mga08y16_981773_c1 3300050511 Unclassified 826
251 nmdc:mga0n895_443838_c1 3300050512 Bacteria 1310
252 nmdc:mga0n895_491916_c1 3300050512 Bacteria 1236
253 nmdc:mga0n895_558451_c1 3300050512 Unclassified 1150
254 nmdc:mga0rr50_781051_c1 3300050513 Bacteria 815
255 nmdc:mga0a205_341317_c1 3300050515 Bacteria 1366
256 Ga0500555_008250 3300053103 Bacteria 2967
257 Ga0530510_0073677 3300061734 Bacteria 2479
258 Ga0307408_100005765
259 ARcpr5yngRDRAFT_c025550
260 Ga0065704_10518931
261 Ga0065715_10203005
262 Ga0065707_11005217
263 Ga0070683_100523817
264 Ga0068869_100351030
265 Ga0070689_100658841
266 Ga0070661_101747370
267 Ga0070668_100595647
268 Ga0070668_101140163
269 Ga0070669_101066845
270 Ga0070675_100295050
271 Ga0070675_102143521
272 Ga0070667_101234806
273 Ga0070703_10049668
274 Ga0070713_100977468
275 Ga0070710_11139973
276 Ga0070701_10071514
277 Ga0070711_100227543
278 Ga0070705_100085559
279 Ga0070705_100477067
280 Ga0070705_101127333
281 Ga0070700_100136721
282 Ga0070694_100184983
283 Ga0070694_100778304
284 Ga0070694_100857467
285 Ga0070708_100533572
286 Ga0070708_100605589
287 Ga0070706_100104020
288 Ga0070706_101049444
289 Ga0070707_100283215
290 Ga0070707_101546591
291 Ga0070698_100796777
292 Ga0070699_100000018
293 Ga0070679_102078938
294 Ga0070672_100240975
295 Ga0070686_100139394
296 Ga0070695_100077144
297 Ga0070696_100000011
298 Ga0070696_100096364
299 Ga0070693_100588385
300 Ga0070665_100103810
301 Ga0070704_100028004
302 Ga0070704_100350546
303 Ga0070704_101208110
304 Ga0070704_101647558
305 Ga0068855_100117179
306 Ga0070664_100518388
307 Ga0068857_100693605
308 Ga0068857_100765697
309 Ga0068856_100420228
310 Ga0068852_101487663
311 Ga0068852_102854828
312 Ga0068859_100008248
313 Ga0068864_100880131
314 Ga0068861_100399468
315 Ga0068861_101103836
316 Ga0068870_11050757
317 Ga0068863_100030270
318 Ga0068863_101042044
319 Ga0068858_101384985
320 Ga0068860_101402326
321 Ga0068860_101414905
322 Ga0068862_100381672
323 Ga0068862_100761537
324 Ga0081455_10754844
325 Ga0081538_10045244
326 Ga0070712_100199772
327 Ga0097621_101348493
328 Ga0068871_100523056
329 Ga0075428_101103404
330 Ga0075430_100115469
331 Ga0075431_101576190
332 Ga0075434_100266121
333 Ga0075434_100706592
334 Ga0075434_100798890
335 Ga0075434_101169075
336 Ga0075434_101743161
337 Ga0097620_100008248
338 Ga0075435_100760435
339 Ga0075435_101075871
340 Ga0099794_10253749
341 Ga0111539_10502322
342 Ga0105247_10012599
343 Ga0105247_10268565
344 Ga0114129_10201869
345 Ga0105241_12220777
346 Ga0105242_11806754
347 Ga0105248_11793472
348 Ga0105237_10174480
349 Ga0105237_11091058
350 Ga0105249_12112759
351 Ga0105249_12369104
352 Ga0105249_13506364
353 Ga0105239_10135575
354 Ga0105239_10411584
355 Ga0105239_12183264
356 Ga0105246_10973886
357 Ga0105246_11154727
358 Ga0157374_11524264
359 Ga0157374_12292578
360 Ga0157378_10088913
361 Ga0157372_11353369
362 Ga0157372_12543664
363 Ga0157375_10474327
364 Ga0157375_13169265
365 Ga0163163_10916011
366 Ga0157380_10085623
367 Ga0157380_10123043
368 Ga0157379_10990949
369 Ga0157376_10426100
370 Ga0163161_12091241
371 Ga0213876_10000222
372 Ga0207697_10039010
373 Ga0207653_10012174
374 Ga0207710_10003582
375 Ga0207643_10736747
376 Ga0207684_10179427
377 Ga0207671_10158604
378 Ga0207671_11263398
379 Ga0207663_10098099
380 Ga0207646_10248770
381 Ga0207646_10871704
382 Ga0207681_10359955
383 Ga0207659_10264122
384 Ga0207700_11262790
385 Ga0207690_11702819
386 Ga0207670_10915724
387 Ga0207691_10618296
388 Ga0207679_10474274
389 Ga0207667_10111243
390 Ga0207712_11260462
391 Ga0207712_11396887
392 Ga0207668_10009263
393 Ga0207668_11652817
394 Ga0207703_11353798
395 Ga0207708_10145809
396 Ga0207676_11124549
397 Ga0207674_10763874
398 Ga0207675_101416742
399 Ga0207675_101436290
400 Ga0207675_101657694
401 Ga0207683_11684239
402 Ga0209967_1029163
403 Ga0209996_1021928
404 Ga0209999_1048372
405 Ga0209982_1034981
406 Ga0268266_10000001
407 Ga0268266_10029232
408 Ga0268265_10421385
409 Ga0268264_10054915
410 Ga0265338_10132259
411 Ga0307408_100093581
412 Ga0307405_10000431
413 Ga0307413_10000611
414 Ga0307413_11606911
415 Ga0307410_10005679
416 Ga0307406_10002382
417 Ga0307406_10550177
418 Ga0307407_10000511
419 Ga0307407_10627079
420 Ga0307407_11545045
421 Ga0307412_10001715
422 Ga0307409_100005592
423 Ga0307409_102811250
424 Ga0307416_100019752
425 Ga0307414_10544379
426 Ga0307411_10002273
427 Ga0307415_100003353
428 Ga0307415_100530007
429 Ga0373944_0071144
430 Ga0373943_0144654
431 Ga0373927_0132774
432 Ga0373947_0505296
433 Ga0373925_0119460
434 Ga0395905_1035143
435 Ga0436365_0344253
436 Ga0436362_1017895
437 Ga0451577_0048029
438 Ga0451577_0418470
439 Ga0453683_0828986
440 Ga0453684_1192986
441 Ga0466971_0582109
442 Ga0466967_1705782
443 Ga0496100_0261851
444 Ga0496101_0341033
445 Ga0496102_0047474
446 Ga0496103_0176820
447 Ga0496104_0253865
448 Ga0496105_0090447
449 Ga0496106_0475970
450 Ga0496106_0723422
451 Ga0496108_0046314
452 Ga0496108_0868710
453 Ga0496109_0197039
454 Ga0496110_1206843
455 Ga0496111_0257947
456 Ga0496112_0107415
457 Ga0496113_0034314
458 Ga0496115_0564842
459 Ga0496115_1381334
460 Ga0501032_0003860
461 Ga0501033_0000720
462 Ga0501034_0004188
463 Ga0501036_0004881
464 Ga0501036_1094879
465 Ga0501037_0002331
466 Ga0501038_0004437
467 Ga0501039_0002430
468 Ga0501039_1076037
469 Ga0501040_0602841
470 Ga0501041_0480266
471 Ga0501043_0046982
472 Ga0501046_0006002
473 Ga0501047_0031434
474 Ga0501047_1263097
475 Ga0501048_0416529
476 Ga0501048_0809653
477 Ga0501068_0015958
478 Ga0501069_0050267
479 Ga0501070_1170862
480 Ga0501071_0165849
481 Ga0501071_0661013
482 Ga0501072_0003977
483 Ga0501072_0379808
484 Ga0501072_0725169
485 Ga0501073_0003125
486 Ga0501074_0018891
487 Ga0501075_0474177
488 Ga0501076_0164057
489 Ga0501077_0414048
490 Ga0501201_025764
491 Ga0501233_233939
492 Ga0501079_0228563
493 Ga0501079_0767663
494 Ga0501080_0002682
495 Ga0501080_0881850
496 Ga0501080_0999618
497 Ga0501080_1607910
498 Ga0501081_0900542
499 Ga0501273_035738
500 Ga0501035_0084326
501 Ga0501035_1491504
502 Ga0501044_0726154
503 nmdc:mga05p37_72918_c1
504 nmdc:mga0qj67_105365_c1
505 nmdc:mga06r32_210468_c1
506 nmdc:mga06r32_836811_c1
507 nmdc:mga08y16_981773_c1
508 nmdc:mga0n895_443838_c1
509 nmdc:mga0n895_491916_c1
510 nmdc:mga0n895_558451_c1
511 nmdc:mga0rr50_781051_c1
512 nmdc:mga0a205_341317_c1
513 Ga0500555_008250
514 Ga0530510_0073677

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07927

HicA_toxin

HicA toxin of bacterial toxin-antitoxin,

4

58

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6g26-assembly1.cif.gz_F the crystal structure of the burkholderia pseudomallei hicab complex 0.9031 2 58
6hpb-assembly1.cif.gz_A crystal structure of the e.coli hicab toxin-antitoxin complex 0.865 2 57
5j3b-assembly1.cif.gz_A structure of translation elongation factor p from acinetobacter baumannii 0.8642 15 40
6g26-assembly1.cif.gz_F the crystal structure of the burkholderia pseudomallei hicab complex 0.8498 2 58
5j3b-assembly2.cif.gz_B structure of translation elongation factor p from acinetobacter baumannii 0.8464 15 40
ID Description Score Start End Superfamily
6g26F00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.9031 2 58 3.30.920.30
6bogA01 Mainly Beta;Roll;SH3 type barrels.; 0.8675 15 40 2.30.30.140
af_P76106_1_57_3.30.920.30 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.8654 1 58 3.30.920.30
af_Q54V25_1_59_3.30.920.30 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.8583 1 58 3.30.920.30
af_P76106_1_57_3.30.920.30 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.8519 1 58 3.30.920.30
ID Description Score Start End GO Terms
AF-A0A1F2THT6-F1-model_v4 Addiction module toxin, HicA family 1.006 2 61 GO:0003729
GO:0004519
AF-A0A351JN76-F1-model_v4 Addiction module toxin, HicA family 1.005 1 60
AF-A0A6N9C9H3-F1-model_v4 Addiction module toxin, HicA family 1.005 1 53 GO:0003729
GO:0004519
AF-A0A2M7SCS3-F1-model_v4 Addiction module toxin, HicA family 1.002 1 62 GO:0003729
GO:0004519
AF-A0A7C4VZE2-F1-model_v4 Type II toxin-antitoxin system HicA family toxin 1.001 1 60 GO:0003729
GO:0004519

Map