F366993
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 257 | 142 | 250 | 241 |
Family's Representative Sequence
| Representative Sequence | 3300003323|rootH1_10185092|rootH1_101850922 |
| Length | 259 |
| Sequence | MPSPDAESQRMNILEVCVDDAAGLDAAVQGGADRIELCSSLDIGGVTPSAGLMAEAAQLAIPVIALIRPRGGGFSYSAAEERVMLRDIEQAVRQGLAGVAIGALTADSRLDLPMLRRLASRAQGLQLTLHRAFDLVPDQAAALEEAVSLGFHRILTSGGAPKAADGAARLASLVKQGQGRVRILAGSGITTENVQRLMSSTGVHEVHASCRAAVAKPAPELVAFGFAGPSGRATSAAVVRELKRLVCGHPSGHPPALET |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 2 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 3 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 4 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 5 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 6 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 7 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 11 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 15 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 35 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 36 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 37 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 38 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 39 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 40 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 41 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 42 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 43 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 44 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 45 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 46 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 47 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 48 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 49 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 50 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 62 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 63 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 64 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 65 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 66 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 67 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 68 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 69 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 70 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 71 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 72 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 114 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 115 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 116 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 117 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 118 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 119 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 120 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 121 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 122 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 123 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 124 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 125 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 126 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 127 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 128 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 129 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 130 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 131 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 132 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 135 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 136 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 137 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 138 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 139 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 140 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 141 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 142 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.28 |
| Metatranscriptomes | 0 |
| Isolates | 2.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.46 |
| Nodule | 0 |
| Rhizoplane | 5.06 |
| Rhizosphere | 62.26 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10002478 | 3300001989 | Bacteria | 7129 |
| 2 | JGI24737J22298_10055340 | 3300001990 | Bacteria | 1199 |
| 3 | JGI25152J39213_1000091 | 3300002773 | Bacteria | 63165 |
| 4 | JGI25150J39212_1000068 | 3300002774 | Bacteria | 62962 |
| 5 | JGI25153J46596_10000031 | 3300003215 | Bacteria | 196926 |
| 6 | JGI25153J46596_10004747 | 3300003215 | Bacteria | 7239 |
| 7 | JGI25153J46596_10011048 | 3300003215 | Bacteria | 4023 |
| 8 | JGI25153J46596_10021045 | 3300003215 | Bacteria | 2444 |
| 9 | rootL2_10008238 | 3300003322 | Bacteria | 20631 |
| 10 | rootL2_10081301 | 3300003322 | Bacteria | 3151 |
| 11 | rootL2_10133019 | 3300003322 | Bacteria | 1542 |
| 12 | rootH1_10185092 | 3300003323 | Bacteria | 2784 |
| 13 | rootH1_10206821 | 3300003323 | Unclassified | 1961 |
| 14 | rootH1_10273390 | 3300003323 | Bacteria | 2026 |
| 15 | Ga0055525_1000012 | 3300003759 | Bacteria | 486564 |
| 16 | Ga0055525_1000013 | 3300003759 | Bacteria | 440870 |
| 17 | Ga0055542_1000115 | 3300003762 | Bacteria | 106506 |
| 18 | Ga0055529_1000052 | 3300003763 | Bacteria | 203029 |
| 19 | Ga0055529_1000581 | 3300003763 | Bacteria | 29446 |
| 20 | Ga0055537_1000161 | 3300003773 | Bacteria | 50226 |
| 21 | Ga0055524_1000110 | 3300003775 | Bacteria | 99255 |
| 22 | Ga0055524_1000665 | 3300003775 | Bacteria | 24147 |
| 23 | Ga0055530_10000074 | 3300003791 | Bacteria | 85116 |
| 24 | Ga0055531_10000253 | 3300003794 | Bacteria | 57396 |
| 25 | Ga0065165_1002695 | 3300005262 | Bacteria | 14279 |
| 26 | Ga0065165_1018615 | 3300005262 | Bacteria | 2507 |
| 27 | Ga0070676_10039738 | 3300005328 | Bacteria | 2722 |
| 28 | Ga0070666_10230032 | 3300005335 | Bacteria | 1309 |
| 29 | Ga0070661_100028884 | 3300005344 | Bacteria | 4002 |
| 30 | Ga0070668_100060152 | 3300005347 | Bacteria | 2941 |
| 31 | Ga0070674_100003829 | 3300005356 | Bacteria | 8511 |
| 32 | Ga0070667_100080660 | 3300005367 | Bacteria | 2783 |
| 33 | Ga0070663_100192414 | 3300005455 | Bacteria | 1588 |
| 34 | Ga0070678_100120642 | 3300005456 | Bacteria | 2067 |
| 35 | Ga0070662_100031666 | 3300005457 | Bacteria | 3713 |
| 36 | Ga0070665_100000810 | 3300005548 | Bacteria | 40895 |
| 37 | Ga0068856_100055888 | 3300005614 | Bacteria | 3895 |
| 38 | Ga0075369_10072371 | 3300006186 | Bacteria | 1519 |
| 39 | Ga0075366_10026740 | 3300006195 | Bacteria | 3381 |
| 40 | Ga0213872_10000381 | 3300021361 | Bacteria | 37204 |
| 41 | Ga0213872_10000837 | 3300021361 | Bacteria | 22321 |
| 42 | Ga0213872_10009734 | 3300021361 | Unclassified | 4597 |
| 43 | Ga0209674_108326 | 3300025226 | Bacteria | 1237 |
| 44 | Ga0209563_100025 | 3300025230 | Bacteria | 596456 |
| 45 | Ga0209563_100030 | 3300025230 | Bacteria | 489259 |
| 46 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 47 | Ga0209026_1014261 | 3300025250 | Bacteria | 1332 |
| 48 | Ga0209148_1000011 | 3300025254 | Bacteria | 1196503 |
| 49 | Ga0209129_1000003 | 3300025258 | Bacteria | 903689 |
| 50 | Ga0209565_1000030 | 3300025263 | Bacteria | 325058 |
| 51 | Ga0209565_1001520 | 3300025263 | Bacteria | 10031 |
| 52 | Ga0209565_1020514 | 3300025263 | Bacteria | 1393 |
| 53 | Ga0209455_1000006 | 3300025272 | Bacteria | 1196503 |
| 54 | Ga0209455_1000483 | 3300025272 | Bacteria | 29472 |
| 55 | Ga0209673_1000925 | 3300025273 | Bacteria | 37051 |
| 56 | Ga0209564_1040213 | 3300025295 | Bacteria | 1273 |
| 57 | Ga0209758_1000001 | 3300025297 | Bacteria | 1981790 |
| 58 | Ga0209758_1000098 | 3300025297 | Bacteria | 230499 |
| 59 | Ga0209758_1009388 | 3300025297 | Bacteria | 6090 |
| 60 | Ga0209050_1000039 | 3300025298 | Bacteria | 410069 |
| 61 | Ga0209050_1010451 | 3300025298 | Bacteria | 4575 |
| 62 | Ga0209256_1000046 | 3300025299 | Bacteria | 325040 |
| 63 | Ga0209256_1000186 | 3300025299 | Bacteria | 119070 |
| 64 | Ga0209257_1000051 | 3300025304 | Bacteria | 434166 |
| 65 | Ga0209257_1001591 | 3300025304 | Bacteria | 26038 |
| 66 | Ga0207697_10093501 | 3300025315 | Bacteria | 1276 |
| 67 | Ga0207647_10005172 | 3300025904 | Bacteria | 9597 |
| 68 | Ga0207645_10065890 | 3300025907 | Bacteria | 2315 |
| 69 | Ga0207706_10046366 | 3300025933 | Bacteria | 3848 |
| 70 | Ga0207669_10002603 | 3300025937 | Bacteria | 7712 |
| 71 | Ga0207668_10051414 | 3300025972 | Bacteria | 2846 |
| 72 | Ga0207658_10009865 | 3300025986 | Bacteria | 6487 |
| 73 | Ga0207678_10225453 | 3300026067 | Bacteria | 1604 |
| 74 | Ga0207683_10048691 | 3300026121 | Bacteria | 3710 |
| 75 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 76 | Ga0307517_10038973 | 3300028786 | Bacteria | 5238 |
| 77 | Ga0307513_10014719 | 3300031456 | Bacteria | 9515 |
| 78 | Ga0395899_0032535 | 3300037312 | Bacteria | 3918 |
| 79 | Ga0395899_0059959 | 3300037312 | Bacteria | 2804 |
| 80 | Ga0395905_0118018 | 3300037471 | Bacteria | 2494 |
| 81 | Ga0395905_0132218 | 3300037471 | Bacteria | 2347 |
| 82 | Ga0395905_0162763 | 3300037471 | Bacteria | 2097 |
| 83 | Ga0395901_0035949 | 3300038443 | Bacteria | 5118 |
| 84 | Ga0436361_0389628 | 3300039447 | Bacteria | 39329 |
| 85 | Ga0436361_0454529 | 3300039447 | Bacteria | 33442 |
| 86 | Ga0436361_0527259 | 3300039447 | Unclassified | 4862 |
| 87 | Ga0436361_0897983 | 3300039447 | Bacteria | 8213 |
| 88 | Ga0495617_000018 | 3300046452 | Bacteria | 248300 |
| 89 | Ga0495617_001203 | 3300046452 | Bacteria | 11652 |
| 90 | Ga0495591_000033 | 3300046458 | Bacteria | 171402 |
| 91 | Ga0495638_0204125 | 3300046460 | Bacteria | 1114 |
| 92 | Ga0495650_0000067 | 3300046471 | Bacteria | 269882 |
| 93 | Ga0495650_0000158 | 3300046471 | Bacteria | 154681 |
| 94 | Ga0495650_0003843 | 3300046471 | Bacteria | 10660 |
| 95 | Ga0495650_0083243 | 3300046471 | Bacteria | 1230 |
| 96 | Ga0495605_0003823 | 3300046474 | Bacteria | 8932 |
| 97 | Ga0495605_0004034 | 3300046474 | Bacteria | 8669 |
| 98 | Ga0495605_0016557 | 3300046474 | Bacteria | 3988 |
| 99 | Ga0495584_0000801 | 3300046491 | Bacteria | 20681 |
| 100 | Ga0495584_0008097 | 3300046491 | Bacteria | 5462 |
| 101 | Ga0495584_0012031 | 3300046491 | Bacteria | 4424 |
| 102 | Ga0495585_0004469 | 3300046492 | Bacteria | 9065 |
| 103 | Ga0495585_0006219 | 3300046492 | Bacteria | 7439 |
| 104 | Ga0495585_0047212 | 3300046492 | Bacteria | 2398 |
| 105 | Ga0495585_0057236 | 3300046492 | Bacteria | 2152 |
| 106 | Ga0495596_0001821 | 3300046500 | Bacteria | 11848 |
| 107 | Ga0495596_0011591 | 3300046500 | Bacteria | 3795 |
| 108 | Ga0495607_0000521 | 3300046501 | Bacteria | 37926 |
| 109 | Ga0495607_0088573 | 3300046501 | Bacteria | 1682 |
| 110 | Ga0495583_0000851 | 3300046506 | Bacteria | 37181 |
| 111 | Ga0495583_0001096 | 3300046506 | Bacteria | 29972 |
| 112 | Ga0495583_0005197 | 3300046506 | Bacteria | 8953 |
| 113 | Ga0495583_0013788 | 3300046506 | Bacteria | 4486 |
| 114 | Ga0495606_0000397 | 3300046507 | Bacteria | 73368 |
| 115 | Ga0495606_0003998 | 3300046507 | Bacteria | 15056 |
| 116 | Ga0495606_0075034 | 3300046507 | Bacteria | 2117 |
| 117 | Ga0495606_0096159 | 3300046507 | Bacteria | 1812 |
| 118 | Ga0495606_0249554 | 3300046507 | Bacteria | 985 |
| 119 | Ga0495610_0000012 | 3300046512 | Bacteria | 517442 |
| 120 | Ga0495610_0008104 | 3300046512 | Bacteria | 6873 |
| 121 | Ga0495631_0019443 | 3300046518 | Bacteria | 3185 |
| 122 | Ga0495631_0064018 | 3300046518 | Bacteria | 1592 |
| 123 | Ga0495631_0114512 | 3300046518 | Bacteria | 1159 |
| 124 | Ga0495631_0121658 | 3300046518 | Bacteria | 1122 |
| 125 | Ga0495637_0000002 | 3300046520 | Bacteria | 629280 |
| 126 | Ga0495637_0000051 | 3300046520 | Bacteria | 100076 |
| 127 | Ga0495643_0002091 | 3300046522 | Bacteria | 16517 |
| 128 | Ga0495643_0004109 | 3300046522 | Bacteria | 10349 |
| 129 | Ga0495644_0009448 | 3300046523 | Bacteria | 3760 |
| 130 | Ga0495644_0095764 | 3300046523 | Bacteria | 1121 |
| 131 | Ga0495648_0000143 | 3300046524 | Bacteria | 85539 |
| 132 | Ga0495648_0005070 | 3300046524 | Bacteria | 11056 |
| 133 | Ga0495648_0006812 | 3300046524 | Bacteria | 9232 |
| 134 | Ga0495648_0176865 | 3300046524 | Bacteria | 1088 |
| 135 | Ga0495663_0001446 | 3300046525 | Bacteria | 7499 |
| 136 | Ga0495642_0006991 | 3300046528 | Bacteria | 4329 |
| 137 | Ga0495642_0033881 | 3300046528 | Unclassified | 2054 |
| 138 | Ga0495654_0000011 | 3300046530 | Bacteria | 363172 |
| 139 | Ga0495654_0002623 | 3300046530 | Bacteria | 11455 |
| 140 | Ga0495654_0099440 | 3300046530 | Bacteria | 1341 |
| 141 | Ga0495587_0100401 | 3300046536 | Bacteria | 1668 |
| 142 | Ga0495609_0032771 | 3300046538 | Bacteria | 2359 |
| 143 | Ga0495609_0052433 | 3300046538 | Bacteria | 1815 |
| 144 | Ga0495597_0000252 | 3300046542 | Bacteria | 48772 |
| 145 | Ga0495597_0000827 | 3300046542 | Bacteria | 24312 |
| 146 | Ga0495597_0029780 | 3300046542 | Bacteria | 2491 |
| 147 | Ga0495622_0141593 | 3300046557 | Bacteria | 1092 |
| 148 | Ga0495633_0002068 | 3300046558 | Bacteria | 14445 |
| 149 | Ga0495633_0021712 | 3300046558 | Bacteria | 3207 |
| 150 | Ga0495668_0001668 | 3300046616 | Bacteria | 20628 |
| 151 | Ga0495668_0120781 | 3300046616 | Bacteria | 1433 |
| 152 | Ga0495668_0141848 | 3300046616 | Bacteria | 1315 |
| 153 | Ga0495611_0001110 | 3300046648 | Bacteria | 14172 |
| 154 | Ga0495611_0001583 | 3300046648 | Bacteria | 11133 |
| 155 | Ga0495611_0008010 | 3300046648 | Bacteria | 4488 |
| 156 | Ga0495611_0040018 | 3300046648 | Bacteria | 2088 |
| 157 | Ga0495611_0089952 | 3300046648 | Bacteria | 1418 |
| 158 | Ga0495625_0000150 | 3300046660 | Bacteria | 106314 |
| 159 | Ga0495625_0040560 | 3300046660 | Bacteria | 3393 |
| 160 | Ga0495625_0078710 | 3300046660 | Bacteria | 2301 |
| 161 | Ga0495625_0240136 | 3300046660 | Bacteria | 1180 |
| 162 | Ga0495625_0338415 | 3300046660 | Bacteria | 954 |
| 163 | Ga0495661_0000461 | 3300046665 | Bacteria | 43183 |
| 164 | Ga0495661_0010348 | 3300046665 | Bacteria | 6366 |
| 165 | Ga0495661_0090063 | 3300046665 | Bacteria | 1747 |
| 166 | Ga0495623_0007626 | 3300046679 | Bacteria | 7030 |
| 167 | Ga0495669_0000520 | 3300046684 | Bacteria | 17474 |
| 168 | Ga0495669_0030288 | 3300046684 | Bacteria | 2375 |
| 169 | Ga0495669_0077661 | 3300046684 | Bacteria | 1520 |
| 170 | Ga0495670_0000033 | 3300046691 | Bacteria | 81716 |
| 171 | Ga0495670_0016936 | 3300046691 | Bacteria | 3582 |
| 172 | Ga0495670_0370649 | 3300046691 | Bacteria | 772 |
| 173 | Ga0495671_0047493 | 3300046692 | Bacteria | 2145 |
| 174 | Ga0495649_0000024 | 3300046694 | Bacteria | 175713 |
| 175 | Ga0495649_0047965 | 3300046694 | Bacteria | 2322 |
| 176 | Ga0495649_0093168 | 3300046694 | Bacteria | 1604 |
| 177 | Ga0495649_0177282 | 3300046694 | Bacteria | 1113 |
| 178 | Ga0495649_0189435 | 3300046694 | Bacteria | 1071 |
| 179 | Ga0495589_0000151 | 3300046794 | Bacteria | 64300 |
| 180 | Ga0495589_0169050 | 3300046794 | Bacteria | 1039 |
| 181 | Ga0495600_0000094 | 3300046809 | Bacteria | 48664 |
| 182 | Ga0495660_0004725 | 3300046810 | Bacteria | 8221 |
| 183 | Ga0495660_0047434 | 3300046810 | Bacteria | 2352 |
| 184 | Ga0495660_0169222 | 3300046810 | Bacteria | 1065 |
| 185 | Ga0495672_0000056 | 3300047320 | Bacteria | 223740 |
| 186 | Ga0495683_0000017 | 3300047323 | Bacteria | 189599 |
| 187 | Ga0495683_0002547 | 3300047323 | Bacteria | 10952 |
| 188 | Ga0495683_0006317 | 3300047323 | Bacteria | 6479 |
| 189 | Ga0495683_0044885 | 3300047323 | Bacteria | 2222 |
| 190 | Ga0495683_0158412 | 3300047323 | Bacteria | 1048 |
| 191 | Ga0495687_000098 | 3300047443 | Bacteria | 132403 |
| 192 | Ga0495687_000455 | 3300047443 | Bacteria | 50452 |
| 193 | Ga0495677_0004141 | 3300047445 | Bacteria | 5598 |
| 194 | Ga0495679_004892 | 3300047446 | Bacteria | 6047 |
| 195 | Ga0495679_066832 | 3300047446 | Bacteria | 1042 |
| 196 | Ga0495679_066834 | 3300047446 | Bacteria | 1042 |
| 197 | Ga0495673_0000003 | 3300047469 | Bacteria | 1491337 |
| 198 | Ga0495673_0000050 | 3300047469 | Bacteria | 262267 |
| 199 | Ga0495681_0012685 | 3300047470 | Bacteria | 4938 |
| 200 | Ga0495681_0020634 | 3300047470 | Bacteria | 3571 |
| 201 | Ga0495681_0099812 | 3300047470 | Bacteria | 1270 |
| 202 | Ga0495686_0044955 | 3300047472 | Bacteria | 2795 |
| 203 | Ga0495626_0001568 | 3300048091 | Bacteria | 17939 |
| 204 | Ga0495626_0006422 | 3300048091 | Bacteria | 6695 |
| 205 | Ga0495626_0018603 | 3300048091 | Bacteria | 3484 |
| 206 | Ga0496102_0000077 | 3300048905 | Bacteria | 142501 |
| 207 | Ga0496102_0000571 | 3300048905 | Bacteria | 39125 |
| 208 | Ga0496103_0000403 | 3300048906 | Bacteria | 38378 |
| 209 | Ga0496104_0012455 | 3300048907 | Bacteria | 7646 |
| 210 | Ga0496105_0002058 | 3300048908 | Bacteria | 14540 |
| 211 | Ga0496109_0034650 | 3300048912 | Bacteria | 4549 |
| 212 | Ga0496109_0097736 | 3300048912 | Bacteria | 2721 |
| 213 | Ga0496112_0288195 | 3300048915 | Bacteria | 1588 |
| 214 | Ga0496112_0512415 | 3300048915 | Bacteria | 1135 |
| 215 | Ga0496113_0005467 | 3300048916 | Bacteria | 7928 |
| 216 | Ga0496113_0065307 | 3300048916 | Bacteria | 2754 |
| 217 | Ga0496114_0005237 | 3300048917 | Bacteria | 10135 |
| 218 | Ga0496115_0000131 | 3300048918 | Bacteria | 68111 |
| 219 | Ga0496116_0003198 | 3300048919 | Bacteria | 16381 |
| 220 | Ga0496117_0001521 | 3300048920 | Bacteria | 33156 |
| 221 | Ga0496118_0001238 | 3300048921 | Bacteria | 39264 |
| 222 | Ga0496119_0005690 | 3300048922 | Bacteria | 11822 |
| 223 | Ga0496121_0000228 | 3300048924 | Bacteria | 120653 |
| 224 | Ga0496122_0000299 | 3300048925 | Bacteria | 109780 |
| 225 | Ga0496122_0005142 | 3300048925 | Bacteria | 15780 |
| 226 | Ga0496122_0111951 | 3300048925 | Bacteria | 1789 |
| 227 | Ga0496122_0128371 | 3300048925 | Bacteria | 1618 |
| 228 | Ga0496122_0259361 | 3300048925 | Bacteria | 966 |
| 229 | Ga0496123_0000959 | 3300048926 | Bacteria | 44656 |
| 230 | Ga0496123_0042584 | 3300048926 | Bacteria | 3131 |
| 231 | Ga0496123_0066441 | 3300048926 | Bacteria | 2284 |
| 232 | Ga0496124_0000081 | 3300048927 | Bacteria | 208413 |
| 233 | Ga0496124_0273997 | 3300048927 | Bacteria | 1234 |
| 234 | Ga0496125_0000520 | 3300048928 | Bacteria | 66776 |
| 235 | Ga0496125_0001128 | 3300048928 | Bacteria | 40779 |
| 236 | Ga0496126_0001331 | 3300048929 | Bacteria | 39237 |
| 237 | Ga0496126_0010255 | 3300048929 | Bacteria | 9846 |
| 238 | Ga0495678_000048 | 3300049459 | Bacteria | 165744 |
| 239 | Ga0495678_031015 | 3300049459 | Bacteria | 2233 |
| 240 | Ga0495682_0013242 | 3300049460 | Bacteria | 3143 |
| 241 | Ga0495682_0040857 | 3300049460 | Bacteria | 1700 |
| 242 | Ga0501043_0066350 | 3300049579 | Bacteria | 2834 |
| 243 | Ga0500610_0000076 | 3300053079 | Bacteria | 30101 |
| 244 | Ga0500595_000094 | 3300053119 | Bacteria | 61463 |
| 245 | Ga0500618_000052 | 3300053125 | Bacteria | 102436 |
| 246 | Ga0500642_0004750 | 3300053130 | Bacteria | 4298 |
| 247 | Ga0500586_005598 | 3300053145 | Bacteria | 3190 |
| 248 | Ga0500636_0028263 | 3300053177 | Bacteria | 3313 |
| 249 | Ga0500645_000002 | 3300053730 | Bacteria | 388892 |
| 250 | Ga0500596_000084 | 3300053735 | Bacteria | 12721 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046474 | Ga0495605_0016557 | Ga0495605_0016557_219_950 | 200 |
| 2 | 3300046491 | Ga0495584_0012031 | Ga0495584_0012031_3533_4264 | 200 |
| 3 | 3300046492 | Ga0495585_0047212 | Ga0495585_0047212_322_1053 | 200 |
| 4 | 3300046500 | Ga0495596_0011591 | Ga0495596_0011591_1467_2198 | 200 |
| 5 | 3300046506 | Ga0495583_0013788 | Ga0495583_0013788_682_1413 | 200 |
| 6 | 3300046523 | Ga0495644_0009448 | Ga0495644_0009448_1341_2072 | 200 |
| 7 | 3300046524 | Ga0495648_0176865 | Ga0495648_0176865_145_876 | 200 |
| 8 | 3300046538 | Ga0495609_0032771 | Ga0495609_0032771_1335_2066 | 200 |
| 9 | 3300046648 | Ga0495611_0040018 | Ga0495611_0040018_583_1314 | 200 |
| 10 | 3300046684 | Ga0495669_0077661 | Ga0495669_0077661_131_862 | 200 |
| 11 | 3300046691 | Ga0495670_0370649 | Ga0495670_0370649_16_747 | 200 |
| 12 | 3300046794 | Ga0495589_0169050 | Ga0495589_0169050_118_849 | 200 |
| 13 | 3300046810 | Ga0495660_0169222 | Ga0495660_0169222_170_901 | 200 |
| 14 | 3300047323 | Ga0495683_0158412 | Ga0495683_0158412_153_884 | 200 |
| 15 | 3300049460 | Ga0495682_0040857 | Ga0495682_0040857_946_1677 | 200 |
| 16 | 3300046507 | Ga0495606_0096159 | Ga0495606_0096159_912_1643 | 207 |
| 17 | 3300038443 | Ga0395901_0035949 | Ga0395901_0035949_1085_1804 | 208 |
| 18 | 3300037471 | Ga0395905_0132218 | Ga0395905_0132218_1222_1971 | 211 |
| 19 | 3300046500 | Ga0495596_0001821 | Ga0495596_0001821_5831_6616 | 212 |
| 20 | 3300021361 | Ga0213872_10000381 | Ga0213872_1000038120 | 216 |
| 21 | 3300039447 | Ga0436361_0389628 | Ga0436361_0389628_19457_20224 | 216 |
| 22 | 3300025226 | Ga0209674_108326 | Ga0209674_1083262 | 217 |
| 23 | 3300037312 | Ga0395899_0059959 | Ga0395899_0059959_848_1579 | 224 |
| 24 | 3300037471 | Ga0395905_0162763 | Ga0395905_0162763_85_807 | 227 |
| 25 | 3300046542 | Ga0495597_0029780 | Ga0495597_0029780_355_1140 | 229 |
| 26 | 3300047323 | Ga0495683_0006317 | Ga0495683_0006317_5342_6127 | 229 |
| 27 | 3300048917 | Ga0496114_0005237 | Ga0496114_0005237_6503_7273 | 230 |
| 28 | 3300003323 | rootH1_10206821 | rootH1_102068213 | 231 |
| 29 | 3300048922 | Ga0496119_0005690 | Ga0496119_0005690_7789_8499 | 231 |
| 30 | 3300003322 | rootL2_10008238 | rootL2_100082383 | 232 |
| 31 | 3300003322 | rootL2_10081301 | rootL2_100813012 | 232 |
| 32 | 3300003323 | rootH1_10273390 | rootH1_102733902 | 232 |
| 33 | 3300003763 | Ga0055529_1000581 | Ga0055529_100058112 | 232 |
| 34 | 3300025272 | Ga0209455_1000483 | Ga0209455_100048312 | 232 |
| 35 | 3300046491 | Ga0495584_0008097 | Ga0495584_0008097_3087_3821 | 232 |
| 36 | 3300046648 | Ga0495611_0008010 | Ga0495611_0008010_696_1430 | 232 |
| 37 | 3300046684 | Ga0495669_0000520 | Ga0495669_0000520_13701_14435 | 232 |
| 38 | 3300046694 | Ga0495649_0000024 | Ga0495649_0000024_14116_14844 | 232 |
| 39 | 3300046694 | Ga0495649_0047965 | Ga0495649_0047965_1386_2120 | 232 |
| 40 | 3300047443 | Ga0495687_000098 | Ga0495687_000098_124064_124798 | 232 |
| 41 | 3300053079 | Ga0500610_0000076 | Ga0500610_0000076_26276_27010 | 232 |
| 42 | 3300053730 | Ga0500645_000002 | Ga0500645_000002_37576_38310 | 232 |
| 43 | iso_pu_bacteria | 2738541297 | 2738828396 | 232 |
| 44 | iso_pu_bacteria | 2738541357 | 2739152192 | 232 |
| 45 | iso_pu_bacteria | 2738543003 | 2739193787 | 232 |
| 46 | iso_pu_bacteria | 2738543026 | 2739320588 | 232 |
| 47 | iso_pu_bacteria | 2738543029 | 2739338504 | 232 |
| 48 | iso_pu_bacteria | 2808606418 | 2809143405 | 232 |
| 49 | 3300003215 | JGI25153J46596_10000031 | JGI25153J46596_100000318 | 233 |
| 50 | 3300025297 | Ga0209758_1000001 | Ga0209758_1000001441 | 233 |
| 51 | 3300047446 | Ga0495679_004892 | Ga0495679_004892_2663_3391 | 233 |
| 52 | 3300002773 | JGI25152J39213_1000091 | JGI25152J39213_100009112 | 234 |
| 53 | 3300002774 | JGI25150J39212_1000068 | JGI25150J39212_100006812 | 234 |
| 54 | 3300003215 | JGI25153J46596_10004747 | JGI25153J46596_100047475 | 234 |
| 55 | 3300003775 | Ga0055524_1000665 | Ga0055524_10006658 | 234 |
| 56 | 3300005262 | Ga0065165_1018615 | Ga0065165_10186153 | 234 |
| 57 | 3300025245 | Ga0207425_1000001 | Ga0207425_1000001539 | 234 |
| 58 | 3300025258 | Ga0209129_1000003 | Ga0209129_1000003539 | 234 |
| 59 | 3300025263 | Ga0209565_1001520 | Ga0209565_10015203 | 234 |
| 60 | 3300025263 | Ga0209565_1020514 | Ga0209565_10205142 | 234 |
| 61 | 3300025297 | Ga0209758_1000098 | Ga0209758_100009884 | 234 |
| 62 | 3300025299 | Ga0209256_1000186 | Ga0209256_100018665 | 234 |
| 63 | 3300037471 | Ga0395905_0118018 | Ga0395905_0118018_765_1496 | 234 |
| 64 | 3300046452 | Ga0495617_000018 | Ga0495617_000018_205740_206471 | 234 |
| 65 | 3300046458 | Ga0495591_000033 | Ga0495591_000033_48709_49443 | 234 |
| 66 | 3300046460 | Ga0495638_0204125 | Ga0495638_0204125_238_969 | 234 |
| 67 | 3300046471 | Ga0495650_0000067 | Ga0495650_0000067_223563_224294 | 234 |
| 68 | 3300046471 | Ga0495650_0003843 | Ga0495650_0003843_1707_2438 | 234 |
| 69 | 3300046471 | Ga0495650_0083243 | Ga0495650_0083243_389_1120 | 234 |
| 70 | 3300046474 | Ga0495605_0003823 | Ga0495605_0003823_2880_3611 | 234 |
| 71 | 3300046474 | Ga0495605_0004034 | Ga0495605_0004034_220_954 | 234 |
| 72 | 3300046491 | Ga0495584_0000801 | Ga0495584_0000801_1297_2031 | 234 |
| 73 | 3300046492 | Ga0495585_0004469 | Ga0495585_0004469_3734_4495 | 234 |
| 74 | 3300046492 | Ga0495585_0006219 | Ga0495585_0006219_5836_6567 | 234 |
| 75 | 3300046492 | Ga0495585_0057236 | Ga0495585_0057236_34_768 | 234 |
| 76 | 3300046501 | Ga0495607_0000521 | Ga0495607_0000521_3233_3967 | 234 |
| 77 | 3300046501 | Ga0495607_0088573 | Ga0495607_0088573_659_1390 | 234 |
| 78 | 3300046506 | Ga0495583_0000851 | Ga0495583_0000851_25685_26419 | 234 |
| 79 | 3300046507 | Ga0495606_0249554 | Ga0495606_0249554_81_812 | 234 |
| 80 | 3300046512 | Ga0495610_0000012 | Ga0495610_0000012_256233_256964 | 234 |
| 81 | 3300046512 | Ga0495610_0008104 | Ga0495610_0008104_4109_4843 | 234 |
| 82 | 3300046518 | Ga0495631_0019443 | Ga0495631_0019443_662_1447 | 234 |
| 83 | 3300046518 | Ga0495631_0064018 | Ga0495631_0064018_298_1029 | 234 |
| 84 | 3300046518 | Ga0495631_0114512 | Ga0495631_0114512_290_1021 | 234 |
| 85 | 3300046518 | Ga0495631_0121658 | Ga0495631_0121658_205_939 | 234 |
| 86 | 3300046520 | Ga0495637_0000002 | Ga0495637_0000002_397402_398136 | 234 |
| 87 | 3300046520 | Ga0495637_0000051 | Ga0495637_0000051_91042_91773 | 234 |
| 88 | 3300046522 | Ga0495643_0004109 | Ga0495643_0004109_4638_5369 | 234 |
| 89 | 3300046523 | Ga0495644_0095764 | Ga0495644_0095764_183_917 | 234 |
| 90 | 3300046524 | Ga0495648_0005070 | Ga0495648_0005070_7622_8353 | 234 |
| 91 | 3300046528 | Ga0495642_0006991 | Ga0495642_0006991_1948_2682 | 234 |
| 92 | 3300046530 | Ga0495654_0000011 | Ga0495654_0000011_135496_136227 | 234 |
| 93 | 3300046530 | Ga0495654_0002623 | Ga0495654_0002623_8418_9149 | 234 |
| 94 | 3300046530 | Ga0495654_0099440 | Ga0495654_0099440_447_1181 | 234 |
| 95 | 3300046538 | Ga0495609_0052433 | Ga0495609_0052433_660_1394 | 234 |
| 96 | 3300046542 | Ga0495597_0000252 | Ga0495597_0000252_34167_34898 | 234 |
| 97 | 3300046542 | Ga0495597_0000827 | Ga0495597_0000827_10914_11645 | 234 |
| 98 | 3300046557 | Ga0495622_0141593 | Ga0495622_0141593_164_895 | 234 |
| 99 | 3300046558 | Ga0495633_0002068 | Ga0495633_0002068_12784_13518 | 234 |
| 100 | 3300046616 | Ga0495668_0001668 | Ga0495668_0001668_19548_20279 | 234 |
| 101 | 3300046648 | Ga0495611_0001110 | Ga0495611_0001110_2759_3490 | 234 |
| 102 | 3300046648 | Ga0495611_0001583 | Ga0495611_0001583_8197_8931 | 234 |
| 103 | 3300046648 | Ga0495611_0089952 | Ga0495611_0089952_302_1033 | 234 |
| 104 | 3300046660 | Ga0495625_0040560 | Ga0495625_0040560_1326_2111 | 234 |
| 105 | 3300046660 | Ga0495625_0078710 | Ga0495625_0078710_1386_2117 | 234 |
| 106 | 3300046660 | Ga0495625_0240136 | Ga0495625_0240136_288_1019 | 234 |
| 107 | 3300046665 | Ga0495661_0000461 | Ga0495661_0000461_19952_20683 | 234 |
| 108 | 3300046665 | Ga0495661_0010348 | Ga0495661_0010348_1898_2629 | 234 |
| 109 | 3300046679 | Ga0495623_0007626 | Ga0495623_0007626_6005_6736 | 234 |
| 110 | 3300046684 | Ga0495669_0030288 | Ga0495669_0030288_356_1087 | 234 |
| 111 | 3300046691 | Ga0495670_0016936 | Ga0495670_0016936_411_1196 | 234 |
| 112 | 3300046794 | Ga0495589_0000151 | Ga0495589_0000151_45607_46338 | 234 |
| 113 | 3300046810 | Ga0495660_0004725 | Ga0495660_0004725_3911_4642 | 234 |
| 114 | 3300046810 | Ga0495660_0047434 | Ga0495660_0047434_678_1412 | 234 |
| 115 | 3300047320 | Ga0495672_0000056 | Ga0495672_0000056_27997_28731 | 234 |
| 116 | 3300047323 | Ga0495683_0000017 | Ga0495683_0000017_94749_95483 | 234 |
| 117 | 3300047323 | Ga0495683_0044885 | Ga0495683_0044885_596_1327 | 234 |
| 118 | 3300047446 | Ga0495679_066832 | Ga0495679_066832_52_783 | 234 |
| 119 | 3300047446 | Ga0495679_066834 | Ga0495679_066834_260_991 | 234 |
| 120 | 3300047469 | Ga0495673_0000003 | Ga0495673_0000003_416823_417554 | 234 |
| 121 | 3300047469 | Ga0495673_0000050 | Ga0495673_0000050_41245_41976 | 234 |
| 122 | 3300047470 | Ga0495681_0020634 | Ga0495681_0020634_1732_2517 | 234 |
| 123 | 3300047470 | Ga0495681_0099812 | Ga0495681_0099812_473_1207 | 234 |
| 124 | 3300047472 | Ga0495686_0044955 | Ga0495686_0044955_1223_1957 | 234 |
| 125 | 3300048091 | Ga0495626_0001568 | Ga0495626_0001568_15457_16188 | 234 |
| 126 | 3300048091 | Ga0495626_0006422 | Ga0495626_0006422_3362_4096 | 234 |
| 127 | 3300048091 | Ga0495626_0018603 | Ga0495626_0018603_2600_3334 | 234 |
| 128 | 3300048905 | Ga0496102_0000077 | Ga0496102_0000077_124490_125221 | 234 |
| 129 | 3300048912 | Ga0496109_0034650 | Ga0496109_0034650_1705_2436 | 234 |
| 130 | 3300048915 | Ga0496112_0288195 | Ga0496112_0288195_814_1545 | 234 |
| 131 | 3300048916 | Ga0496113_0005467 | Ga0496113_0005467_5379_6110 | 234 |
| 132 | 3300048925 | Ga0496122_0000299 | Ga0496122_0000299_85231_85962 | 234 |
| 133 | 3300048925 | Ga0496122_0111951 | Ga0496122_0111951_943_1674 | 234 |
| 134 | 3300048925 | Ga0496122_0128371 | Ga0496122_0128371_697_1428 | 234 |
| 135 | 3300048925 | Ga0496122_0259361 | Ga0496122_0259361_221_952 | 234 |
| 136 | 3300048926 | Ga0496123_0000959 | Ga0496123_0000959_23800_24531 | 234 |
| 137 | 3300048926 | Ga0496123_0066441 | Ga0496123_0066441_930_1661 | 234 |
| 138 | 3300048927 | Ga0496124_0273997 | Ga0496124_0273997_306_1037 | 234 |
| 139 | 3300048928 | Ga0496125_0000520 | Ga0496125_0000520_60565_61296 | 234 |
| 140 | 3300048929 | Ga0496126_0010255 | Ga0496126_0010255_5814_6545 | 234 |
| 141 | 3300049459 | Ga0495678_000048 | Ga0495678_000048_82198_82932 | 234 |
| 142 | 3300049459 | Ga0495678_031015 | Ga0495678_031015_479_1210 | 234 |
| 143 | 3300049460 | Ga0495682_0013242 | Ga0495682_0013242_2346_3080 | 234 |
| 144 | 3300053125 | Ga0500618_000052 | Ga0500618_000052_44944_45675 | 234 |
| 145 | 3300053145 | Ga0500586_005598 | Ga0500586_005598_1973_2704 | 234 |
| 146 | 3300031456 | Ga0307513_10014719 | Ga0307513_100147196 | 236 |
| 147 | 3300003759 | Ga0055525_1000013 | Ga0055525_1000013131 | 237 |
| 148 | 3300003791 | Ga0055530_10000074 | Ga0055530_1000007413 | 237 |
| 149 | 3300003794 | Ga0055531_10000253 | Ga0055531_1000025313 | 237 |
| 150 | 3300025230 | Ga0209563_100025 | Ga0209563_100025455 | 237 |
| 151 | 3300025298 | Ga0209050_1000039 | Ga0209050_1000039188 | 237 |
| 152 | 3300025304 | Ga0209257_1000051 | Ga0209257_1000051188 | 237 |
| 153 | 3300047470 | Ga0495681_0012685 | Ga0495681_0012685_3881_4609 | 237 |
| 154 | iso_pu_bacteria | 2671180139 | 2671695517 | 237 |
| 155 | 3300003215 | JGI25153J46596_10011048 | JGI25153J46596_100110483 | 238 |
| 156 | 3300003215 | JGI25153J46596_10021045 | JGI25153J46596_100210452 | 238 |
| 157 | 3300003323 | rootH1_10185092 | rootH1_101850922 | 238 |
| 158 | 3300003773 | Ga0055537_1000161 | Ga0055537_10001613 | 238 |
| 159 | 3300003775 | Ga0055524_1000110 | Ga0055524_100011078 | 238 |
| 160 | 3300005262 | Ga0065165_1002695 | Ga0065165_10026958 | 238 |
| 161 | 3300005614 | Ga0068856_100055888 | Ga0068856_1000558882 | 238 |
| 162 | 3300021361 | Ga0213872_10009734 | Ga0213872_100097343 | 238 |
| 163 | 3300025263 | Ga0209565_1000030 | Ga0209565_1000030101 | 238 |
| 164 | 3300025273 | Ga0209673_1000925 | Ga0209673_100092510 | 238 |
| 165 | 3300025295 | Ga0209564_1040213 | Ga0209564_10402131 | 238 |
| 166 | 3300025297 | Ga0209758_1009388 | Ga0209758_10093885 | 238 |
| 167 | 3300025298 | Ga0209050_1010451 | Ga0209050_10104515 | 238 |
| 168 | 3300025299 | Ga0209256_1000046 | Ga0209256_1000046184 | 238 |
| 169 | 3300025304 | Ga0209257_1001591 | Ga0209257_100159116 | 238 |
| 170 | 3300028786 | Ga0307517_10038973 | Ga0307517_100389735 | 238 |
| 171 | 3300039447 | Ga0436361_0527259 | Ga0436361_0527259_3373_4116 | 238 |
| 172 | 3300046471 | Ga0495650_0000158 | Ga0495650_0000158_19813_20544 | 238 |
| 173 | 3300046506 | Ga0495583_0001096 | Ga0495583_0001096_4332_5090 | 238 |
| 174 | 3300046536 | Ga0495587_0100401 | Ga0495587_0100401_266_1024 | 238 |
| 175 | 3300046558 | Ga0495633_0021712 | Ga0495633_0021712_2320_3078 | 238 |
| 176 | 3300046665 | Ga0495661_0090063 | Ga0495661_0090063_822_1580 | 238 |
| 177 | 3300046809 | Ga0495600_0000094 | Ga0495600_0000094_40045_40803 | 238 |
| 178 | 3300048905 | Ga0496102_0000571 | Ga0496102_0000571_14519_15253 | 238 |
| 179 | 3300048906 | Ga0496103_0000403 | Ga0496103_0000403_23894_24628 | 238 |
| 180 | 3300048907 | Ga0496104_0012455 | Ga0496104_0012455_4659_5393 | 238 |
| 181 | 3300048908 | Ga0496105_0002058 | Ga0496105_0002058_12257_12991 | 238 |
| 182 | 3300048918 | Ga0496115_0000131 | Ga0496115_0000131_13640_14374 | 238 |
| 183 | 3300048919 | Ga0496116_0003198 | Ga0496116_0003198_1749_2483 | 238 |
| 184 | 3300048920 | Ga0496117_0001521 | Ga0496117_0001521_23857_24591 | 238 |
| 185 | 3300048921 | Ga0496118_0001238 | Ga0496118_0001238_23962_24696 | 238 |
| 186 | 3300048924 | Ga0496121_0000228 | Ga0496121_0000228_13677_14411 | 238 |
| 187 | 3300048927 | Ga0496124_0000081 | Ga0496124_0000081_14569_15303 | 238 |
| 188 | 3300048929 | Ga0496126_0001331 | Ga0496126_0001331_23935_24669 | 238 |
| 189 | 3300053119 | Ga0500595_000094 | Ga0500595_000094_10627_11385 | 238 |
| 190 | 3300053177 | Ga0500636_0028263 | Ga0500636_0028263_2068_2826 | 238 |
| 191 | 3300001989 | JGI24739J22299_10002478 | JGI24739J22299_100024787 | 239 |
| 192 | 3300001990 | JGI24737J22298_10055340 | JGI24737J22298_100553402 | 239 |
| 193 | 3300003322 | rootL2_10133019 | rootL2_101330192 | 239 |
| 194 | 3300003759 | Ga0055525_1000012 | Ga0055525_1000012285 | 239 |
| 195 | 3300003762 | Ga0055542_1000115 | Ga0055542_100011512 | 239 |
| 196 | 3300003763 | Ga0055529_1000052 | Ga0055529_1000052171 | 239 |
| 197 | 3300005328 | Ga0070676_10039738 | Ga0070676_100397383 | 239 |
| 198 | 3300005335 | Ga0070666_10230032 | Ga0070666_102300322 | 239 |
| 199 | 3300005344 | Ga0070661_100028884 | Ga0070661_1000288843 | 239 |
| 200 | 3300005347 | Ga0070668_100060152 | Ga0070668_1000601523 | 239 |
| 201 | 3300005356 | Ga0070674_100003829 | Ga0070674_1000038295 | 239 |
| 202 | 3300005367 | Ga0070667_100080660 | Ga0070667_1000806602 | 239 |
| 203 | 3300005455 | Ga0070663_100192414 | Ga0070663_1001924142 | 239 |
| 204 | 3300005456 | Ga0070678_100120642 | Ga0070678_1001206422 | 239 |
| 205 | 3300005457 | Ga0070662_100031666 | Ga0070662_1000316662 | 239 |
| 206 | 3300005548 | Ga0070665_100000810 | Ga0070665_10000081021 | 239 |
| 207 | 3300006186 | Ga0075369_10072371 | Ga0075369_100723712 | 239 |
| 208 | 3300006195 | Ga0075366_10026740 | Ga0075366_100267403 | 239 |
| 209 | 3300021361 | Ga0213872_10000837 | Ga0213872_100008372 | 239 |
| 210 | 3300025230 | Ga0209563_100030 | Ga0209563_100030165 | 239 |
| 211 | 3300025250 | Ga0209026_1014261 | Ga0209026_10142612 | 239 |
| 212 | 3300025254 | Ga0209148_1000011 | Ga0209148_1000011376 | 239 |
| 213 | 3300025272 | Ga0209455_1000006 | Ga0209455_1000006818 | 239 |
| 214 | 3300025315 | Ga0207697_10093501 | Ga0207697_100935012 | 239 |
| 215 | 3300025904 | Ga0207647_10005172 | Ga0207647_100051728 | 239 |
| 216 | 3300025907 | Ga0207645_10065890 | Ga0207645_100658902 | 239 |
| 217 | 3300025933 | Ga0207706_10046366 | Ga0207706_100463662 | 239 |
| 218 | 3300025937 | Ga0207669_10002603 | Ga0207669_100026034 | 239 |
| 219 | 3300025972 | Ga0207668_10051414 | Ga0207668_100514143 | 239 |
| 220 | 3300025986 | Ga0207658_10009865 | Ga0207658_100098654 | 239 |
| 221 | 3300026067 | Ga0207678_10225453 | Ga0207678_102254532 | 239 |
| 222 | 3300026121 | Ga0207683_10048691 | Ga0207683_100486912 | 239 |
| 223 | 3300028379 | Ga0268266_10000002 | Ga0268266_100000021750 | 239 |
| 224 | 3300037312 | Ga0395899_0032535 | Ga0395899_0032535_1980_2801 | 239 |
| 225 | 3300039447 | Ga0436361_0454529 | Ga0436361_0454529_28565_29323 | 239 |
| 226 | 3300039447 | Ga0436361_0897983 | Ga0436361_0897983_1304_2050 | 239 |
| 227 | 3300046452 | Ga0495617_001203 | Ga0495617_001203_3648_4403 | 239 |
| 228 | 3300046506 | Ga0495583_0005197 | Ga0495583_0005197_3474_4208 | 239 |
| 229 | 3300046507 | Ga0495606_0000397 | Ga0495606_0000397_31779_32534 | 239 |
| 230 | 3300046507 | Ga0495606_0003998 | Ga0495606_0003998_9112_9846 | 239 |
| 231 | 3300046507 | Ga0495606_0075034 | Ga0495606_0075034_1330_2091 | 239 |
| 232 | 3300046522 | Ga0495643_0002091 | Ga0495643_0002091_7333_8094 | 239 |
| 233 | 3300046524 | Ga0495648_0000143 | Ga0495648_0000143_1255_1989 | 239 |
| 234 | 3300046524 | Ga0495648_0006812 | Ga0495648_0006812_6608_7378 | 239 |
| 235 | 3300046525 | Ga0495663_0001446 | Ga0495663_0001446_6520_7341 | 239 |
| 236 | 3300046528 | Ga0495642_0033881 | Ga0495642_0033881_852_1613 | 239 |
| 237 | 3300046616 | Ga0495668_0120781 | Ga0495668_0120781_363_1097 | 239 |
| 238 | 3300046616 | Ga0495668_0141848 | Ga0495668_0141848_97_858 | 239 |
| 239 | 3300046660 | Ga0495625_0000150 | Ga0495625_0000150_56959_57693 | 239 |
| 240 | 3300046660 | Ga0495625_0338415 | Ga0495625_0338415_148_909 | 239 |
| 241 | 3300046691 | Ga0495670_0000033 | Ga0495670_0000033_63891_64625 | 239 |
| 242 | 3300046692 | Ga0495671_0047493 | Ga0495671_0047493_1286_2035 | 239 |
| 243 | 3300046694 | Ga0495649_0093168 | Ga0495649_0093168_808_1569 | 239 |
| 244 | 3300046694 | Ga0495649_0177282 | Ga0495649_0177282_321_1055 | 239 |
| 245 | 3300046694 | Ga0495649_0189435 | Ga0495649_0189435_78_827 | 239 |
| 246 | 3300047323 | Ga0495683_0002547 | Ga0495683_0002547_3115_3936 | 239 |
| 247 | 3300047443 | Ga0495687_000455 | Ga0495687_000455_8777_9538 | 239 |
| 248 | 3300047445 | Ga0495677_0004141 | Ga0495677_0004141_3053_3814 | 239 |
| 249 | 3300048912 | Ga0496109_0097736 | Ga0496109_0097736_1950_2684 | 239 |
| 250 | 3300048915 | Ga0496112_0512415 | Ga0496112_0512415_160_894 | 239 |
| 251 | 3300048916 | Ga0496113_0065307 | Ga0496113_0065307_809_1543 | 239 |
| 252 | 3300048925 | Ga0496122_0005142 | Ga0496122_0005142_3395_4129 | 239 |
| 253 | 3300048926 | Ga0496123_0042584 | Ga0496123_0042584_1371_2105 | 239 |
| 254 | 3300048928 | Ga0496125_0001128 | Ga0496125_0001128_31143_31877 | 239 |
| 255 | 3300049579 | Ga0501043_0066350 | Ga0501043_0066350_1683_2417 | 239 |
| 256 | 3300053130 | Ga0500642_0004750 | Ga0500642_0004750_3508_4242 | 239 |
| 257 | 3300053735 | Ga0500596_000084 | Ga0500596_000084_11504_12328 | 239 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2bdq-assembly1.cif.gz_B | crystal structure of the putative copper homeostasis protein cutc from streptococcus agalactiae, northeast strucural genomics target sar15. | 0.9447 | 3 | 195 |
| 3iwp-assembly5.cif.gz_D | crystal structure of human copper homeostasis protein cutc | 0.9349 | 3 | 234 |
| 3iwp-assembly4.cif.gz_B | crystal structure of human copper homeostasis protein cutc | 0.9332 | 1 | 233 |
| 3iwp-assembly4.cif.gz_A | crystal structure of human copper homeostasis protein cutc | 0.9266 | 1 | 235 |
| 1x8c-assembly1.cif.gz_A | crystal structure of the semet-derivative copper homeostasis protein (cutcm) with calcium binding from shigella flexneri 2a str. 301 | 0.925 | 3 | 237 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P34630_10_248_3.20.20.380 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain | 0.9539 | 4 | 232 | 3.20.20.380 |
| af_Q4E0C3_1_211_3.20.20.380 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain | 0.9451 | 3 | 195 | 3.20.20.380 |
| af_Q9D8X1_24_272_3.20.20.380 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain | 0.9313 | 3 | 234 | 3.20.20.380 |
| af_P67826_1_248_3.20.20.380 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain | 0.9228 | 3 | 237 | 3.20.20.380 |
| 2bdqB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain | 0.9206 | 4 | 195 | 3.20.20.380 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0C9N6G7-F1-model_v4 | PF03932 family protein CutC | 0.9879 | 1 | 233 |
GO:0005507
GO:0005737 |
| AF-A0A847X024-F1-model_v4 | Copper homeostasis protein cutC homolog | 0.9828 | 3 | 195 |
GO:0005507
|
| AF-A0A351VCH7-F1-model_v4 | Copper homeostasis protein cutC homolog | 0.9826 | 2 | 185 |
GO:0005507
|
| AF-A0A3D3SLZ3-F1-model_v4 | deleted | 0.9815 | 4 | 122 |
|
| AF-A0A355FNW3-F1-model_v4 | Copper homeostasis protein cutC homolog | 0.981 | 1 | 181 |
GO:0005507
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar