F366993

General Info

Members Datasets Scaffolds Average Seq Length
257 142 250 241

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10185092|rootH1_101850922
Length 259
Sequence MPSPDAESQRMNILEVCVDDAAGLDAAVQGGADRIELCSSLDIGGVTPSAGLMAEAAQLAIPVIALIRPRGGGFSYSAAEERVMLRDIEQAVRQGLAGVAIGALTADSRLDLPMLRRLASRAQGLQLTLHRAFDLVPDQAAALEEAVSLGFHRILTSGGAPKAADGAARLASLVKQGQGRVRILAGSGITTENVQRLMSSTGVHEVHASCRAAVAKPAPELVAFGFAGPSGRATSAAVVRELKRLVCGHPSGHPPALET

Samples

Sample ID Description Type Environment
1 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
2 2738541297 Duganella sp. GV083 Isolate Unclassified
3 2738541357 Duganella sp. GV053 Isolate Unclassified
4 2738543003 Duganella sp. GV066 Isolate Unclassified
5 2738543026 Duganella sp. GV089 Isolate Unclassified
6 2738543029 Duganella sp. GV039 Isolate Unclassified
7 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
37 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
40 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
41 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
43 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
48 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
62 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
63 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
64 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
65 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
66 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
67 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
68 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
69 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
70 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
71 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
72 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
73 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
74 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
75 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
76 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
77 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
78 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
79 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
80 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
81 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
82 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
83 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
84 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
85 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
86 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
87 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
88 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
89 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
90 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
91 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
92 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
93 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
94 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
95 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
96 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
97 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
98 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
99 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
100 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
101 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
102 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
103 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
104 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
105 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
106 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
107 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
108 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
109 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
110 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
111 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
112 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
113 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
114 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
115 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
116 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
117 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
118 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
119 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
120 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
121 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
122 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
123 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
124 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
125 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
126 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
127 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
128 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
129 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
130 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
131 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
132 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
133 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
134 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
135 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
136 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
137 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
138 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
139 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
140 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
141 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
142 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.28
Metatranscriptomes 0
Isolates 2.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.46
Nodule 0
Rhizoplane 5.06
Rhizosphere 62.26
Stem 0
Stem Tuber 0
Unclassified 13.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10002478 3300001989 Bacteria 7129
2 JGI24737J22298_10055340 3300001990 Bacteria 1199
3 JGI25152J39213_1000091 3300002773 Bacteria 63165
4 JGI25150J39212_1000068 3300002774 Bacteria 62962
5 JGI25153J46596_10000031 3300003215 Bacteria 196926
6 JGI25153J46596_10004747 3300003215 Bacteria 7239
7 JGI25153J46596_10011048 3300003215 Bacteria 4023
8 JGI25153J46596_10021045 3300003215 Bacteria 2444
9 rootL2_10008238 3300003322 Bacteria 20631
10 rootL2_10081301 3300003322 Bacteria 3151
11 rootL2_10133019 3300003322 Bacteria 1542
12 rootH1_10185092 3300003323 Bacteria 2784
13 rootH1_10206821 3300003323 Unclassified 1961
14 rootH1_10273390 3300003323 Bacteria 2026
15 Ga0055525_1000012 3300003759 Bacteria 486564
16 Ga0055525_1000013 3300003759 Bacteria 440870
17 Ga0055542_1000115 3300003762 Bacteria 106506
18 Ga0055529_1000052 3300003763 Bacteria 203029
19 Ga0055529_1000581 3300003763 Bacteria 29446
20 Ga0055537_1000161 3300003773 Bacteria 50226
21 Ga0055524_1000110 3300003775 Bacteria 99255
22 Ga0055524_1000665 3300003775 Bacteria 24147
23 Ga0055530_10000074 3300003791 Bacteria 85116
24 Ga0055531_10000253 3300003794 Bacteria 57396
25 Ga0065165_1002695 3300005262 Bacteria 14279
26 Ga0065165_1018615 3300005262 Bacteria 2507
27 Ga0070676_10039738 3300005328 Bacteria 2722
28 Ga0070666_10230032 3300005335 Bacteria 1309
29 Ga0070661_100028884 3300005344 Bacteria 4002
30 Ga0070668_100060152 3300005347 Bacteria 2941
31 Ga0070674_100003829 3300005356 Bacteria 8511
32 Ga0070667_100080660 3300005367 Bacteria 2783
33 Ga0070663_100192414 3300005455 Bacteria 1588
34 Ga0070678_100120642 3300005456 Bacteria 2067
35 Ga0070662_100031666 3300005457 Bacteria 3713
36 Ga0070665_100000810 3300005548 Bacteria 40895
37 Ga0068856_100055888 3300005614 Bacteria 3895
38 Ga0075369_10072371 3300006186 Bacteria 1519
39 Ga0075366_10026740 3300006195 Bacteria 3381
40 Ga0213872_10000381 3300021361 Bacteria 37204
41 Ga0213872_10000837 3300021361 Bacteria 22321
42 Ga0213872_10009734 3300021361 Unclassified 4597
43 Ga0209674_108326 3300025226 Bacteria 1237
44 Ga0209563_100025 3300025230 Bacteria 596456
45 Ga0209563_100030 3300025230 Bacteria 489259
46 Ga0207425_1000001 3300025245 Bacteria 2525432
47 Ga0209026_1014261 3300025250 Bacteria 1332
48 Ga0209148_1000011 3300025254 Bacteria 1196503
49 Ga0209129_1000003 3300025258 Bacteria 903689
50 Ga0209565_1000030 3300025263 Bacteria 325058
51 Ga0209565_1001520 3300025263 Bacteria 10031
52 Ga0209565_1020514 3300025263 Bacteria 1393
53 Ga0209455_1000006 3300025272 Bacteria 1196503
54 Ga0209455_1000483 3300025272 Bacteria 29472
55 Ga0209673_1000925 3300025273 Bacteria 37051
56 Ga0209564_1040213 3300025295 Bacteria 1273
57 Ga0209758_1000001 3300025297 Bacteria 1981790
58 Ga0209758_1000098 3300025297 Bacteria 230499
59 Ga0209758_1009388 3300025297 Bacteria 6090
60 Ga0209050_1000039 3300025298 Bacteria 410069
61 Ga0209050_1010451 3300025298 Bacteria 4575
62 Ga0209256_1000046 3300025299 Bacteria 325040
63 Ga0209256_1000186 3300025299 Bacteria 119070
64 Ga0209257_1000051 3300025304 Bacteria 434166
65 Ga0209257_1001591 3300025304 Bacteria 26038
66 Ga0207697_10093501 3300025315 Bacteria 1276
67 Ga0207647_10005172 3300025904 Bacteria 9597
68 Ga0207645_10065890 3300025907 Bacteria 2315
69 Ga0207706_10046366 3300025933 Bacteria 3848
70 Ga0207669_10002603 3300025937 Bacteria 7712
71 Ga0207668_10051414 3300025972 Bacteria 2846
72 Ga0207658_10009865 3300025986 Bacteria 6487
73 Ga0207678_10225453 3300026067 Bacteria 1604
74 Ga0207683_10048691 3300026121 Bacteria 3710
75 Ga0268266_10000002 3300028379 Bacteria 3059047
76 Ga0307517_10038973 3300028786 Bacteria 5238
77 Ga0307513_10014719 3300031456 Bacteria 9515
78 Ga0395899_0032535 3300037312 Bacteria 3918
79 Ga0395899_0059959 3300037312 Bacteria 2804
80 Ga0395905_0118018 3300037471 Bacteria 2494
81 Ga0395905_0132218 3300037471 Bacteria 2347
82 Ga0395905_0162763 3300037471 Bacteria 2097
83 Ga0395901_0035949 3300038443 Bacteria 5118
84 Ga0436361_0389628 3300039447 Bacteria 39329
85 Ga0436361_0454529 3300039447 Bacteria 33442
86 Ga0436361_0527259 3300039447 Unclassified 4862
87 Ga0436361_0897983 3300039447 Bacteria 8213
88 Ga0495617_000018 3300046452 Bacteria 248300
89 Ga0495617_001203 3300046452 Bacteria 11652
90 Ga0495591_000033 3300046458 Bacteria 171402
91 Ga0495638_0204125 3300046460 Bacteria 1114
92 Ga0495650_0000067 3300046471 Bacteria 269882
93 Ga0495650_0000158 3300046471 Bacteria 154681
94 Ga0495650_0003843 3300046471 Bacteria 10660
95 Ga0495650_0083243 3300046471 Bacteria 1230
96 Ga0495605_0003823 3300046474 Bacteria 8932
97 Ga0495605_0004034 3300046474 Bacteria 8669
98 Ga0495605_0016557 3300046474 Bacteria 3988
99 Ga0495584_0000801 3300046491 Bacteria 20681
100 Ga0495584_0008097 3300046491 Bacteria 5462
101 Ga0495584_0012031 3300046491 Bacteria 4424
102 Ga0495585_0004469 3300046492 Bacteria 9065
103 Ga0495585_0006219 3300046492 Bacteria 7439
104 Ga0495585_0047212 3300046492 Bacteria 2398
105 Ga0495585_0057236 3300046492 Bacteria 2152
106 Ga0495596_0001821 3300046500 Bacteria 11848
107 Ga0495596_0011591 3300046500 Bacteria 3795
108 Ga0495607_0000521 3300046501 Bacteria 37926
109 Ga0495607_0088573 3300046501 Bacteria 1682
110 Ga0495583_0000851 3300046506 Bacteria 37181
111 Ga0495583_0001096 3300046506 Bacteria 29972
112 Ga0495583_0005197 3300046506 Bacteria 8953
113 Ga0495583_0013788 3300046506 Bacteria 4486
114 Ga0495606_0000397 3300046507 Bacteria 73368
115 Ga0495606_0003998 3300046507 Bacteria 15056
116 Ga0495606_0075034 3300046507 Bacteria 2117
117 Ga0495606_0096159 3300046507 Bacteria 1812
118 Ga0495606_0249554 3300046507 Bacteria 985
119 Ga0495610_0000012 3300046512 Bacteria 517442
120 Ga0495610_0008104 3300046512 Bacteria 6873
121 Ga0495631_0019443 3300046518 Bacteria 3185
122 Ga0495631_0064018 3300046518 Bacteria 1592
123 Ga0495631_0114512 3300046518 Bacteria 1159
124 Ga0495631_0121658 3300046518 Bacteria 1122
125 Ga0495637_0000002 3300046520 Bacteria 629280
126 Ga0495637_0000051 3300046520 Bacteria 100076
127 Ga0495643_0002091 3300046522 Bacteria 16517
128 Ga0495643_0004109 3300046522 Bacteria 10349
129 Ga0495644_0009448 3300046523 Bacteria 3760
130 Ga0495644_0095764 3300046523 Bacteria 1121
131 Ga0495648_0000143 3300046524 Bacteria 85539
132 Ga0495648_0005070 3300046524 Bacteria 11056
133 Ga0495648_0006812 3300046524 Bacteria 9232
134 Ga0495648_0176865 3300046524 Bacteria 1088
135 Ga0495663_0001446 3300046525 Bacteria 7499
136 Ga0495642_0006991 3300046528 Bacteria 4329
137 Ga0495642_0033881 3300046528 Unclassified 2054
138 Ga0495654_0000011 3300046530 Bacteria 363172
139 Ga0495654_0002623 3300046530 Bacteria 11455
140 Ga0495654_0099440 3300046530 Bacteria 1341
141 Ga0495587_0100401 3300046536 Bacteria 1668
142 Ga0495609_0032771 3300046538 Bacteria 2359
143 Ga0495609_0052433 3300046538 Bacteria 1815
144 Ga0495597_0000252 3300046542 Bacteria 48772
145 Ga0495597_0000827 3300046542 Bacteria 24312
146 Ga0495597_0029780 3300046542 Bacteria 2491
147 Ga0495622_0141593 3300046557 Bacteria 1092
148 Ga0495633_0002068 3300046558 Bacteria 14445
149 Ga0495633_0021712 3300046558 Bacteria 3207
150 Ga0495668_0001668 3300046616 Bacteria 20628
151 Ga0495668_0120781 3300046616 Bacteria 1433
152 Ga0495668_0141848 3300046616 Bacteria 1315
153 Ga0495611_0001110 3300046648 Bacteria 14172
154 Ga0495611_0001583 3300046648 Bacteria 11133
155 Ga0495611_0008010 3300046648 Bacteria 4488
156 Ga0495611_0040018 3300046648 Bacteria 2088
157 Ga0495611_0089952 3300046648 Bacteria 1418
158 Ga0495625_0000150 3300046660 Bacteria 106314
159 Ga0495625_0040560 3300046660 Bacteria 3393
160 Ga0495625_0078710 3300046660 Bacteria 2301
161 Ga0495625_0240136 3300046660 Bacteria 1180
162 Ga0495625_0338415 3300046660 Bacteria 954
163 Ga0495661_0000461 3300046665 Bacteria 43183
164 Ga0495661_0010348 3300046665 Bacteria 6366
165 Ga0495661_0090063 3300046665 Bacteria 1747
166 Ga0495623_0007626 3300046679 Bacteria 7030
167 Ga0495669_0000520 3300046684 Bacteria 17474
168 Ga0495669_0030288 3300046684 Bacteria 2375
169 Ga0495669_0077661 3300046684 Bacteria 1520
170 Ga0495670_0000033 3300046691 Bacteria 81716
171 Ga0495670_0016936 3300046691 Bacteria 3582
172 Ga0495670_0370649 3300046691 Bacteria 772
173 Ga0495671_0047493 3300046692 Bacteria 2145
174 Ga0495649_0000024 3300046694 Bacteria 175713
175 Ga0495649_0047965 3300046694 Bacteria 2322
176 Ga0495649_0093168 3300046694 Bacteria 1604
177 Ga0495649_0177282 3300046694 Bacteria 1113
178 Ga0495649_0189435 3300046694 Bacteria 1071
179 Ga0495589_0000151 3300046794 Bacteria 64300
180 Ga0495589_0169050 3300046794 Bacteria 1039
181 Ga0495600_0000094 3300046809 Bacteria 48664
182 Ga0495660_0004725 3300046810 Bacteria 8221
183 Ga0495660_0047434 3300046810 Bacteria 2352
184 Ga0495660_0169222 3300046810 Bacteria 1065
185 Ga0495672_0000056 3300047320 Bacteria 223740
186 Ga0495683_0000017 3300047323 Bacteria 189599
187 Ga0495683_0002547 3300047323 Bacteria 10952
188 Ga0495683_0006317 3300047323 Bacteria 6479
189 Ga0495683_0044885 3300047323 Bacteria 2222
190 Ga0495683_0158412 3300047323 Bacteria 1048
191 Ga0495687_000098 3300047443 Bacteria 132403
192 Ga0495687_000455 3300047443 Bacteria 50452
193 Ga0495677_0004141 3300047445 Bacteria 5598
194 Ga0495679_004892 3300047446 Bacteria 6047
195 Ga0495679_066832 3300047446 Bacteria 1042
196 Ga0495679_066834 3300047446 Bacteria 1042
197 Ga0495673_0000003 3300047469 Bacteria 1491337
198 Ga0495673_0000050 3300047469 Bacteria 262267
199 Ga0495681_0012685 3300047470 Bacteria 4938
200 Ga0495681_0020634 3300047470 Bacteria 3571
201 Ga0495681_0099812 3300047470 Bacteria 1270
202 Ga0495686_0044955 3300047472 Bacteria 2795
203 Ga0495626_0001568 3300048091 Bacteria 17939
204 Ga0495626_0006422 3300048091 Bacteria 6695
205 Ga0495626_0018603 3300048091 Bacteria 3484
206 Ga0496102_0000077 3300048905 Bacteria 142501
207 Ga0496102_0000571 3300048905 Bacteria 39125
208 Ga0496103_0000403 3300048906 Bacteria 38378
209 Ga0496104_0012455 3300048907 Bacteria 7646
210 Ga0496105_0002058 3300048908 Bacteria 14540
211 Ga0496109_0034650 3300048912 Bacteria 4549
212 Ga0496109_0097736 3300048912 Bacteria 2721
213 Ga0496112_0288195 3300048915 Bacteria 1588
214 Ga0496112_0512415 3300048915 Bacteria 1135
215 Ga0496113_0005467 3300048916 Bacteria 7928
216 Ga0496113_0065307 3300048916 Bacteria 2754
217 Ga0496114_0005237 3300048917 Bacteria 10135
218 Ga0496115_0000131 3300048918 Bacteria 68111
219 Ga0496116_0003198 3300048919 Bacteria 16381
220 Ga0496117_0001521 3300048920 Bacteria 33156
221 Ga0496118_0001238 3300048921 Bacteria 39264
222 Ga0496119_0005690 3300048922 Bacteria 11822
223 Ga0496121_0000228 3300048924 Bacteria 120653
224 Ga0496122_0000299 3300048925 Bacteria 109780
225 Ga0496122_0005142 3300048925 Bacteria 15780
226 Ga0496122_0111951 3300048925 Bacteria 1789
227 Ga0496122_0128371 3300048925 Bacteria 1618
228 Ga0496122_0259361 3300048925 Bacteria 966
229 Ga0496123_0000959 3300048926 Bacteria 44656
230 Ga0496123_0042584 3300048926 Bacteria 3131
231 Ga0496123_0066441 3300048926 Bacteria 2284
232 Ga0496124_0000081 3300048927 Bacteria 208413
233 Ga0496124_0273997 3300048927 Bacteria 1234
234 Ga0496125_0000520 3300048928 Bacteria 66776
235 Ga0496125_0001128 3300048928 Bacteria 40779
236 Ga0496126_0001331 3300048929 Bacteria 39237
237 Ga0496126_0010255 3300048929 Bacteria 9846
238 Ga0495678_000048 3300049459 Bacteria 165744
239 Ga0495678_031015 3300049459 Bacteria 2233
240 Ga0495682_0013242 3300049460 Bacteria 3143
241 Ga0495682_0040857 3300049460 Bacteria 1700
242 Ga0501043_0066350 3300049579 Bacteria 2834
243 Ga0500610_0000076 3300053079 Bacteria 30101
244 Ga0500595_000094 3300053119 Bacteria 61463
245 Ga0500618_000052 3300053125 Bacteria 102436
246 Ga0500642_0004750 3300053130 Bacteria 4298
247 Ga0500586_005598 3300053145 Bacteria 3190
248 Ga0500636_0028263 3300053177 Bacteria 3313
249 Ga0500645_000002 3300053730 Bacteria 388892
250 Ga0500596_000084 3300053735 Bacteria 12721

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046474 Ga0495605_0016557 Ga0495605_0016557_219_950 200
2 3300046491 Ga0495584_0012031 Ga0495584_0012031_3533_4264 200
3 3300046492 Ga0495585_0047212 Ga0495585_0047212_322_1053 200
4 3300046500 Ga0495596_0011591 Ga0495596_0011591_1467_2198 200
5 3300046506 Ga0495583_0013788 Ga0495583_0013788_682_1413 200
6 3300046523 Ga0495644_0009448 Ga0495644_0009448_1341_2072 200
7 3300046524 Ga0495648_0176865 Ga0495648_0176865_145_876 200
8 3300046538 Ga0495609_0032771 Ga0495609_0032771_1335_2066 200
9 3300046648 Ga0495611_0040018 Ga0495611_0040018_583_1314 200
10 3300046684 Ga0495669_0077661 Ga0495669_0077661_131_862 200
11 3300046691 Ga0495670_0370649 Ga0495670_0370649_16_747 200
12 3300046794 Ga0495589_0169050 Ga0495589_0169050_118_849 200
13 3300046810 Ga0495660_0169222 Ga0495660_0169222_170_901 200
14 3300047323 Ga0495683_0158412 Ga0495683_0158412_153_884 200
15 3300049460 Ga0495682_0040857 Ga0495682_0040857_946_1677 200
16 3300046507 Ga0495606_0096159 Ga0495606_0096159_912_1643 207
17 3300038443 Ga0395901_0035949 Ga0395901_0035949_1085_1804 208
18 3300037471 Ga0395905_0132218 Ga0395905_0132218_1222_1971 211
19 3300046500 Ga0495596_0001821 Ga0495596_0001821_5831_6616 212
20 3300021361 Ga0213872_10000381 Ga0213872_1000038120 216
21 3300039447 Ga0436361_0389628 Ga0436361_0389628_19457_20224 216
22 3300025226 Ga0209674_108326 Ga0209674_1083262 217
23 3300037312 Ga0395899_0059959 Ga0395899_0059959_848_1579 224
24 3300037471 Ga0395905_0162763 Ga0395905_0162763_85_807 227
25 3300046542 Ga0495597_0029780 Ga0495597_0029780_355_1140 229
26 3300047323 Ga0495683_0006317 Ga0495683_0006317_5342_6127 229
27 3300048917 Ga0496114_0005237 Ga0496114_0005237_6503_7273 230
28 3300003323 rootH1_10206821 rootH1_102068213 231
29 3300048922 Ga0496119_0005690 Ga0496119_0005690_7789_8499 231
30 3300003322 rootL2_10008238 rootL2_100082383 232
31 3300003322 rootL2_10081301 rootL2_100813012 232
32 3300003323 rootH1_10273390 rootH1_102733902 232
33 3300003763 Ga0055529_1000581 Ga0055529_100058112 232
34 3300025272 Ga0209455_1000483 Ga0209455_100048312 232
35 3300046491 Ga0495584_0008097 Ga0495584_0008097_3087_3821 232
36 3300046648 Ga0495611_0008010 Ga0495611_0008010_696_1430 232
37 3300046684 Ga0495669_0000520 Ga0495669_0000520_13701_14435 232
38 3300046694 Ga0495649_0000024 Ga0495649_0000024_14116_14844 232
39 3300046694 Ga0495649_0047965 Ga0495649_0047965_1386_2120 232
40 3300047443 Ga0495687_000098 Ga0495687_000098_124064_124798 232
41 3300053079 Ga0500610_0000076 Ga0500610_0000076_26276_27010 232
42 3300053730 Ga0500645_000002 Ga0500645_000002_37576_38310 232
43 iso_pu_bacteria 2738541297 2738828396 232
44 iso_pu_bacteria 2738541357 2739152192 232
45 iso_pu_bacteria 2738543003 2739193787 232
46 iso_pu_bacteria 2738543026 2739320588 232
47 iso_pu_bacteria 2738543029 2739338504 232
48 iso_pu_bacteria 2808606418 2809143405 232
49 3300003215 JGI25153J46596_10000031 JGI25153J46596_100000318 233
50 3300025297 Ga0209758_1000001 Ga0209758_1000001441 233
51 3300047446 Ga0495679_004892 Ga0495679_004892_2663_3391 233
52 3300002773 JGI25152J39213_1000091 JGI25152J39213_100009112 234
53 3300002774 JGI25150J39212_1000068 JGI25150J39212_100006812 234
54 3300003215 JGI25153J46596_10004747 JGI25153J46596_100047475 234
55 3300003775 Ga0055524_1000665 Ga0055524_10006658 234
56 3300005262 Ga0065165_1018615 Ga0065165_10186153 234
57 3300025245 Ga0207425_1000001 Ga0207425_1000001539 234
58 3300025258 Ga0209129_1000003 Ga0209129_1000003539 234
59 3300025263 Ga0209565_1001520 Ga0209565_10015203 234
60 3300025263 Ga0209565_1020514 Ga0209565_10205142 234
61 3300025297 Ga0209758_1000098 Ga0209758_100009884 234
62 3300025299 Ga0209256_1000186 Ga0209256_100018665 234
63 3300037471 Ga0395905_0118018 Ga0395905_0118018_765_1496 234
64 3300046452 Ga0495617_000018 Ga0495617_000018_205740_206471 234
65 3300046458 Ga0495591_000033 Ga0495591_000033_48709_49443 234
66 3300046460 Ga0495638_0204125 Ga0495638_0204125_238_969 234
67 3300046471 Ga0495650_0000067 Ga0495650_0000067_223563_224294 234
68 3300046471 Ga0495650_0003843 Ga0495650_0003843_1707_2438 234
69 3300046471 Ga0495650_0083243 Ga0495650_0083243_389_1120 234
70 3300046474 Ga0495605_0003823 Ga0495605_0003823_2880_3611 234
71 3300046474 Ga0495605_0004034 Ga0495605_0004034_220_954 234
72 3300046491 Ga0495584_0000801 Ga0495584_0000801_1297_2031 234
73 3300046492 Ga0495585_0004469 Ga0495585_0004469_3734_4495 234
74 3300046492 Ga0495585_0006219 Ga0495585_0006219_5836_6567 234
75 3300046492 Ga0495585_0057236 Ga0495585_0057236_34_768 234
76 3300046501 Ga0495607_0000521 Ga0495607_0000521_3233_3967 234
77 3300046501 Ga0495607_0088573 Ga0495607_0088573_659_1390 234
78 3300046506 Ga0495583_0000851 Ga0495583_0000851_25685_26419 234
79 3300046507 Ga0495606_0249554 Ga0495606_0249554_81_812 234
80 3300046512 Ga0495610_0000012 Ga0495610_0000012_256233_256964 234
81 3300046512 Ga0495610_0008104 Ga0495610_0008104_4109_4843 234
82 3300046518 Ga0495631_0019443 Ga0495631_0019443_662_1447 234
83 3300046518 Ga0495631_0064018 Ga0495631_0064018_298_1029 234
84 3300046518 Ga0495631_0114512 Ga0495631_0114512_290_1021 234
85 3300046518 Ga0495631_0121658 Ga0495631_0121658_205_939 234
86 3300046520 Ga0495637_0000002 Ga0495637_0000002_397402_398136 234
87 3300046520 Ga0495637_0000051 Ga0495637_0000051_91042_91773 234
88 3300046522 Ga0495643_0004109 Ga0495643_0004109_4638_5369 234
89 3300046523 Ga0495644_0095764 Ga0495644_0095764_183_917 234
90 3300046524 Ga0495648_0005070 Ga0495648_0005070_7622_8353 234
91 3300046528 Ga0495642_0006991 Ga0495642_0006991_1948_2682 234
92 3300046530 Ga0495654_0000011 Ga0495654_0000011_135496_136227 234
93 3300046530 Ga0495654_0002623 Ga0495654_0002623_8418_9149 234
94 3300046530 Ga0495654_0099440 Ga0495654_0099440_447_1181 234
95 3300046538 Ga0495609_0052433 Ga0495609_0052433_660_1394 234
96 3300046542 Ga0495597_0000252 Ga0495597_0000252_34167_34898 234
97 3300046542 Ga0495597_0000827 Ga0495597_0000827_10914_11645 234
98 3300046557 Ga0495622_0141593 Ga0495622_0141593_164_895 234
99 3300046558 Ga0495633_0002068 Ga0495633_0002068_12784_13518 234
100 3300046616 Ga0495668_0001668 Ga0495668_0001668_19548_20279 234
101 3300046648 Ga0495611_0001110 Ga0495611_0001110_2759_3490 234
102 3300046648 Ga0495611_0001583 Ga0495611_0001583_8197_8931 234
103 3300046648 Ga0495611_0089952 Ga0495611_0089952_302_1033 234
104 3300046660 Ga0495625_0040560 Ga0495625_0040560_1326_2111 234
105 3300046660 Ga0495625_0078710 Ga0495625_0078710_1386_2117 234
106 3300046660 Ga0495625_0240136 Ga0495625_0240136_288_1019 234
107 3300046665 Ga0495661_0000461 Ga0495661_0000461_19952_20683 234
108 3300046665 Ga0495661_0010348 Ga0495661_0010348_1898_2629 234
109 3300046679 Ga0495623_0007626 Ga0495623_0007626_6005_6736 234
110 3300046684 Ga0495669_0030288 Ga0495669_0030288_356_1087 234
111 3300046691 Ga0495670_0016936 Ga0495670_0016936_411_1196 234
112 3300046794 Ga0495589_0000151 Ga0495589_0000151_45607_46338 234
113 3300046810 Ga0495660_0004725 Ga0495660_0004725_3911_4642 234
114 3300046810 Ga0495660_0047434 Ga0495660_0047434_678_1412 234
115 3300047320 Ga0495672_0000056 Ga0495672_0000056_27997_28731 234
116 3300047323 Ga0495683_0000017 Ga0495683_0000017_94749_95483 234
117 3300047323 Ga0495683_0044885 Ga0495683_0044885_596_1327 234
118 3300047446 Ga0495679_066832 Ga0495679_066832_52_783 234
119 3300047446 Ga0495679_066834 Ga0495679_066834_260_991 234
120 3300047469 Ga0495673_0000003 Ga0495673_0000003_416823_417554 234
121 3300047469 Ga0495673_0000050 Ga0495673_0000050_41245_41976 234
122 3300047470 Ga0495681_0020634 Ga0495681_0020634_1732_2517 234
123 3300047470 Ga0495681_0099812 Ga0495681_0099812_473_1207 234
124 3300047472 Ga0495686_0044955 Ga0495686_0044955_1223_1957 234
125 3300048091 Ga0495626_0001568 Ga0495626_0001568_15457_16188 234
126 3300048091 Ga0495626_0006422 Ga0495626_0006422_3362_4096 234
127 3300048091 Ga0495626_0018603 Ga0495626_0018603_2600_3334 234
128 3300048905 Ga0496102_0000077 Ga0496102_0000077_124490_125221 234
129 3300048912 Ga0496109_0034650 Ga0496109_0034650_1705_2436 234
130 3300048915 Ga0496112_0288195 Ga0496112_0288195_814_1545 234
131 3300048916 Ga0496113_0005467 Ga0496113_0005467_5379_6110 234
132 3300048925 Ga0496122_0000299 Ga0496122_0000299_85231_85962 234
133 3300048925 Ga0496122_0111951 Ga0496122_0111951_943_1674 234
134 3300048925 Ga0496122_0128371 Ga0496122_0128371_697_1428 234
135 3300048925 Ga0496122_0259361 Ga0496122_0259361_221_952 234
136 3300048926 Ga0496123_0000959 Ga0496123_0000959_23800_24531 234
137 3300048926 Ga0496123_0066441 Ga0496123_0066441_930_1661 234
138 3300048927 Ga0496124_0273997 Ga0496124_0273997_306_1037 234
139 3300048928 Ga0496125_0000520 Ga0496125_0000520_60565_61296 234
140 3300048929 Ga0496126_0010255 Ga0496126_0010255_5814_6545 234
141 3300049459 Ga0495678_000048 Ga0495678_000048_82198_82932 234
142 3300049459 Ga0495678_031015 Ga0495678_031015_479_1210 234
143 3300049460 Ga0495682_0013242 Ga0495682_0013242_2346_3080 234
144 3300053125 Ga0500618_000052 Ga0500618_000052_44944_45675 234
145 3300053145 Ga0500586_005598 Ga0500586_005598_1973_2704 234
146 3300031456 Ga0307513_10014719 Ga0307513_100147196 236
147 3300003759 Ga0055525_1000013 Ga0055525_1000013131 237
148 3300003791 Ga0055530_10000074 Ga0055530_1000007413 237
149 3300003794 Ga0055531_10000253 Ga0055531_1000025313 237
150 3300025230 Ga0209563_100025 Ga0209563_100025455 237
151 3300025298 Ga0209050_1000039 Ga0209050_1000039188 237
152 3300025304 Ga0209257_1000051 Ga0209257_1000051188 237
153 3300047470 Ga0495681_0012685 Ga0495681_0012685_3881_4609 237
154 iso_pu_bacteria 2671180139 2671695517 237
155 3300003215 JGI25153J46596_10011048 JGI25153J46596_100110483 238
156 3300003215 JGI25153J46596_10021045 JGI25153J46596_100210452 238
157 3300003323 rootH1_10185092 rootH1_101850922 238
158 3300003773 Ga0055537_1000161 Ga0055537_10001613 238
159 3300003775 Ga0055524_1000110 Ga0055524_100011078 238
160 3300005262 Ga0065165_1002695 Ga0065165_10026958 238
161 3300005614 Ga0068856_100055888 Ga0068856_1000558882 238
162 3300021361 Ga0213872_10009734 Ga0213872_100097343 238
163 3300025263 Ga0209565_1000030 Ga0209565_1000030101 238
164 3300025273 Ga0209673_1000925 Ga0209673_100092510 238
165 3300025295 Ga0209564_1040213 Ga0209564_10402131 238
166 3300025297 Ga0209758_1009388 Ga0209758_10093885 238
167 3300025298 Ga0209050_1010451 Ga0209050_10104515 238
168 3300025299 Ga0209256_1000046 Ga0209256_1000046184 238
169 3300025304 Ga0209257_1001591 Ga0209257_100159116 238
170 3300028786 Ga0307517_10038973 Ga0307517_100389735 238
171 3300039447 Ga0436361_0527259 Ga0436361_0527259_3373_4116 238
172 3300046471 Ga0495650_0000158 Ga0495650_0000158_19813_20544 238
173 3300046506 Ga0495583_0001096 Ga0495583_0001096_4332_5090 238
174 3300046536 Ga0495587_0100401 Ga0495587_0100401_266_1024 238
175 3300046558 Ga0495633_0021712 Ga0495633_0021712_2320_3078 238
176 3300046665 Ga0495661_0090063 Ga0495661_0090063_822_1580 238
177 3300046809 Ga0495600_0000094 Ga0495600_0000094_40045_40803 238
178 3300048905 Ga0496102_0000571 Ga0496102_0000571_14519_15253 238
179 3300048906 Ga0496103_0000403 Ga0496103_0000403_23894_24628 238
180 3300048907 Ga0496104_0012455 Ga0496104_0012455_4659_5393 238
181 3300048908 Ga0496105_0002058 Ga0496105_0002058_12257_12991 238
182 3300048918 Ga0496115_0000131 Ga0496115_0000131_13640_14374 238
183 3300048919 Ga0496116_0003198 Ga0496116_0003198_1749_2483 238
184 3300048920 Ga0496117_0001521 Ga0496117_0001521_23857_24591 238
185 3300048921 Ga0496118_0001238 Ga0496118_0001238_23962_24696 238
186 3300048924 Ga0496121_0000228 Ga0496121_0000228_13677_14411 238
187 3300048927 Ga0496124_0000081 Ga0496124_0000081_14569_15303 238
188 3300048929 Ga0496126_0001331 Ga0496126_0001331_23935_24669 238
189 3300053119 Ga0500595_000094 Ga0500595_000094_10627_11385 238
190 3300053177 Ga0500636_0028263 Ga0500636_0028263_2068_2826 238
191 3300001989 JGI24739J22299_10002478 JGI24739J22299_100024787 239
192 3300001990 JGI24737J22298_10055340 JGI24737J22298_100553402 239
193 3300003322 rootL2_10133019 rootL2_101330192 239
194 3300003759 Ga0055525_1000012 Ga0055525_1000012285 239
195 3300003762 Ga0055542_1000115 Ga0055542_100011512 239
196 3300003763 Ga0055529_1000052 Ga0055529_1000052171 239
197 3300005328 Ga0070676_10039738 Ga0070676_100397383 239
198 3300005335 Ga0070666_10230032 Ga0070666_102300322 239
199 3300005344 Ga0070661_100028884 Ga0070661_1000288843 239
200 3300005347 Ga0070668_100060152 Ga0070668_1000601523 239
201 3300005356 Ga0070674_100003829 Ga0070674_1000038295 239
202 3300005367 Ga0070667_100080660 Ga0070667_1000806602 239
203 3300005455 Ga0070663_100192414 Ga0070663_1001924142 239
204 3300005456 Ga0070678_100120642 Ga0070678_1001206422 239
205 3300005457 Ga0070662_100031666 Ga0070662_1000316662 239
206 3300005548 Ga0070665_100000810 Ga0070665_10000081021 239
207 3300006186 Ga0075369_10072371 Ga0075369_100723712 239
208 3300006195 Ga0075366_10026740 Ga0075366_100267403 239
209 3300021361 Ga0213872_10000837 Ga0213872_100008372 239
210 3300025230 Ga0209563_100030 Ga0209563_100030165 239
211 3300025250 Ga0209026_1014261 Ga0209026_10142612 239
212 3300025254 Ga0209148_1000011 Ga0209148_1000011376 239
213 3300025272 Ga0209455_1000006 Ga0209455_1000006818 239
214 3300025315 Ga0207697_10093501 Ga0207697_100935012 239
215 3300025904 Ga0207647_10005172 Ga0207647_100051728 239
216 3300025907 Ga0207645_10065890 Ga0207645_100658902 239
217 3300025933 Ga0207706_10046366 Ga0207706_100463662 239
218 3300025937 Ga0207669_10002603 Ga0207669_100026034 239
219 3300025972 Ga0207668_10051414 Ga0207668_100514143 239
220 3300025986 Ga0207658_10009865 Ga0207658_100098654 239
221 3300026067 Ga0207678_10225453 Ga0207678_102254532 239
222 3300026121 Ga0207683_10048691 Ga0207683_100486912 239
223 3300028379 Ga0268266_10000002 Ga0268266_100000021750 239
224 3300037312 Ga0395899_0032535 Ga0395899_0032535_1980_2801 239
225 3300039447 Ga0436361_0454529 Ga0436361_0454529_28565_29323 239
226 3300039447 Ga0436361_0897983 Ga0436361_0897983_1304_2050 239
227 3300046452 Ga0495617_001203 Ga0495617_001203_3648_4403 239
228 3300046506 Ga0495583_0005197 Ga0495583_0005197_3474_4208 239
229 3300046507 Ga0495606_0000397 Ga0495606_0000397_31779_32534 239
230 3300046507 Ga0495606_0003998 Ga0495606_0003998_9112_9846 239
231 3300046507 Ga0495606_0075034 Ga0495606_0075034_1330_2091 239
232 3300046522 Ga0495643_0002091 Ga0495643_0002091_7333_8094 239
233 3300046524 Ga0495648_0000143 Ga0495648_0000143_1255_1989 239
234 3300046524 Ga0495648_0006812 Ga0495648_0006812_6608_7378 239
235 3300046525 Ga0495663_0001446 Ga0495663_0001446_6520_7341 239
236 3300046528 Ga0495642_0033881 Ga0495642_0033881_852_1613 239
237 3300046616 Ga0495668_0120781 Ga0495668_0120781_363_1097 239
238 3300046616 Ga0495668_0141848 Ga0495668_0141848_97_858 239
239 3300046660 Ga0495625_0000150 Ga0495625_0000150_56959_57693 239
240 3300046660 Ga0495625_0338415 Ga0495625_0338415_148_909 239
241 3300046691 Ga0495670_0000033 Ga0495670_0000033_63891_64625 239
242 3300046692 Ga0495671_0047493 Ga0495671_0047493_1286_2035 239
243 3300046694 Ga0495649_0093168 Ga0495649_0093168_808_1569 239
244 3300046694 Ga0495649_0177282 Ga0495649_0177282_321_1055 239
245 3300046694 Ga0495649_0189435 Ga0495649_0189435_78_827 239
246 3300047323 Ga0495683_0002547 Ga0495683_0002547_3115_3936 239
247 3300047443 Ga0495687_000455 Ga0495687_000455_8777_9538 239
248 3300047445 Ga0495677_0004141 Ga0495677_0004141_3053_3814 239
249 3300048912 Ga0496109_0097736 Ga0496109_0097736_1950_2684 239
250 3300048915 Ga0496112_0512415 Ga0496112_0512415_160_894 239
251 3300048916 Ga0496113_0065307 Ga0496113_0065307_809_1543 239
252 3300048925 Ga0496122_0005142 Ga0496122_0005142_3395_4129 239
253 3300048926 Ga0496123_0042584 Ga0496123_0042584_1371_2105 239
254 3300048928 Ga0496125_0001128 Ga0496125_0001128_31143_31877 239
255 3300049579 Ga0501043_0066350 Ga0501043_0066350_1683_2417 239
256 3300053130 Ga0500642_0004750 Ga0500642_0004750_3508_4242 239
257 3300053735 Ga0500596_000084 Ga0500596_000084_11504_12328 239

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03932

CutC

CutC family

12

212

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bdq-assembly1.cif.gz_B crystal structure of the putative copper homeostasis protein cutc from streptococcus agalactiae, northeast strucural genomics target sar15. 0.9447 3 195
3iwp-assembly5.cif.gz_D crystal structure of human copper homeostasis protein cutc 0.9349 3 234
3iwp-assembly4.cif.gz_B crystal structure of human copper homeostasis protein cutc 0.9332 1 233
3iwp-assembly4.cif.gz_A crystal structure of human copper homeostasis protein cutc 0.9266 1 235
1x8c-assembly1.cif.gz_A crystal structure of the semet-derivative copper homeostasis protein (cutcm) with calcium binding from shigella flexneri 2a str. 301 0.925 3 237
ID Description Score Start End Superfamily
af_P34630_10_248_3.20.20.380 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain 0.9539 4 232 3.20.20.380
af_Q4E0C3_1_211_3.20.20.380 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain 0.9451 3 195 3.20.20.380
af_Q9D8X1_24_272_3.20.20.380 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain 0.9313 3 234 3.20.20.380
af_P67826_1_248_3.20.20.380 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain 0.9228 3 237 3.20.20.380
2bdqB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain 0.9206 4 195 3.20.20.380
ID Description Score Start End GO Terms
AF-A0A0C9N6G7-F1-model_v4 PF03932 family protein CutC 0.9879 1 233 GO:0005507
GO:0005737
AF-A0A847X024-F1-model_v4 Copper homeostasis protein cutC homolog 0.9828 3 195 GO:0005507
AF-A0A351VCH7-F1-model_v4 Copper homeostasis protein cutC homolog 0.9826 2 185 GO:0005507
AF-A0A3D3SLZ3-F1-model_v4 deleted 0.9815 4 122
AF-A0A355FNW3-F1-model_v4 Copper homeostasis protein cutC homolog 0.981 1 181 GO:0005507

Feature Viewer

pLDDT pTM Quality
94.77 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map