F367230

General Info

Members Datasets Scaffolds Average Seq Length
257 155 514 287

Family's Representative Sequence

Representative Sequence 3300007076|Ga0075435_100035886|Ga0075435_1000358863
Length 302
Sequence MNAATKRHKEHTKSSSNISAIVTAYERIDQTLATLRVIHGCVPQPNEILVHVDANRIECEKAIRNVFPEVRLLRSEDQVGPGGGRNKLLNAAQFEFVASFDDDSYPIDSDYFARALKVFERFPDASMISAALYHVGESIGLDDQSAQWTADFCGGACIFRRNAFLEAGGYVPLPVAYGMEEVDLAIRLHSHGGKILTTPWLRVFHDTDLRRHSDPGVTAGSIANLALLAYLRYPVSLWAIGVGQCASRLLWLLRHGRWRGIWKGVTMIPAHLWANHRYRLPVSKKVVRSYLALRRAPMAVSF

Samples

Sample ID Description Type Environment
1 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
62 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
122 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
127 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
134 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
135 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
136 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
137 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
138 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
139 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
140 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
141 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
142 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
143 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
144 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
145 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
146 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
147 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
148 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
149 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
150 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
151 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
155 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.95
Rhizosphere 95.72
Stem 0
Stem Tuber 0
Unclassified 29.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075435_100035886 3300007076 Unclassified 3937
2 MRS1b_contig_2119228 2162886011 Unclassified 982
3 CNAas_1000201 3300000532 Bacteria 5544
4 JGI24751J29686_10000033 3300002459 Bacteria 87652
5 rootH2_10265427 3300003320 Unclassified 3579
6 rootL2_10009670 3300003322 Bacteria 3393
7 rootL2_10037216 3300003322 Bacteria 4345
8 rootH1_10340575 3300003323 Bacteria 1455
9 Ga0065714_10064457 3300005288 Bacteria 69065
10 Ga0065704_10076869 3300005289 Unclassified 4945
11 Ga0065712_10067742 3300005290 Bacteria 73878
12 Ga0065712_10116630 3300005290 Bacteria 1733
13 Ga0065715_10008370 3300005293 Bacteria 4731
14 Ga0065715_10090576 3300005293 Bacteria 6759
15 Ga0065715_10093619 3300005293 Bacteria 4621
16 Ga0065715_10290170 3300005293 Bacteria 1065
17 Ga0065707_10003978 3300005295 Bacteria 5155
18 Ga0065707_10084531 3300005295 Bacteria 7095
19 Ga0065707_10155116 3300005295 Unclassified 1617
20 Ga0065707_10254087 3300005295 Unclassified 1116
21 Ga0070676_10086656 3300005328 Bacteria 1910
22 Ga0070670_100000118 3300005331 Bacteria 73231
23 Ga0070670_100028071 3300005331 Unclassified 4843
24 Ga0070670_100615415 3300005331 Unclassified 973
25 Ga0068869_100173726 3300005334 Bacteria 1685
26 Ga0068869_100565645 3300005334 Bacteria 957
27 Ga0070682_100003508 3300005337 Bacteria 8676
28 Ga0070682_100049927 3300005337 Bacteria 2610
29 Ga0070689_100000966 3300005340 Bacteria 17933
30 Ga0070689_100236883 3300005340 Unclassified 1502
31 Ga0070687_100002402 3300005343 Bacteria 6996
32 Ga0070687_100254724 3300005343 Unclassified 1092
33 Ga0070692_10005828 3300005345 Bacteria 5298
34 Ga0070692_10010468 3300005345 Bacteria 4222
35 Ga0070692_10247795 3300005345 Bacteria 1065
36 Ga0070669_100044119 3300005353 Unclassified 3249
37 Ga0070673_100226759 3300005364 Unclassified 1619
38 Ga0070673_100238796 3300005364 Unclassified 1579
39 Ga0070673_100351688 3300005364 Bacteria 1308
40 Ga0070659_100107851 3300005366 Unclassified 2246
41 Ga0070703_10001414 3300005406 Bacteria 7252
42 Ga0070700_100037307 3300005441 Bacteria 2955
43 Ga0070700_100059659 3300005441 Bacteria 2402
44 Ga0070700_100073160 3300005441 Bacteria 2193
45 Ga0070700_100176453 3300005441 Bacteria 1483
46 Ga0070694_100023413 3300005444 Bacteria 3972
47 Ga0070694_100250351 3300005444 Bacteria 1340
48 Ga0070708_100080542 3300005445 Bacteria 2947
49 Ga0070681_10001832 3300005458 Bacteria 19169
50 Ga0070681_10258137 3300005458 Bacteria 1655
51 Ga0068867_100042847 3300005459 Unclassified 3312
52 Ga0070706_100000002 3300005467 Bacteria 326510
53 Ga0070698_100126912 3300005471 Bacteria 2508
54 Ga0070699_100001161 3300005518 Bacteria 24445
55 Ga0070699_100353871 3300005518 Bacteria 1323
56 Ga0070679_100021571 3300005530 Bacteria 6289
57 Ga0070697_100211540 3300005536 Unclassified 1651
58 Ga0068853_100266093 3300005539 Bacteria 1577
59 Ga0068853_100405245 3300005539 Bacteria 1277
60 Ga0070672_100042537 3300005543 Bacteria 3498
61 Ga0070672_100277673 3300005543 Unclassified 1416
62 Ga0070695_100022380 3300005545 Bacteria 3877
63 Ga0070695_100060389 3300005545 Bacteria 2456
64 Ga0070695_100099800 3300005545 Bacteria 1953
65 Ga0070695_100296541 3300005545 Unclassified 1193
66 Ga0070693_100233191 3300005547 Bacteria 1212
67 Ga0070704_100090515 3300005549 Unclassified 2279
68 Ga0070704_100161787 3300005549 Unclassified 1771
69 Ga0068855_100310673 3300005563 Unclassified 1744
70 Ga0070664_100177120 3300005564 Bacteria 1894
71 Ga0068857_100133615 3300005577 Bacteria 2239
72 Ga0068857_100171731 3300005577 Bacteria 1971
73 Ga0068854_100124192 3300005578 Bacteria 1964
74 Ga0070702_100004026 3300005615 Bacteria 6669
75 Ga0070702_100038374 3300005615 Bacteria 2667
76 Ga0070702_100308258 3300005615 Unclassified 1098
77 Ga0070702_100337383 3300005615 Bacteria 1056
78 Ga0068859_100009008 3300005617 Bacteria 10079
79 Ga0068859_100019511 3300005617 Bacteria 6812
80 Ga0068859_100020892 3300005617 Bacteria 6571
81 Ga0068859_100115520 3300005617 Unclassified 2749
82 Ga0068859_100127648 3300005617 Bacteria 2613
83 Ga0068859_100565528 3300005617 Unclassified 1231
84 Ga0068864_100047850 3300005618 Bacteria 3675
85 Ga0068864_100157540 3300005618 Bacteria 2062
86 Ga0068864_100688953 3300005618 Unclassified 997
87 Ga0068851_10016842 3300005834 Unclassified 3502
88 Ga0068863_100032450 3300005841 Unclassified 4978
89 Ga0068863_100360110 3300005841 Bacteria 1418
90 Ga0068858_100119162 3300005842 Unclassified 2468
91 Ga0068860_100139215 3300005843 Unclassified 2332
92 Ga0068862_100079387 3300005844 Bacteria 2845
93 Ga0068862_100098423 3300005844 Unclassified 2555
94 Ga0068862_100446979 3300005844 Bacteria 1218
95 Ga0081539_10000508 3300005985 Bacteria 80945
96 Ga0081539_10001267 3300005985 Bacteria 44584
97 Ga0075432_10066253 3300006058 Unclassified 1292
98 Ga0097621_100002056 3300006237 Bacteria 13762
99 Ga0075431_100567154 3300006847 Unclassified 1121
100 Ga0075433_10094108 3300006852 Bacteria 2652
101 Ga0075433_10097707 3300006852 Bacteria 2599
102 Ga0075433_10130202 3300006852 Unclassified 2235
103 Ga0075434_100155215 3300006871 Unclassified 2309
104 Ga0075429_100058665 3300006880 Bacteria 3352
105 Ga0068865_100053415 3300006881 Bacteria 2804
106 Ga0075436_100047179 3300006914 Bacteria 2971
107 Ga0097620_100009008 3300006931 Bacteria 10079
108 Ga0097620_100019511 3300006931 Bacteria 6812
109 Ga0097620_100020894 3300006931 Bacteria 6571
110 Ga0097620_100038811 3300006931 Bacteria 4777
111 Ga0097620_100115524 3300006931 Unclassified 2749
112 Ga0097620_100127637 3300006931 Bacteria 2613
113 Ga0097620_100565526 3300006931 Unclassified 1231
114 Ga0105251_10044209 3300009011 Bacteria 2153
115 Ga0105250_10043915 3300009092 Bacteria 1792
116 Ga0105240_10074735 3300009093 Bacteria 4182
117 Ga0111539_10006848 3300009094 Bacteria 14641
118 Ga0111539_10033596 3300009094 Bacteria 6228
119 Ga0111539_10165553 3300009094 Bacteria 2585
120 Ga0111539_10167775 3300009094 Unclassified 2565
121 Ga0105247_10001797 3300009101 Bacteria 15062
122 Ga0105247_10093594 3300009101 Bacteria 1910
123 Ga0114129_10032861 3300009147 Bacteria 7331
124 Ga0105243_10042932 3300009148 Bacteria 3543
125 Ga0105243_10056307 3300009148 Bacteria 3126
126 Ga0105243_10259377 3300009148 Bacteria 1555
127 Ga0105241_10223032 3300009174 Unclassified 1585
128 Ga0105241_10276870 3300009174 Bacteria 1431
129 Ga0105241_10317769 3300009174 Bacteria 1342
130 Ga0105242_10218053 3300009176 Unclassified 1704
131 Ga0105248_10003801 3300009177 Bacteria 16737
132 Ga0105248_10018530 3300009177 Bacteria 7695
133 Ga0105248_10122724 3300009177 Bacteria 2931
134 Ga0105248_10140068 3300009177 Bacteria 2729
135 Ga0105248_10156101 3300009177 Bacteria 2575
136 Ga0105237_10004118 3300009545 Bacteria 16956
137 Ga0105237_10038927 3300009545 Bacteria 4802
138 Ga0105238_10025573 3300009551 Bacteria 6019
139 Ga0105238_10038195 3300009551 Unclassified 4877
140 Ga0105249_10116340 3300009553 Unclassified 2534
141 Ga0105249_10239994 3300009553 Unclassified 1791
142 Ga0157373_10053798 3300013100 Unclassified 2862
143 Ga0157378_10563493 3300013297 Bacteria 1146
144 Ga0163162_10046389 3300013306 Bacteria 4355
145 Ga0157372_10194016 3300013307 Bacteria 2352
146 Ga0157372_10748210 3300013307 Unclassified 1137
147 Ga0157375_10092471 3300013308 Unclassified 3089
148 Ga0163163_10000263 3300014325 Bacteria 53159
149 Ga0163163_10217077 3300014325 Bacteria 1961
150 Ga0163163_10684229 3300014325 Unclassified 1089
151 Ga0163163_10868479 3300014325 Unclassified 965
152 Ga0157380_10002244 3300014326 Bacteria 13000
153 Ga0157380_10413119 3300014326 Unclassified 1284
154 Ga0157379_10166496 3300014968 Bacteria 1990
155 Ga0213876_10000006 3300021384 Bacteria 700803
156 Ga0207653_10001505 3300025885 Bacteria 7543
157 Ga0207710_10000988 3300025900 Bacteria 14888
158 Ga0207680_10269286 3300025903 Bacteria 1181
159 Ga0207647_10007422 3300025904 Bacteria 7922
160 Ga0207645_10210447 3300025907 Unclassified 1281
161 Ga0207643_10076565 3300025908 Unclassified 1933
162 Ga0207684_10000065 3300025910 Bacteria 194463
163 Ga0207707_10219519 3300025912 Bacteria 1655
164 Ga0207671_10005951 3300025914 Bacteria 11054
165 Ga0207671_10030195 3300025914 Bacteria 4043
166 Ga0207660_10092574 3300025917 Bacteria 2244
167 Ga0207652_10058199 3300025921 Unclassified 3330
168 Ga0207681_10020619 3300025923 Bacteria 4180
169 Ga0207694_10008235 3300025924 Bacteria 7881
170 Ga0207694_10039199 3300025924 Bacteria 3645
171 Ga0207650_10000046 3300025925 Bacteria 178190
172 Ga0207690_10151993 3300025932 Unclassified 1717
173 Ga0207686_10108994 3300025934 Unclassified 1864
174 Ga0207709_10002396 3300025935 Bacteria 11810
175 Ga0207709_10056747 3300025935 Bacteria 2425
176 Ga0207691_10286119 3300025940 Unclassified 1418
177 Ga0207711_10026979 3300025941 Unclassified 4822
178 Ga0207711_10050671 3300025941 Unclassified 3554
179 Ga0207711_10177962 3300025941 Bacteria 1933
180 Ga0207689_10195765 3300025942 Bacteria 1668
181 Ga0207689_10229683 3300025942 Unclassified 1533
182 Ga0207679_10064854 3300025945 Bacteria 2731
183 Ga0207651_10090957 3300025960 Bacteria 2233
184 Ga0207651_10273105 3300025960 Bacteria 1393
185 Ga0207677_10036255 3300026023 Unclassified 3213
186 Ga0207703_10140504 3300026035 Archaea 2095
187 Ga0207708_10000133 3300026075 Bacteria 58317
188 Ga0207708_10021581 3300026075 Bacteria 4857
189 Ga0207708_10033818 3300026075 Bacteria 3886
190 Ga0207708_10035029 3300026075 Bacteria 3820
191 Ga0207708_10059453 3300026075 Bacteria 2917
192 Ga0207708_10190166 3300026075 Bacteria 1633
193 Ga0207641_10191802 3300026088 Unclassified 1878
194 Ga0207648_10027099 3300026089 Bacteria 5090
195 Ga0207648_10381131 3300026089 Bacteria 1275
196 Ga0207648_10457776 3300026089 Unclassified 1162
197 Ga0207676_10008506 3300026095 Bacteria 7297
198 Ga0207676_10050293 3300026095 Bacteria 3249
199 Ga0207676_10060986 3300026095 Bacteria 2985
200 Ga0207676_10098494 3300026095 Bacteria 2418
201 Ga0207676_10352314 3300026095 Bacteria 1362
202 Ga0207674_10007064 3300026116 Bacteria 13122
203 Ga0207674_10065181 3300026116 Unclassified 3673
204 Ga0207674_10200196 3300026116 Bacteria 1946
205 Ga0207675_100017370 3300026118 Bacteria 6716
206 Ga0207428_10026340 3300027907 Bacteria 4854
207 Ga0207428_10129956 3300027907 Bacteria 1928
208 Ga0268265_10201466 3300028380 Bacteria 1727
209 Ga0268264_10244284 3300028381 Unclassified 1664
210 Ga0307408_100062393 3300031548 Bacteria 2723
211 Ga0307406_10056457 3300031901 Bacteria 2514
212 Ga0307407_10153560 3300031903 Bacteria 1499
213 Ga0307414_10066992 3300032004 Bacteria 2569
214 Ga0307415_100049306 3300032126 Bacteria 2846
215 Ga0373951_0003027 3300035091 Bacteria 4165
216 Ga0373941_0021007 3300035115 Bacteria 1837
217 Ga0395900_0279805 3300037418 Bacteria 1661
218 Ga0395898_0397842 3300037466 Bacteria 1313
219 Ga0395901_0385573 3300038443 Bacteria 1442
220 Ga0242420_007118 3300038996 Unclassified 1789
221 Ga0436365_0695157 3300039437 Bacteria 511493
222 Ga0451576_0304331 3300045051 Bacteria 1668
223 Ga0496107_0186907 3300048910 Bacteria 1539
224 Ga0496108_0095218 3300048911 Bacteria 2535
225 Ga0496108_0113395 3300048911 Unclassified 2320
226 Ga0496112_0522881 3300048915 Unclassified 1121
227 Ga0496113_0087948 3300048916 Bacteria 2390
228 Ga0501294_009539 3300049517 Bacteria 954
229 Ga0501300_012008 3300049523 Bacteria 1261
230 Ga0501198_010857 3300049649 Unclassified 1352
231 Ga0501202_019836 3300049652 Unclassified 1332
232 Ga0501216_022079 3300049660 Bacteria 1123
233 Ga0501217_003684 3300049661 Bacteria 3111
234 Ga0501217_010137 3300049661 Bacteria 2059
235 Ga0501223_012163 3300049663 Bacteria 1724
236 Ga0501224_001456 3300049664 Bacteria 3132
237 Ga0501233_010041 3300049668 Bacteria 1857
238 Ga0501249_016286 3300049679 Unclassified 1596
239 Ga0501257_010110 3300049686 Bacteria 2136
240 Ga0501257_019557 3300049686 Unclassified 1585
241 Ga0501225_0013438 3300049705 Bacteria 2291
242 Ga0501225_0014697 3300049705 Bacteria 2184
243 Ga0501234_016642 3300049707 Unclassified 1160
244 Ga0501273_002821 3300049770 Unclassified 1800
245 Ga0501273_012373 3300049770 Bacteria 1074
246 Ga0501283_023795 3300049779 Unclassified 995
247 Ga0501204_004680 3300049850 Bacteria 1479
248 Ga0501226_001565 3300049853 Bacteria 2906
249 nmdc:mga05p37_420582_c1 3300050507 Bacteria 1555
250 nmdc:mga06r32_292200_c1 3300050510 Bacteria 1616
251 nmdc:mga08y16_28897_c1 3300050511 Bacteria 5845
252 nmdc:mga08y16_312308_c1 3300050511 Bacteria 1619
253 nmdc:mga0n895_607534_c1 3300050512 Unclassified 1095
254 nmdc:mga08x19_22471_c1 3300050514 Bacteria 3906
255 nmdc:mga0a205_145675_c1 3300050515 Unclassified 2268
256 nmdc:mga0a205_157735_c1 3300050515 Unclassified 2167
257 nmdc:mga0a205_244553_c1 3300050515 Bacteria 1675
258 Ga0075435_100035886
259 MRS1b_contig_2119228
260 CNAas_1000201
261 JGI24751J29686_10000033
262 rootH2_10265427
263 rootL2_10009670
264 rootL2_10037216
265 rootH1_10340575
266 Ga0065714_10064457
267 Ga0065704_10076869
268 Ga0065712_10067742
269 Ga0065712_10116630
270 Ga0065715_10008370
271 Ga0065715_10090576
272 Ga0065715_10093619
273 Ga0065715_10290170
274 Ga0065707_10003978
275 Ga0065707_10084531
276 Ga0065707_10155116
277 Ga0065707_10254087
278 Ga0070676_10086656
279 Ga0070670_100000118
280 Ga0070670_100028071
281 Ga0070670_100615415
282 Ga0068869_100173726
283 Ga0068869_100565645
284 Ga0070682_100003508
285 Ga0070682_100049927
286 Ga0070689_100000966
287 Ga0070689_100236883
288 Ga0070687_100002402
289 Ga0070687_100254724
290 Ga0070692_10005828
291 Ga0070692_10010468
292 Ga0070692_10247795
293 Ga0070669_100044119
294 Ga0070673_100226759
295 Ga0070673_100238796
296 Ga0070673_100351688
297 Ga0070659_100107851
298 Ga0070703_10001414
299 Ga0070700_100037307
300 Ga0070700_100059659
301 Ga0070700_100073160
302 Ga0070700_100176453
303 Ga0070694_100023413
304 Ga0070694_100250351
305 Ga0070708_100080542
306 Ga0070681_10001832
307 Ga0070681_10258137
308 Ga0068867_100042847
309 Ga0070706_100000002
310 Ga0070698_100126912
311 Ga0070699_100001161
312 Ga0070699_100353871
313 Ga0070679_100021571
314 Ga0070697_100211540
315 Ga0068853_100266093
316 Ga0068853_100405245
317 Ga0070672_100042537
318 Ga0070672_100277673
319 Ga0070695_100022380
320 Ga0070695_100060389
321 Ga0070695_100099800
322 Ga0070695_100296541
323 Ga0070693_100233191
324 Ga0070704_100090515
325 Ga0070704_100161787
326 Ga0068855_100310673
327 Ga0070664_100177120
328 Ga0068857_100133615
329 Ga0068857_100171731
330 Ga0068854_100124192
331 Ga0070702_100004026
332 Ga0070702_100038374
333 Ga0070702_100308258
334 Ga0070702_100337383
335 Ga0068859_100009008
336 Ga0068859_100019511
337 Ga0068859_100020892
338 Ga0068859_100115520
339 Ga0068859_100127648
340 Ga0068859_100565528
341 Ga0068864_100047850
342 Ga0068864_100157540
343 Ga0068864_100688953
344 Ga0068851_10016842
345 Ga0068863_100032450
346 Ga0068863_100360110
347 Ga0068858_100119162
348 Ga0068860_100139215
349 Ga0068862_100079387
350 Ga0068862_100098423
351 Ga0068862_100446979
352 Ga0081539_10000508
353 Ga0081539_10001267
354 Ga0075432_10066253
355 Ga0097621_100002056
356 Ga0075431_100567154
357 Ga0075433_10094108
358 Ga0075433_10097707
359 Ga0075433_10130202
360 Ga0075434_100155215
361 Ga0075429_100058665
362 Ga0068865_100053415
363 Ga0075436_100047179
364 Ga0097620_100009008
365 Ga0097620_100019511
366 Ga0097620_100020894
367 Ga0097620_100038811
368 Ga0097620_100115524
369 Ga0097620_100127637
370 Ga0097620_100565526
371 Ga0105251_10044209
372 Ga0105250_10043915
373 Ga0105240_10074735
374 Ga0111539_10006848
375 Ga0111539_10033596
376 Ga0111539_10165553
377 Ga0111539_10167775
378 Ga0105247_10001797
379 Ga0105247_10093594
380 Ga0114129_10032861
381 Ga0105243_10042932
382 Ga0105243_10056307
383 Ga0105243_10259377
384 Ga0105241_10223032
385 Ga0105241_10276870
386 Ga0105241_10317769
387 Ga0105242_10218053
388 Ga0105248_10003801
389 Ga0105248_10018530
390 Ga0105248_10122724
391 Ga0105248_10140068
392 Ga0105248_10156101
393 Ga0105237_10004118
394 Ga0105237_10038927
395 Ga0105238_10025573
396 Ga0105238_10038195
397 Ga0105249_10116340
398 Ga0105249_10239994
399 Ga0157373_10053798
400 Ga0157378_10563493
401 Ga0163162_10046389
402 Ga0157372_10194016
403 Ga0157372_10748210
404 Ga0157375_10092471
405 Ga0163163_10000263
406 Ga0163163_10217077
407 Ga0163163_10684229
408 Ga0163163_10868479
409 Ga0157380_10002244
410 Ga0157380_10413119
411 Ga0157379_10166496
412 Ga0213876_10000006
413 Ga0207653_10001505
414 Ga0207710_10000988
415 Ga0207680_10269286
416 Ga0207647_10007422
417 Ga0207645_10210447
418 Ga0207643_10076565
419 Ga0207684_10000065
420 Ga0207707_10219519
421 Ga0207671_10005951
422 Ga0207671_10030195
423 Ga0207660_10092574
424 Ga0207652_10058199
425 Ga0207681_10020619
426 Ga0207694_10008235
427 Ga0207694_10039199
428 Ga0207650_10000046
429 Ga0207690_10151993
430 Ga0207686_10108994
431 Ga0207709_10002396
432 Ga0207709_10056747
433 Ga0207691_10286119
434 Ga0207711_10026979
435 Ga0207711_10050671
436 Ga0207711_10177962
437 Ga0207689_10195765
438 Ga0207689_10229683
439 Ga0207679_10064854
440 Ga0207651_10090957
441 Ga0207651_10273105
442 Ga0207677_10036255
443 Ga0207703_10140504
444 Ga0207708_10000133
445 Ga0207708_10021581
446 Ga0207708_10033818
447 Ga0207708_10035029
448 Ga0207708_10059453
449 Ga0207708_10190166
450 Ga0207641_10191802
451 Ga0207648_10027099
452 Ga0207648_10381131
453 Ga0207648_10457776
454 Ga0207676_10008506
455 Ga0207676_10050293
456 Ga0207676_10060986
457 Ga0207676_10098494
458 Ga0207676_10352314
459 Ga0207674_10007064
460 Ga0207674_10065181
461 Ga0207674_10200196
462 Ga0207675_100017370
463 Ga0207428_10026340
464 Ga0207428_10129956
465 Ga0268265_10201466
466 Ga0268264_10244284
467 Ga0307408_100062393
468 Ga0307406_10056457
469 Ga0307407_10153560
470 Ga0307414_10066992
471 Ga0307415_100049306
472 Ga0373951_0003027
473 Ga0373941_0021007
474 Ga0395900_0279805
475 Ga0395898_0397842
476 Ga0395901_0385573
477 Ga0242420_007118
478 Ga0436365_0695157
479 Ga0451576_0304331
480 Ga0496107_0186907
481 Ga0496108_0095218
482 Ga0496108_0113395
483 Ga0496112_0522881
484 Ga0496113_0087948
485 Ga0501294_009539
486 Ga0501300_012008
487 Ga0501198_010857
488 Ga0501202_019836
489 Ga0501216_022079
490 Ga0501217_003684
491 Ga0501217_010137
492 Ga0501223_012163
493 Ga0501224_001456
494 Ga0501233_010041
495 Ga0501249_016286
496 Ga0501257_010110
497 Ga0501257_019557
498 Ga0501225_0013438
499 Ga0501225_0014697
500 Ga0501234_016642
501 Ga0501273_002821
502 Ga0501273_012373
503 Ga0501283_023795
504 Ga0501204_004680
505 Ga0501226_001565
506 nmdc:mga05p37_420582_c1
507 nmdc:mga06r32_292200_c1
508 nmdc:mga08y16_28897_c1
509 nmdc:mga08y16_312308_c1
510 nmdc:mga0n895_607534_c1
511 nmdc:mga08x19_22471_c1
512 nmdc:mga0a205_145675_c1
513 nmdc:mga0a205_157735_c1
514 nmdc:mga0a205_244553_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13641

Glyco_tranf_2_3

Glycosyltransferase like family 2

16

137

0.91

PF00535

Glycos_transf_2

Glycosyl transferase family 2

19

167

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4d0z-assembly3.cif.gz_C galnac-t2 crystal soaked with udp-5sgalnac, mea2 and manganese (higher resolution dataset) 0.8511 2 191
4d11-assembly4.cif.gz_F galnac-t2 crystal soaked with udp-5sgalnac, mea2 peptide and manganese (lower resolution dataset) 0.8508 2 191
6nqt-assembly3.cif.gz_F galnac-t2 soaked with udp-sugar 0.8324 2 217
5fv9-assembly4.cif.gz_F-3 crystal structure of galnac-t2 in complex with compound 16d 0.8297 2 198
2z87-assembly3.cif.gz_B crystal structure of chondroitin polymerase from escherichia coli strain k4 (k4cp) complexed with udp-galnac and udp 0.8278 2 191
ID Description Score Start End Superfamily
4d11F00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8508 2 191 3.90.550.10
af_P9WMY3_4_248_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8338 1 192 3.90.550.10
af_P9WMX3_2_220_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8253 2 192 3.90.550.10
af_A0A096MIV6_83_419_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8241 1 191 3.90.550.10
af_Q9RQP9_29_257_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8241 2 191 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A3S0G5W5-F1-model_v4 Glycosyltransferase 0.9617 2 279 GO:0016740
AF-A0A3S0G5W5-F1-model_v4 Glycosyltransferase 0.9324 2 279 GO:0016740
AF-A0A661CYV5-F1-model_v4 Uncharacterized protein 0.9144 2 99 GO:0003824
GO:0009116
AF-A0A2V6UAH6-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.9102 2 273
AF-A0A1F5TBS1-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.8926 1 189

Map