F366847

General Info

Members Datasets Scaffolds Average Seq Length
256 166 512 181

Family's Representative Sequence

Representative Sequence 3300049574|Ga0501038_0064993|Ga0501038_0064993_2382_2993
Length 203
Sequence VCPPHDRAVRRLARAVHPEEFPLAIQPIRLFGDPVLRKPAIEVVDFDKELRTLIADLTDTMLAAPGAGLAAPQIGVGLRAFTWNVDDGVGHLINPVLDLSEEIQDGPEGCLSLPELTYDCKRALSVVAKGFNMYGDPVTIEGTELLARAIQHETDHLDGVLFIDRLGTEARKAAMKEIRESEWFGLERPTVKVSPHRTGGLGL

Samples

Sample ID Description Type Environment
1 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
13 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
14 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
18 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
19 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
20 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
21 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
22 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
24 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
25 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
26 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
27 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
28 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
44 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
47 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
48 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
49 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
50 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
51 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
52 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
53 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
54 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
55 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
56 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
57 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
58 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
59 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
60 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
61 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
62 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
63 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
64 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
65 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
66 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
67 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
68 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
69 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
70 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
71 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
72 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
73 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
74 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
75 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
76 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
77 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
78 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
79 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
80 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
81 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
82 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
83 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
84 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
85 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
86 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
87 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
88 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
89 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
90 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
91 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
92 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
93 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
94 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
95 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
96 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
97 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
98 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
99 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
100 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
101 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
102 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
103 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
104 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
105 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
106 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
109 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
110 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
111 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
112 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
113 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
114 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
115 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
116 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
130 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
131 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
132 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
133 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
134 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
135 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
136 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
137 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
138 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
142 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
143 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
144 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
145 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
146 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
147 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
148 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
149 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
150 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
151 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
152 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
153 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
154 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
155 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
156 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
157 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
158 2643221576 Nocardioides sp. Root614 Isolate Unclassified
159 2643221590 Nocardioides sp. Root682 Isolate Unclassified
160 2643221641 Nocardioides sp. Root122 Isolate Unclassified
161 2739367898 Nocardioides sp. CF479 Isolate Unclassified
162 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
163 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
164 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
165 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
166 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.53
Metatranscriptomes 1.95
Isolates 3.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.97
Nodule 0.39
Rhizoplane 8.98
Rhizosphere 67.58
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501038_0064993 3300049574 Bacteria 3110
2 LJQas_1002812 3300000549 Bacteria 2387
3 Ga0070658_10012697 3300005327 Bacteria 6755
4 Ga0070680_100001360 3300005336 Bacteria 17685
5 Ga0068868_100377099 3300005338 Bacteria 1220
6 Ga0070688_100390425 3300005365 Bacteria 1028
7 Ga0070667_100014986 3300005367 Bacteria 6405
8 Ga0070700_100074898 3300005441 Bacteria 2170
9 Ga0070708_100856039 3300005445 Bacteria 854
10 Ga0070681_10008153 3300005458 Bacteria 10254
11 Ga0070681_10252446 3300005458 Bacteria 1676
12 Ga0070679_100023515 3300005530 Bacteria 6032
13 Ga0068857_100563769 3300005577 Bacteria 1074
14 Ga0068851_10149939 3300005834 Bacteria 1274
15 Ga0068860_100000696 3300005843 Bacteria 38651
16 Ga0081455_10020478 3300005937 Bacteria 6224
17 Ga0081539_10174475 3300005985 Bacteria 1013
18 Ga0075365_10052900 3300006038 Bacteria 2688
19 Ga0075365_10082582 3300006038 Bacteria 2179
20 Ga0075365_10093191 3300006038 Bacteria 2054
21 Ga0075365_10121001 3300006038 Bacteria 1806
22 Ga0075365_10137113 3300006038 Bacteria 1697
23 Ga0075365_10217916 3300006038 Bacteria 1339
24 Ga0075365_10263936 3300006038 Bacteria 1211
25 Ga0075365_10264044 3300006038 Bacteria 1210
26 Ga0075365_10394572 3300006038 Bacteria 976
27 Ga0075365_10504652 3300006038 Bacteria 855
28 Ga0075365_10704047 3300006038 Bacteria 713
29 Ga0075363_100000197 3300006048 Bacteria 16386
30 Ga0075364_10007920 3300006051 Bacteria 6329
31 Ga0075364_10012201 3300006051 Bacteria 5249
32 Ga0075364_10221223 3300006051 Bacteria 1285
33 Ga0075364_10338637 3300006051 Bacteria 1025
34 Ga0075367_10107662 3300006178 Bacteria 1708
35 Ga0075370_10006105 3300006353 Bacteria 6041
36 Ga0075370_10018050 3300006353 Bacteria 3822
37 Ga0075370_10502173 3300006353 Bacteria 732
38 Ga0114129_11128714 3300009147 Bacteria 980
39 Ga0105248_10718865 3300009177 Bacteria 1127
40 Ga0105249_10371281 3300009553 Bacteria 1454
41 Ga0206351_10696824 3300020077 Bacteria 797
42 Ga0206354_10503493 3300020081 Bacteria 1101
43 Ga0206353_10365872 3300020082 Bacteria 1130
44 Ga0206353_11029603 3300020082 Bacteria 19172
45 Ga0207688_10237205 3300025901 Bacteria 1102
46 Ga0207705_10002849 3300025909 Bacteria 13227
47 Ga0207707_10001139 3300025912 Bacteria 25193
48 Ga0207707_10294174 3300025912 Bacteria 1405
49 Ga0207660_10002139 3300025917 Bacteria 13117
50 Ga0207652_10000651 3300025921 Bacteria 34132
51 Ga0207694_10945831 3300025924 Bacteria 729
52 Ga0207679_10549166 3300025945 Bacteria 1036
53 Ga0207667_10610119 3300025949 Bacteria 1099
54 Ga0207658_10457041 3300025986 Bacteria 1131
55 Ga0207677_10301368 3300026023 Bacteria 1324
56 Ga0207678_10249081 3300026067 Bacteria 1521
57 Ga0207702_11242811 3300026078 Bacteria 739
58 Ga0207674_10736121 3300026116 Bacteria 952
59 Ga0207675_100530900 3300026118 Bacteria 1174
60 Ga0207698_10288548 3300026142 Bacteria 1521
61 Ga0209813_10125338 3300027866 Bacteria 898
62 Ga0268265_11896879 3300028380 Bacteria 603
63 Ga0268264_10000697 3300028381 Bacteria 39075
64 Ga0316176_1071433 3300030732 Bacteria 1037
65 Ga0316183_1128797 3300030742 Bacteria 682
66 Ga0307513_10503670 3300031456 Bacteria 928
67 Ga0307408_100340864 3300031548 Bacteria 1269
68 Ga0316576_10006224 3300031727 Bacteria 7404
69 Ga0316578_10102997 3300031728 Bacteria 1712
70 Ga0307405_10061087 3300031731 Bacteria 2381
71 Ga0307405_10087355 3300031731 Bacteria 2055
72 Ga0307405_10423646 3300031731 Bacteria 1048
73 Ga0307413_11153299 3300031824 Bacteria 672
74 Ga0307406_10245313 3300031901 Bacteria 1346
75 Ga0307407_10053780 3300031903 Bacteria 2318
76 Ga0307407_10159480 3300031903 Bacteria 1475
77 Ga0307412_10319478 3300031911 Bacteria 1235
78 Ga0307409_100002918 3300031995 Bacteria 9084
79 Ga0307409_100396893 3300031995 Bacteria 1316
80 Ga0307409_100477257 3300031995 Bacteria 1209
81 Ga0307409_100491323 3300031995 Bacteria 1193
82 Ga0307409_100946691 3300031995 Bacteria 877
83 Ga0307409_101083632 3300031995 Bacteria 822
84 Ga0307416_100003189 3300032002 Bacteria 9606
85 Ga0307416_100314348 3300032002 Bacteria 1565
86 Ga0307414_10190848 3300032004 Bacteria 1658
87 Ga0307415_100003367 3300032126 Bacteria 8125
88 Ga0307415_100243017 3300032126 Bacteria 1457
89 Ga0307415_100595195 3300032126 Bacteria 983
90 Ga0316574_0197363 3300035398 Bacteria 1293
91 Ga0316582_0395403 3300036647 Bacteria 952
92 Ga0316584_0020534 3300036712 Bacteria 4790
93 Ga0395900_0009238 3300037418 Bacteria 10110
94 Ga0436364_0133695 3300037853 Bacteria 959
95 Ga0395901_0019613 3300038443 Bacteria 6912
96 Ga0395901_0520942 3300038443 Bacteria 1208
97 Ga0451787_554511 3300041441 Bacteria 744
98 Ga0451789_1169151 3300041443 Bacteria 676
99 Ga0451791_0511752 3300041451 Bacteria 1325
100 Ga0451795_0526443 3300041456 Bacteria 642
101 Ga0451802_0079481 3300041460 Bacteria 1235
102 Ga0451802_0619996 3300041460 Bacteria 854
103 Ga0451843_0296373 3300041509 Bacteria 1117
104 Ga0451853_2287133 3300041512 Bacteria 675
105 Ga0466969_0013761 3300044656 Bacteria 4260
106 Ga0466972_0106942 3300044658 Bacteria 1323
107 Ga0466965_0103557 3300044683 Bacteria 1457
108 Ga0466966_0013323 3300044684 Bacteria 5443
109 Ga0466961_0010469 3300044693 Bacteria 5917
110 Ga0466964_0253028 3300044706 Bacteria 869
111 Ga0466971_0010631 3300044719 Bacteria 4024
112 Ga0466970_0003311 3300044765 Bacteria 7829
113 Ga0466957_0171999 3300044842 Bacteria 1411
114 Ga0466957_0637804 3300044842 Bacteria 748
115 Ga0466960_0000704 3300044901 Bacteria 11646
116 Ga0466960_0140443 3300044901 Bacteria 1283
117 Ga0466959_0020878 3300045049 Bacteria 4826
118 Ga0466967_0378049 3300045976 Bacteria 1375
119 Ga0466967_1066092 3300045976 Bacteria 805
120 Ga0495629_0163663 3300046459 Bacteria 1545
121 Ga0495582_0274362 3300046473 Bacteria 968
122 Ga0495639_0225236 3300046475 Bacteria 923
123 Ga0495664_0207034 3300046477 Bacteria 1188
124 Ga0495594_0476572 3300046499 Bacteria 709
125 Ga0495618_0044993 3300046514 Bacteria 2784
126 Ga0495640_0006803 3300046533 Bacteria 9013
127 Ga0495667_0021802 3300046559 Bacteria 4321
128 Ga0495634_0024502 3300046642 Bacteria 4233
129 Ga0495634_0367720 3300046642 Bacteria 859
130 Ga0495625_0296823 3300046660 Bacteria 1035
131 Ga0495657_0007933 3300046675 Bacteria 8141
132 Ga0495658_0032235 3300046683 Bacteria 2860
133 Ga0495613_0005019 3300046689 Bacteria 9940
134 Ga0495613_0282493 3300046689 Bacteria 1152
135 Ga0495613_0341818 3300046689 Bacteria 1029
136 Ga0495600_0090180 3300046809 Bacteria 1999
137 Ga0495581_0086082 3300047315 Bacteria 1822
138 Ga0495604_0010341 3300047317 Bacteria 7390
139 Ga0495676_0002182 3300047321 Bacteria 17334
140 Ga0496100_0313194 3300048903 Bacteria 1177
141 Ga0496101_0032854 3300048904 Bacteria 3656
142 Ga0496102_0640724 3300048905 Bacteria 986
143 Ga0496104_0399904 3300048907 Bacteria 1286
144 Ga0496106_0037764 3300048909 Bacteria 3613
145 Ga0496106_0403234 3300048909 Bacteria 1099
146 Ga0496107_0097076 3300048910 Bacteria 2157
147 Ga0496108_0408199 3300048911 Bacteria 1186
148 Ga0496108_0635944 3300048911 Bacteria 928
149 Ga0496109_0255505 3300048912 Bacteria 1650
150 Ga0496109_0396628 3300048912 Bacteria 1304
151 Ga0496110_0866365 3300048913 Bacteria 809
152 Ga0496112_0226067 3300048915 Bacteria 1827
153 Ga0496113_0163583 3300048916 Bacteria 1760
154 Ga0496114_0099382 3300048917 Bacteria 2482
155 Ga0496114_0223441 3300048917 Bacteria 1653
156 Ga0496114_0248584 3300048917 Bacteria 1565
157 Ga0496124_0262867 3300048927 Bacteria 1269
158 Ga0501318_064071 3300049534 Bacteria 569
159 Ga0501031_0083416 3300049568 Bacteria 2083
160 Ga0501031_0126975 3300049568 Bacteria 1666
161 Ga0501031_0127015 3300049568 Bacteria 1666
162 Ga0501031_0802666 3300049568 Bacteria 603
163 Ga0501032_0005140 3300049569 Bacteria 9761
164 Ga0501032_0152523 3300049569 Bacteria 1519
165 Ga0501033_0091162 3300049570 Bacteria 2229
166 Ga0501034_0014658 3300049571 Bacteria 8070
167 Ga0501034_0123838 3300049571 Bacteria 2571
168 Ga0501036_0007661 3300049572 Bacteria 8815
169 Ga0501036_0164166 3300049572 Bacteria 1872
170 Ga0501036_0661640 3300049572 Bacteria 864
171 Ga0501038_0105939 3300049574 Bacteria 2335
172 Ga0501038_0247422 3300049574 Bacteria 1413
173 Ga0501038_0440222 3300049574 Bacteria 1004
174 Ga0501039_0045127 3300049575 Bacteria 3404
175 Ga0501039_0062539 3300049575 Bacteria 2884
176 Ga0501039_0077040 3300049575 Bacteria 2593
177 Ga0501039_0079827 3300049575 Bacteria 2546
178 Ga0501039_0301868 3300049575 Bacteria 1259
179 Ga0501040_0205457 3300049576 Bacteria 1399
180 Ga0501041_0644557 3300049577 Bacteria 677
181 Ga0501042_0022820 3300049578 Bacteria 4373
182 Ga0501042_0109610 3300049578 Bacteria 1988
183 Ga0501043_0062573 3300049579 Bacteria 2922
184 Ga0501043_0315970 3300049579 Bacteria 1191
185 Ga0501047_0002800 3300049581 Bacteria 16557
186 Ga0501047_0309233 3300049581 Bacteria 1421
187 Ga0501048_0217495 3300049582 Bacteria 1355
188 Ga0501067_0013469 3300049583 Bacteria 4532
189 Ga0501067_0013500 3300049583 Bacteria 4526
190 Ga0501067_0020721 3300049583 Bacteria 3638
191 Ga0501068_0702707 3300049584 Bacteria 661
192 Ga0501069_0020426 3300049585 Bacteria 3589
193 Ga0501069_0344844 3300049585 Bacteria 877
194 Ga0501070_0153231 3300049586 Bacteria 1901
195 Ga0501070_0332550 3300049586 Bacteria 1235
196 Ga0501070_0357435 3300049586 Bacteria 1185
197 Ga0501070_0665300 3300049586 Bacteria 826
198 Ga0501071_0238152 3300049587 Bacteria 1372
199 Ga0501071_0632796 3300049587 Bacteria 823
200 Ga0501072_0143608 3300049588 Bacteria 1903
201 Ga0501073_0371953 3300049589 Bacteria 987
202 Ga0501074_0386652 3300049590 Bacteria 993
203 Ga0501074_0613211 3300049590 Bacteria 769
204 Ga0501079_0190023 3300049741 Bacteria 1603
205 Ga0501080_0218940 3300049742 Bacteria 1743
206 Ga0501035_0010118 3300049822 Bacteria 8755
207 Ga0501035_0019234 3300049822 Bacteria 6287
208 Ga0501035_0042196 3300049822 Bacteria 4115
209 Ga0501044_0001722 3300049823 Bacteria 25608
210 Ga0501044_0185309 3300049823 Bacteria 2047
211 Ga0501044_0328512 3300049823 Bacteria 1452
212 Ga0501045_0079028 3300049824 Bacteria 2425
213 Ga0501045_0335590 3300049824 Bacteria 1125
214 Ga0501045_0803415 3300049824 Bacteria 693
215 nmdc:mga03n38_36508_c1 3300050490 Bacteria 2113
216 nmdc:mga00v17_198975_c1 3300050491 Bacteria 1295
217 nmdc:mga00v17_385701_c1 3300050491 Bacteria 911
218 nmdc:mga00v17_4230_c1 3300050491 Bacteria 7448
219 nmdc:mga00v17_98081_c1 3300050491 Bacteria 1847
220 nmdc:mga0yw44_1037692_c1 3300050492 Bacteria 555
221 nmdc:mga0yw44_104348_c1 3300050492 Bacteria 1809
222 nmdc:mga0yw44_140836_c1 3300050492 Bacteria 1567
223 nmdc:mga0yw44_31647_c1 3300050492 Bacteria 3078
224 nmdc:mga0yw44_61235_c1 3300050492 Bacteria 2308
225 nmdc:mga0yw44_72425_c1 3300050492 Bacteria 2142
226 nmdc:mga06z11_204896_c1 3300050494 Bacteria 1147
227 nmdc:mga06z11_213705_c1 3300050494 Bacteria 1125
228 nmdc:mga06z11_317874_c1 3300050494 Bacteria 928
229 nmdc:mga06z11_63082_c1 3300050494 Bacteria 1938
230 nmdc:mga04h51_109428_c1 3300050495 Bacteria 1017
231 nmdc:mga07m45_3230_c1 3300050496 Bacteria 7826
232 nmdc:mga07m45_325203_c1 3300050496 Bacteria 894
233 nmdc:mga07m45_44772_c1 3300050496 Bacteria 2484
234 nmdc:mga07m45_531809_c1 3300050496 Bacteria 680
235 Ga0495601_0079716 3300053077 Bacteria 2100
236 Ga0495619_0207678 3300053085 Bacteria 1356
237 Ga0500644_0129448 3300053088 Bacteria 992
238 Ga0500641_0326519 3300053096 Bacteria 623
239 Ga0500553_107030 3300053101 Bacteria 1187
240 Ga0500554_170155 3300053102 Bacteria 734
241 Ga0500573_0097010 3300053140 Bacteria 1661
242 Ga0501084_0207152 3300054114 Bacteria 1655
243 Ga0466962_0002669 3300061719 Bacteria 8488
244 Ga0530510_0270497 3300061734 Bacteria 1268
245 Ga0530510_0417641 3300061734 Bacteria 1012
246 Ga0530510_0418482 3300061734 Bacteria 1011
247 Ga0530510_0982152 3300061734 Bacteria 646
248 2643891679 2643221576 Bacteria 5214352
249 2643960727 2643221590 Bacteria 5214697
250 2644230356 2643221641 Bacteria 4490190
251 2740168971 2739367898 Bacteria 4367674
252 2774392336 2773857762 Bacteria 5971770
253 2809196145 2808606439 Bacteria 5952208
254 2812351731 2811994878 Bacteria 5992952
255 2855391109 2855386786 Bacteria 4752232
256 8054611196 8054609563 Bacteria 5170090
257 Ga0501038_0064993
258 LJQas_1002812
259 Ga0070658_10012697
260 Ga0070680_100001360
261 Ga0068868_100377099
262 Ga0070688_100390425
263 Ga0070667_100014986
264 Ga0070700_100074898
265 Ga0070708_100856039
266 Ga0070681_10008153
267 Ga0070681_10252446
268 Ga0070679_100023515
269 Ga0068857_100563769
270 Ga0068851_10149939
271 Ga0068860_100000696
272 Ga0081455_10020478
273 Ga0081539_10174475
274 Ga0075365_10052900
275 Ga0075365_10082582
276 Ga0075365_10093191
277 Ga0075365_10121001
278 Ga0075365_10137113
279 Ga0075365_10217916
280 Ga0075365_10263936
281 Ga0075365_10264044
282 Ga0075365_10394572
283 Ga0075365_10504652
284 Ga0075365_10704047
285 Ga0075363_100000197
286 Ga0075364_10007920
287 Ga0075364_10012201
288 Ga0075364_10221223
289 Ga0075364_10338637
290 Ga0075367_10107662
291 Ga0075370_10006105
292 Ga0075370_10018050
293 Ga0075370_10502173
294 Ga0114129_11128714
295 Ga0105248_10718865
296 Ga0105249_10371281
297 Ga0206351_10696824
298 Ga0206354_10503493
299 Ga0206353_10365872
300 Ga0206353_11029603
301 Ga0207688_10237205
302 Ga0207705_10002849
303 Ga0207707_10001139
304 Ga0207707_10294174
305 Ga0207660_10002139
306 Ga0207652_10000651
307 Ga0207694_10945831
308 Ga0207679_10549166
309 Ga0207667_10610119
310 Ga0207658_10457041
311 Ga0207677_10301368
312 Ga0207678_10249081
313 Ga0207702_11242811
314 Ga0207674_10736121
315 Ga0207675_100530900
316 Ga0207698_10288548
317 Ga0209813_10125338
318 Ga0268265_11896879
319 Ga0268264_10000697
320 Ga0316176_1071433
321 Ga0316183_1128797
322 Ga0307513_10503670
323 Ga0307408_100340864
324 Ga0316576_10006224
325 Ga0316578_10102997
326 Ga0307405_10061087
327 Ga0307405_10087355
328 Ga0307405_10423646
329 Ga0307413_11153299
330 Ga0307406_10245313
331 Ga0307407_10053780
332 Ga0307407_10159480
333 Ga0307412_10319478
334 Ga0307409_100002918
335 Ga0307409_100396893
336 Ga0307409_100477257
337 Ga0307409_100491323
338 Ga0307409_100946691
339 Ga0307409_101083632
340 Ga0307416_100003189
341 Ga0307416_100314348
342 Ga0307414_10190848
343 Ga0307415_100003367
344 Ga0307415_100243017
345 Ga0307415_100595195
346 Ga0316574_0197363
347 Ga0316582_0395403
348 Ga0316584_0020534
349 Ga0395900_0009238
350 Ga0436364_0133695
351 Ga0395901_0019613
352 Ga0395901_0520942
353 Ga0451787_554511
354 Ga0451789_1169151
355 Ga0451791_0511752
356 Ga0451795_0526443
357 Ga0451802_0079481
358 Ga0451802_0619996
359 Ga0451843_0296373
360 Ga0451853_2287133
361 Ga0466969_0013761
362 Ga0466972_0106942
363 Ga0466965_0103557
364 Ga0466966_0013323
365 Ga0466961_0010469
366 Ga0466964_0253028
367 Ga0466971_0010631
368 Ga0466970_0003311
369 Ga0466957_0171999
370 Ga0466957_0637804
371 Ga0466960_0000704
372 Ga0466960_0140443
373 Ga0466959_0020878
374 Ga0466967_0378049
375 Ga0466967_1066092
376 Ga0495629_0163663
377 Ga0495582_0274362
378 Ga0495639_0225236
379 Ga0495664_0207034
380 Ga0495594_0476572
381 Ga0495618_0044993
382 Ga0495640_0006803
383 Ga0495667_0021802
384 Ga0495634_0024502
385 Ga0495634_0367720
386 Ga0495625_0296823
387 Ga0495657_0007933
388 Ga0495658_0032235
389 Ga0495613_0005019
390 Ga0495613_0282493
391 Ga0495613_0341818
392 Ga0495600_0090180
393 Ga0495581_0086082
394 Ga0495604_0010341
395 Ga0495676_0002182
396 Ga0496100_0313194
397 Ga0496101_0032854
398 Ga0496102_0640724
399 Ga0496104_0399904
400 Ga0496106_0037764
401 Ga0496106_0403234
402 Ga0496107_0097076
403 Ga0496108_0408199
404 Ga0496108_0635944
405 Ga0496109_0255505
406 Ga0496109_0396628
407 Ga0496110_0866365
408 Ga0496112_0226067
409 Ga0496113_0163583
410 Ga0496114_0099382
411 Ga0496114_0223441
412 Ga0496114_0248584
413 Ga0496124_0262867
414 Ga0501318_064071
415 Ga0501031_0083416
416 Ga0501031_0126975
417 Ga0501031_0127015
418 Ga0501031_0802666
419 Ga0501032_0005140
420 Ga0501032_0152523
421 Ga0501033_0091162
422 Ga0501034_0014658
423 Ga0501034_0123838
424 Ga0501036_0007661
425 Ga0501036_0164166
426 Ga0501036_0661640
427 Ga0501038_0105939
428 Ga0501038_0247422
429 Ga0501038_0440222
430 Ga0501039_0045127
431 Ga0501039_0062539
432 Ga0501039_0077040
433 Ga0501039_0079827
434 Ga0501039_0301868
435 Ga0501040_0205457
436 Ga0501041_0644557
437 Ga0501042_0022820
438 Ga0501042_0109610
439 Ga0501043_0062573
440 Ga0501043_0315970
441 Ga0501047_0002800
442 Ga0501047_0309233
443 Ga0501048_0217495
444 Ga0501067_0013469
445 Ga0501067_0013500
446 Ga0501067_0020721
447 Ga0501068_0702707
448 Ga0501069_0020426
449 Ga0501069_0344844
450 Ga0501070_0153231
451 Ga0501070_0332550
452 Ga0501070_0357435
453 Ga0501070_0665300
454 Ga0501071_0238152
455 Ga0501071_0632796
456 Ga0501072_0143608
457 Ga0501073_0371953
458 Ga0501074_0386652
459 Ga0501074_0613211
460 Ga0501079_0190023
461 Ga0501080_0218940
462 Ga0501035_0010118
463 Ga0501035_0019234
464 Ga0501035_0042196
465 Ga0501044_0001722
466 Ga0501044_0185309
467 Ga0501044_0328512
468 Ga0501045_0079028
469 Ga0501045_0335590
470 Ga0501045_0803415
471 nmdc:mga03n38_36508_c1
472 nmdc:mga00v17_198975_c1
473 nmdc:mga00v17_385701_c1
474 nmdc:mga00v17_4230_c1
475 nmdc:mga00v17_98081_c1
476 nmdc:mga0yw44_1037692_c1
477 nmdc:mga0yw44_104348_c1
478 nmdc:mga0yw44_140836_c1
479 nmdc:mga0yw44_31647_c1
480 nmdc:mga0yw44_61235_c1
481 nmdc:mga0yw44_72425_c1
482 nmdc:mga06z11_204896_c1
483 nmdc:mga06z11_213705_c1
484 nmdc:mga06z11_317874_c1
485 nmdc:mga06z11_63082_c1
486 nmdc:mga04h51_109428_c1
487 nmdc:mga07m45_3230_c1
488 nmdc:mga07m45_325203_c1
489 nmdc:mga07m45_44772_c1
490 nmdc:mga07m45_531809_c1
491 Ga0495601_0079716
492 Ga0495619_0207678
493 Ga0500644_0129448
494 Ga0500641_0326519
495 Ga0500553_107030
496 Ga0500554_170155
497 Ga0500573_0097010
498 Ga0501084_0207152
499 Ga0466962_0002669
500 Ga0530510_0270497
501 Ga0530510_0417641
502 Ga0530510_0418482
503 Ga0530510_0982152
504 2643891679
505 2643960727
506 2644230356
507 2740168971
508 2774392336
509 2809196145
510 2812351731
511 2855391109
512 8054611196

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01327

Pep_deformylase

Polypeptide deformylase

25

172

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1lme-assembly2.cif.gz_B crystal structure of peptide deformylase from thermotoga maritima 0.9521 6 145
6jf8-assembly2.cif.gz_C k4u bound crystal structure of class i type b peptide deformylase from acinetobacter baumannii 0.9471 10 145
3cpm-assembly1.cif.gz_A plant peptide deformylase pdf1b crystal structure 0.9457 9 157
3pn5-assembly1.cif.gz_A crystal structure of arabidopsis thaliana petide deformylase 1b (atpdf1b) g41q mutant 0.9425 9 157
3pn3-assembly1.cif.gz_A crystal structure of arabidopsis thaliana petide deformylase 1b (atpdf1b) in complex with inhibitor 21 0.9353 9 157
ID Description Score Start End Superfamily
4je6A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.949 9 144 3.90.45.10
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9455 6 145 3.90.45.10
3g5pA00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9374 9 148 3.90.45.10
af_K7VJY5_57_249_3.90.45.10 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9338 9 160 3.90.45.10
5vcpA00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9281 9 149 3.90.45.10
ID Description Score Start End GO Terms
AF-A0A7W0HUS1-F1-model_v4 Peptide deformylase (EC 3.5.1.88) 0.9763 18 139 GO:0006412
GO:0042586
GO:0043686
AF-A0A5C1QB28-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9661 13 157 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A1W9VVU2-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9658 13 157 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A7V7EBH4-F1-model_v4 Peptide deformylase (EC 3.5.1.88) 0.9652 29 158 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A838JP98-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9637 5 158 GO:0006412
GO:0042586
GO:0043686
GO:0046872

Map