F367148

General Info

Members Datasets Scaffolds Average Seq Length
257 219 514 177

Family's Representative Sequence

Representative Sequence 3300005547|Ga0070693_100051008|Ga0070693_1000510082
Length 193
Sequence MRPLRYSINVTLDGCCDHRAIPADEELHRHAVENLERADALLFGRVTYEMMEAAWRSPAQTGARPDWMEPFARTIDAAKKYVVSSTLDRVDWNAELLRGDLYTAVQQLKNEPGKGLFVGGVKLPLALTELGLIDEYELVVHPRLAGHGPTLFTGLSKPIDLKLVSRLELGSGAVAMRYEPATRRVPPADVTDL

Samples

Sample ID Description Type Environment
1 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
52 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
53 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
99 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
100 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
101 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
102 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
108 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
109 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
110 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
111 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
114 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
115 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
116 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
117 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
118 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
119 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
134 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
135 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
136 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
137 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
142 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
143 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
149 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
150 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
151 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
154 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
157 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
158 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
159 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
160 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
164 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
165 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
166 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
167 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
168 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
173 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
174 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
175 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
176 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
180 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
181 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
182 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
191 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
199 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
200 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
201 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
206 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
209 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
212 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
213 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
214 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
215 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
217 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
218 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
219 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0
Isolates 0.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.5
Nodule 0.39
Rhizoplane 4.28
Rhizosphere 89.49
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070693_100051008 3300005547 Bacteria 2367
2 LJNas_1012451 3300000546 Bacteria 905
3 JGI25159J45721_1016597 3300002987 Bacteria 1562
4 rootL2_10180223 3300003322 Bacteria 1261
5 Ga0055534_1000343 3300003784 Bacteria 30091
6 Ga0070676_10140862 3300005328 Bacteria 1535
7 Ga0070690_100060460 3300005330 Bacteria 2438
8 Ga0070666_10027046 3300005335 Bacteria 3753
9 Ga0070666_10434704 3300005335 Bacteria 946
10 Ga0070680_100005827 3300005336 Bacteria 9353
11 Ga0070682_100000227 3300005337 Bacteria 40661
12 Ga0070660_100132869 3300005339 Bacteria 1993
13 Ga0070691_10350483 3300005341 Bacteria 820
14 Ga0070687_100036792 3300005343 Bacteria 2442
15 Ga0070661_100002899 3300005344 Bacteria 11811
16 Ga0070669_100378125 3300005353 Bacteria 1155
17 Ga0070659_100006405 3300005366 Bacteria 8501
18 Ga0070659_100043177 3300005366 Bacteria 3526
19 Ga0070667_100674569 3300005367 Bacteria 955
20 Ga0070700_100010089 3300005441 Bacteria 5200
21 Ga0070700_100162741 3300005441 Bacteria 1537
22 Ga0070681_10002581 3300005458 Bacteria 16613
23 Ga0070681_10008306 3300005458 Bacteria 10166
24 Ga0070706_100286102 3300005467 Bacteria 1538
25 Ga0070698_100158375 3300005471 Bacteria 2209
26 Ga0070699_100044817 3300005518 Bacteria 3829
27 Ga0070679_100005408 3300005530 Bacteria 11834
28 Ga0070679_100016306 3300005530 Bacteria 7160
29 Ga0070672_100072466 3300005543 Bacteria 2743
30 Ga0070672_100077029 3300005543 Bacteria 2665
31 Ga0070695_100026944 3300005545 Bacteria 3558
32 Ga0070664_100001492 3300005564 Bacteria 18638
33 Ga0068857_100000223 3300005577 Bacteria 37628
34 Ga0068854_100007627 3300005578 Bacteria 6922
35 Ga0070702_100016164 3300005615 Bacteria 3824
36 Ga0070702_100337795 3300005615 Bacteria 1056
37 Ga0068852_100586896 3300005616 Bacteria 1118
38 Ga0068859_100209292 3300005617 Bacteria 2036
39 Ga0068859_100774627 3300005617 Bacteria 1048
40 Ga0068863_100084045 3300005841 Bacteria 3017
41 Ga0068858_100131035 3300005842 Bacteria 2351
42 Ga0068858_100892508 3300005842 Bacteria 869
43 Ga0081455_10008496 3300005937 Bacteria 10669
44 Ga0081455_10044843 3300005937 Bacteria 3852
45 Ga0075434_100405402 3300006871 Bacteria 1384
46 Ga0075436_100081645 3300006914 Bacteria 2241
47 Ga0097620_100209306 3300006931 Bacteria 2036
48 Ga0097620_100774610 3300006931 Bacteria 1048
49 Ga0105240_10000309 3300009093 Bacteria 93964
50 Ga0105245_10077199 3300009098 Bacteria 3036
51 Ga0105245_11606949 3300009098 Bacteria 702
52 Ga0105247_10110475 3300009101 Bacteria 1769
53 Ga0105241_10112699 3300009174 Bacteria 2179
54 Ga0105242_10116819 3300009176 Bacteria 2283
55 Ga0105248_10174056 3300009177 Bacteria 2426
56 Ga0105248_10356717 3300009177 Bacteria 1646
57 Ga0105248_12452204 3300009177 Bacteria 594
58 Ga0105249_10875374 3300009553 Bacteria 964
59 Ga0157371_10244687 3300013102 Bacteria 1291
60 Ga0157374_10029142 3300013296 Bacteria 4995
61 Ga0157378_10000011 3300013297 Bacteria 158889
62 Ga0157375_10002841 3300013308 Bacteria 14995
63 Ga0157379_10201224 3300014968 Bacteria 1801
64 Ga0213876_10000770 3300021384 Bacteria 21997
65 Ga0213875_10065241 3300021388 Bacteria 1702
66 Ga0209130_1014759 3300025284 Bacteria 1949
67 Ga0209675_1000765 3300025291 Bacteria 21581
68 Ga0209676_1003444 3300025292 Bacteria 9733
69 Ga0209025_1035466 3300025294 Bacteria 2253
70 Ga0209051_1004102 3300025303 Bacteria 9149
71 Ga0207645_10013101 3300025907 Bacteria 5600
72 Ga0207645_10033880 3300025907 Bacteria 3282
73 Ga0207684_10276511 3300025910 Bacteria 1448
74 Ga0207654_10084094 3300025911 Bacteria 1923
75 Ga0207707_10011169 3300025912 Bacteria 7813
76 Ga0207707_10045569 3300025912 Bacteria 3821
77 Ga0207695_10000635 3300025913 Bacteria 70312
78 Ga0207662_10048050 3300025918 Bacteria 2528
79 Ga0207662_10464024 3300025918 Bacteria 868
80 Ga0207657_10691047 3300025919 Bacteria 793
81 Ga0207649_10042621 3300025920 Bacteria 2769
82 Ga0207652_10014724 3300025921 Bacteria 6339
83 Ga0207652_10079312 3300025921 Bacteria 2868
84 Ga0207687_10374000 3300025927 Bacteria 1166
85 Ga0207687_10729829 3300025927 Bacteria 842
86 Ga0207644_10074434 3300025931 Bacteria 2493
87 Ga0207690_10002219 3300025932 Bacteria 11837
88 Ga0207706_10206906 3300025933 Bacteria 1720
89 Ga0207686_10022474 3300025934 Bacteria 3633
90 Ga0207709_10003917 3300025935 Bacteria 8698
91 Ga0207665_10015121 3300025939 Bacteria 5069
92 Ga0207665_10335381 3300025939 Bacteria 1138
93 Ga0207691_10149607 3300025940 Bacteria 2053
94 Ga0207691_10329380 3300025940 Bacteria 1308
95 Ga0207711_10145618 3300025941 Bacteria 2134
96 Ga0207679_10002806 3300025945 Bacteria 10806
97 Ga0207712_10391374 3300025961 Bacteria 1166
98 Ga0207712_10450246 3300025961 Bacteria 1092
99 Ga0207640_10647354 3300025981 Bacteria 900
100 Ga0207658_10103767 3300025986 Bacteria 2233
101 Ga0207677_10876994 3300026023 Bacteria 808
102 Ga0207703_10027534 3300026035 Bacteria 4476
103 Ga0207703_11084167 3300026035 Bacteria 769
104 Ga0207639_10476469 3300026041 Bacteria 1137
105 Ga0207639_10888409 3300026041 Bacteria 833
106 Ga0207678_10984463 3300026067 Bacteria 746
107 Ga0207708_10164892 3300026075 Bacteria 1751
108 Ga0207702_10296303 3300026078 Bacteria 1534
109 Ga0207641_10032309 3300026088 Bacteria 4345
110 Ga0207674_10000571 3300026116 Bacteria 48350
111 Ga0209967_1002415 3300027364 Bacteria 2422
112 Ga0210000_1003351 3300027462 Bacteria 2309
113 Ga0209995_1007799 3300027471 Bacteria 1726
114 Ga0209968_1001587 3300027526 Bacteria 3440
115 Ga0209970_1000718 3300027614 Bacteria 5748
116 Ga0210002_1000613 3300027617 Bacteria 4866
117 Ga0209983_1003862 3300027665 Bacteria 3171
118 Ga0209971_1000317 3300027682 Bacteria 13417
119 Ga0209966_1016614 3300027695 Bacteria 1394
120 Ga0209998_10004085 3300027717 Bacteria 3117
121 Ga0209974_10000287 3300027876 Bacteria 16478
122 Ga0265326_10040588 3300028558 Bacteria 1321
123 Ga0265323_10107042 3300028653 Bacteria 920
124 Ga0265322_10013791 3300028654 Bacteria 2340
125 Ga0265339_10192901 3300031249 Bacteria 1009
126 Ga0265316_10135045 3300031344 Bacteria 1856
127 Ga0265314_10046712 3300031711 Bacteria 3053
128 Ga0265342_10028366 3300031712 Bacteria 3488
129 Ga0307406_10038861 3300031901 Bacteria 2948
130 Ga0307406_10534978 3300031901 Bacteria 956
131 Ga0307415_100072193 3300032126 Bacteria 2430
132 Ga0373926_0000315 3300035083 Bacteria 12010
133 Ga0373934_0113009 3300035086 Bacteria 1102
134 Ga0373944_0007223 3300035089 Bacteria 2970
135 Ga0373951_0043565 3300035091 Bacteria 1088
136 Ga0373923_0002526 3300035111 Bacteria 5656
137 Ga0373936_0003011 3300035113 Bacteria 6296
138 Ga0373945_0000522 3300035116 Bacteria 10963
139 Ga0373953_0025135 3300035117 Bacteria 2272
140 Ga0373954_0117163 3300035118 Bacteria 1291
141 Ga0373956_0060916 3300035119 Bacteria 1709
142 Ga0373957_0204053 3300035120 Bacteria 824
143 Ga0373943_0002470 3300035170 Bacteria 8405
144 Ga0373946_0021512 3300035171 Bacteria 2501
145 Ga0373955_0081896 3300035172 Bacteria 1825
146 Ga0373924_0006053 3300035410 Bacteria 4318
147 Ga0373935_0014534 3300035692 Bacteria 4749
148 Ga0373927_0002044 3300035695 Bacteria 14865
149 Ga0373933_0111136 3300035724 Bacteria 1709
150 Ga0373933_0737023 3300035724 Bacteria 648
151 Ga0373947_0079073 3300035725 Bacteria 2031
152 Ga0373925_0016470 3300037068 Bacteria 5355
153 Ga0395900_0122718 3300037418 Bacteria 2665
154 Ga0395898_0597257 3300037466 Bacteria 1046
155 Ga0395905_0037672 3300037471 Bacteria 4539
156 Ga0395905_0234284 3300037471 Bacteria 1716
157 Ga0436364_0941662 3300037853 Bacteria 6124
158 Ga0395901_0002689 3300038443 Bacteria 17931
159 Ga0395901_0091553 3300038443 Bacteria 3183
160 Ga0436365_0764152 3300039437 Bacteria 80595
161 Ga0436362_0150471 3300039453 Bacteria 1152
162 Ga0451797_0815997 3300041453 Bacteria 1332
163 Ga0451843_1288952 3300041509 Bacteria 3354
164 Ga0450923_078842 3300042125 Bacteria 739
165 Ga0451577_0294316 3300042876 Bacteria 1471
166 Ga0466963_0107752 3300044694 Bacteria 1911
167 Ga0453684_0590920 3300044712 Bacteria 1218
168 Ga0451576_0053901 3300045051 Bacteria 4211
169 Ga0451576_0913460 3300045051 Bacteria 921
170 Ga0466958_0484950 3300045836 Bacteria 802
171 Ga0495592_0149796 3300046454 Bacteria 1614
172 Ga0495603_0018968 3300046455 Bacteria 4163
173 Ga0495629_0009773 3300046459 Bacteria 7001
174 Ga0495641_0012267 3300046461 Bacteria 4805
175 Ga0495651_0019049 3300046462 Bacteria 5318
176 Ga0495653_0175248 3300046463 Bacteria 1476
177 Ga0495582_0008424 3300046473 Bacteria 5688
178 Ga0495639_0003451 3300046475 Bacteria 6843
179 Ga0495662_0000794 3300046476 Bacteria 15320
180 Ga0495664_0006243 3300046477 Bacteria 6575
181 Ga0495594_0011201 3300046499 Bacteria 4656
182 Ga0495608_0019729 3300046511 Bacteria 4636
183 Ga0495618_0074635 3300046514 Bacteria 2159
184 Ga0495630_0058593 3300046517 Bacteria 2887
185 Ga0495643_0001241 3300046522 Bacteria 24481
186 Ga0495666_0028638 3300046526 Bacteria 2740
187 Ga0495665_0033543 3300046531 Bacteria 2745
188 Ga0495640_0076484 3300046533 Bacteria 2233
189 Ga0495586_0023101 3300046535 Bacteria 3320
190 Ga0495586_0240648 3300046535 Bacteria 1031
191 Ga0495587_0049720 3300046536 Bacteria 2481
192 Ga0495634_0007729 3300046642 Bacteria 8044
193 Ga0495635_0209200 3300046663 Bacteria 1321
194 Ga0495657_0143375 3300046675 Bacteria 1487
195 Ga0495599_0012123 3300046678 Bacteria 5306
196 Ga0495623_0219976 3300046679 Bacteria 1082
197 Ga0495647_0002220 3300046681 Bacteria 6078
198 Ga0495658_0055672 3300046683 Bacteria 2253
199 Ga0495613_0009957 3300046689 Bacteria 7063
200 Ga0495624_0020514 3300046690 Bacteria 4396
201 Ga0495600_0001706 3300046809 Bacteria 12268
202 Ga0495581_0000455 3300047315 Bacteria 20972
203 Ga0495604_0123308 3300047317 Bacteria 1872
204 Ga0495636_0001693 3300047318 Bacteria 8397
205 Ga0495672_0004889 3300047320 Bacteria 10772
206 Ga0495676_0004186 3300047321 Bacteria 13180
207 Ga0495680_0014061 3300047322 Bacteria 6952
208 Ga0495684_0030416 3300047471 Bacteria 4145
209 Ga0495686_0177378 3300047472 Bacteria 1236
210 Ga0495593_0005845 3300047673 Bacteria 7249
211 Ga0495602_0171983 3300048088 Bacteria 1680
212 Ga0495614_0029538 3300048089 Bacteria 2360
213 Ga0496102_0028077 3300048905 Bacteria 5028
214 Ga0496103_0045319 3300048906 Bacteria 2714
215 Ga0496106_0020017 3300048909 Bacteria 4963
216 Ga0496106_0059628 3300048909 Bacteria 2891
217 Ga0496106_0097773 3300048909 Bacteria 2273
218 Ga0496107_0223502 3300048910 Bacteria 1401
219 Ga0496107_0465784 3300048910 Bacteria 938
220 Ga0496110_0301154 3300048913 Bacteria 1460
221 Ga0496114_0930075 3300048917 Bacteria 751
222 Ga0496115_0639665 3300048918 Bacteria 842
223 Ga0501300_017893 3300049523 Bacteria 1035
224 Ga0501031_0184955 3300049568 Bacteria 1361
225 Ga0501036_1033002 3300049572 Bacteria 672
226 Ga0501036_1158889 3300049572 Bacteria 631
227 Ga0501038_0104431 3300049574 Bacteria 2355
228 Ga0501039_0191102 3300049575 Bacteria 1610
229 Ga0501040_0208977 3300049576 Bacteria 1387
230 Ga0501041_0253588 3300049577 Bacteria 1106
231 Ga0501042_0247389 3300049578 Bacteria 1287
232 Ga0501042_0475894 3300049578 Bacteria 906
233 Ga0501069_0180014 3300049585 Bacteria 1222
234 Ga0501071_0381480 3300049587 Bacteria 1075
235 Ga0501072_0082560 3300049588 Bacteria 2547
236 Ga0501076_0354165 3300049592 Bacteria 1206
237 Ga0501079_1399052 3300049741 Bacteria 550
238 Ga0501080_0022874 3300049742 Bacteria 5795
239 Ga0501083_0216966 3300049744 Bacteria 1247
240 Ga0501045_0255495 3300049824 Bacteria 1304
241 Ga0501045_0682489 3300049824 Bacteria 758
242 nmdc:mga06r32_946677_c1 3300050510 Bacteria 816
243 nmdc:mga0n895_46214_c1 3300050512 Bacteria 4252
244 nmdc:mga0rr50_26751_c1 3300050513 Bacteria 4031
245 nmdc:mga0rr50_431143_c1 3300050513 Bacteria 1116
246 nmdc:mga08x19_507681_c1 3300050514 Bacteria 852
247 nmdc:mga0a205_1066033_c1 3300050515 Bacteria 655
248 Ga0495612_0082945 3300053078 Bacteria 1348
249 Ga0495619_0009980 3300053085 Bacteria 5982
250 Ga0500616_0000172 3300053153 Bacteria 107729
251 Ga0500622_0000594 3300053156 Bacteria 32899
252 Ga0501084_0350105 3300054114 Bacteria 1248
253 Ga0501084_0523746 3300054114 Bacteria 1002
254 Ga0501082_0116759 3300060353 Bacteria 2311
255 Ga0530510_0036109 3300061734 Bacteria 3562
256 2689994961 2687453743 Bacteria 8361025
257 2946003984 2946003308 Bacteria 3857229
258 Ga0070693_100051008
259 LJNas_1012451
260 JGI25159J45721_1016597
261 rootL2_10180223
262 Ga0055534_1000343
263 Ga0070676_10140862
264 Ga0070690_100060460
265 Ga0070666_10027046
266 Ga0070666_10434704
267 Ga0070680_100005827
268 Ga0070682_100000227
269 Ga0070660_100132869
270 Ga0070691_10350483
271 Ga0070687_100036792
272 Ga0070661_100002899
273 Ga0070669_100378125
274 Ga0070659_100006405
275 Ga0070659_100043177
276 Ga0070667_100674569
277 Ga0070700_100010089
278 Ga0070700_100162741
279 Ga0070681_10002581
280 Ga0070681_10008306
281 Ga0070706_100286102
282 Ga0070698_100158375
283 Ga0070699_100044817
284 Ga0070679_100005408
285 Ga0070679_100016306
286 Ga0070672_100072466
287 Ga0070672_100077029
288 Ga0070695_100026944
289 Ga0070664_100001492
290 Ga0068857_100000223
291 Ga0068854_100007627
292 Ga0070702_100016164
293 Ga0070702_100337795
294 Ga0068852_100586896
295 Ga0068859_100209292
296 Ga0068859_100774627
297 Ga0068863_100084045
298 Ga0068858_100131035
299 Ga0068858_100892508
300 Ga0081455_10008496
301 Ga0081455_10044843
302 Ga0075434_100405402
303 Ga0075436_100081645
304 Ga0097620_100209306
305 Ga0097620_100774610
306 Ga0105240_10000309
307 Ga0105245_10077199
308 Ga0105245_11606949
309 Ga0105247_10110475
310 Ga0105241_10112699
311 Ga0105242_10116819
312 Ga0105248_10174056
313 Ga0105248_10356717
314 Ga0105248_12452204
315 Ga0105249_10875374
316 Ga0157371_10244687
317 Ga0157374_10029142
318 Ga0157378_10000011
319 Ga0157375_10002841
320 Ga0157379_10201224
321 Ga0213876_10000770
322 Ga0213875_10065241
323 Ga0209130_1014759
324 Ga0209675_1000765
325 Ga0209676_1003444
326 Ga0209025_1035466
327 Ga0209051_1004102
328 Ga0207645_10013101
329 Ga0207645_10033880
330 Ga0207684_10276511
331 Ga0207654_10084094
332 Ga0207707_10011169
333 Ga0207707_10045569
334 Ga0207695_10000635
335 Ga0207662_10048050
336 Ga0207662_10464024
337 Ga0207657_10691047
338 Ga0207649_10042621
339 Ga0207652_10014724
340 Ga0207652_10079312
341 Ga0207687_10374000
342 Ga0207687_10729829
343 Ga0207644_10074434
344 Ga0207690_10002219
345 Ga0207706_10206906
346 Ga0207686_10022474
347 Ga0207709_10003917
348 Ga0207665_10015121
349 Ga0207665_10335381
350 Ga0207691_10149607
351 Ga0207691_10329380
352 Ga0207711_10145618
353 Ga0207679_10002806
354 Ga0207712_10391374
355 Ga0207712_10450246
356 Ga0207640_10647354
357 Ga0207658_10103767
358 Ga0207677_10876994
359 Ga0207703_10027534
360 Ga0207703_11084167
361 Ga0207639_10476469
362 Ga0207639_10888409
363 Ga0207678_10984463
364 Ga0207708_10164892
365 Ga0207702_10296303
366 Ga0207641_10032309
367 Ga0207674_10000571
368 Ga0209967_1002415
369 Ga0210000_1003351
370 Ga0209995_1007799
371 Ga0209968_1001587
372 Ga0209970_1000718
373 Ga0210002_1000613
374 Ga0209983_1003862
375 Ga0209971_1000317
376 Ga0209966_1016614
377 Ga0209998_10004085
378 Ga0209974_10000287
379 Ga0265326_10040588
380 Ga0265323_10107042
381 Ga0265322_10013791
382 Ga0265339_10192901
383 Ga0265316_10135045
384 Ga0265314_10046712
385 Ga0265342_10028366
386 Ga0307406_10038861
387 Ga0307406_10534978
388 Ga0307415_100072193
389 Ga0373926_0000315
390 Ga0373934_0113009
391 Ga0373944_0007223
392 Ga0373951_0043565
393 Ga0373923_0002526
394 Ga0373936_0003011
395 Ga0373945_0000522
396 Ga0373953_0025135
397 Ga0373954_0117163
398 Ga0373956_0060916
399 Ga0373957_0204053
400 Ga0373943_0002470
401 Ga0373946_0021512
402 Ga0373955_0081896
403 Ga0373924_0006053
404 Ga0373935_0014534
405 Ga0373927_0002044
406 Ga0373933_0111136
407 Ga0373933_0737023
408 Ga0373947_0079073
409 Ga0373925_0016470
410 Ga0395900_0122718
411 Ga0395898_0597257
412 Ga0395905_0037672
413 Ga0395905_0234284
414 Ga0436364_0941662
415 Ga0395901_0002689
416 Ga0395901_0091553
417 Ga0436365_0764152
418 Ga0436362_0150471
419 Ga0451797_0815997
420 Ga0451843_1288952
421 Ga0450923_078842
422 Ga0451577_0294316
423 Ga0466963_0107752
424 Ga0453684_0590920
425 Ga0451576_0053901
426 Ga0451576_0913460
427 Ga0466958_0484950
428 Ga0495592_0149796
429 Ga0495603_0018968
430 Ga0495629_0009773
431 Ga0495641_0012267
432 Ga0495651_0019049
433 Ga0495653_0175248
434 Ga0495582_0008424
435 Ga0495639_0003451
436 Ga0495662_0000794
437 Ga0495664_0006243
438 Ga0495594_0011201
439 Ga0495608_0019729
440 Ga0495618_0074635
441 Ga0495630_0058593
442 Ga0495643_0001241
443 Ga0495666_0028638
444 Ga0495665_0033543
445 Ga0495640_0076484
446 Ga0495586_0023101
447 Ga0495586_0240648
448 Ga0495587_0049720
449 Ga0495634_0007729
450 Ga0495635_0209200
451 Ga0495657_0143375
452 Ga0495599_0012123
453 Ga0495623_0219976
454 Ga0495647_0002220
455 Ga0495658_0055672
456 Ga0495613_0009957
457 Ga0495624_0020514
458 Ga0495600_0001706
459 Ga0495581_0000455
460 Ga0495604_0123308
461 Ga0495636_0001693
462 Ga0495672_0004889
463 Ga0495676_0004186
464 Ga0495680_0014061
465 Ga0495684_0030416
466 Ga0495686_0177378
467 Ga0495593_0005845
468 Ga0495602_0171983
469 Ga0495614_0029538
470 Ga0496102_0028077
471 Ga0496103_0045319
472 Ga0496106_0020017
473 Ga0496106_0059628
474 Ga0496106_0097773
475 Ga0496107_0223502
476 Ga0496107_0465784
477 Ga0496110_0301154
478 Ga0496114_0930075
479 Ga0496115_0639665
480 Ga0501300_017893
481 Ga0501031_0184955
482 Ga0501036_1033002
483 Ga0501036_1158889
484 Ga0501038_0104431
485 Ga0501039_0191102
486 Ga0501040_0208977
487 Ga0501041_0253588
488 Ga0501042_0247389
489 Ga0501042_0475894
490 Ga0501069_0180014
491 Ga0501071_0381480
492 Ga0501072_0082560
493 Ga0501076_0354165
494 Ga0501079_1399052
495 Ga0501080_0022874
496 Ga0501083_0216966
497 Ga0501045_0255495
498 Ga0501045_0682489
499 nmdc:mga06r32_946677_c1
500 nmdc:mga0n895_46214_c1
501 nmdc:mga0rr50_26751_c1
502 nmdc:mga0rr50_431143_c1
503 nmdc:mga08x19_507681_c1
504 nmdc:mga0a205_1066033_c1
505 Ga0495612_0082945
506 Ga0495619_0009980
507 Ga0500616_0000172
508 Ga0500622_0000594
509 Ga0501084_0350105
510 Ga0501084_0523746
511 Ga0501082_0116759
512 Ga0530510_0036109
513 2689994961
514 2946003984

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

2

175

0.87

Map