F366677

General Info

Members Datasets Scaffolds Average Seq Length
256 143 254 230

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0476260|Ga0395901_0476260_131_883
Length 250
Sequence MSEALKPASRSSRRTSPAATTGAPVLSLRGVVRSYPSGDRLLEVLKGVDLDVQAGDMVGLIGPSGSGKSSLLHAAGLLEHPDAGQIMVEGRDCSVLREADRTKVRLHKIGFVYQFHHLLPEFTALDNVAMPLRIAGKSRMAARDRAKALLEQLGLGERLHHQPAQMSGGEQQRVAIARALANSPKVVLADEPTGNLDPVTSEAVFTSLFELCRREGVAAVVATHNMELARYMDRVFALKDGHLEAKDFAT

Samples

Sample ID Description Type Environment
1 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
2 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
46 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
74 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
75 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
76 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
77 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
78 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
79 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
80 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
81 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
88 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
89 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
90 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
91 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
92 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
93 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
94 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
95 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
96 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
97 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
98 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
99 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
100 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
101 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
102 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
103 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
104 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
105 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
106 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
107 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
108 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
109 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
114 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
115 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
116 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
117 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
118 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
119 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
120 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
121 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
122 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
123 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
124 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
125 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
126 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
127 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
128 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
129 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
130 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
131 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
132 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
133 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
134 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
135 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
136 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
137 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
138 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
139 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
140 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
141 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
142 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
143 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0
Isolates 0.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.36
Nodule 0.39
Rhizoplane 1.17
Rhizosphere 76.17
Stem 0
Stem Tuber 0
Unclassified 3.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055536_1000596 3300003781 Bacteria 24634
2 Ga0055531_10031836 3300003794 Bacteria 1736
3 Ga0065165_1045965 3300005262 Bacteria 1269
4 Ga0070670_100000037 3300005331 Bacteria 156070
5 Ga0070670_100052858 3300005331 Bacteria 3489
6 Ga0070670_100053591 3300005331 Bacteria 3464
7 Ga0070666_10004507 3300005335 Bacteria 8488
8 Ga0070666_10046554 3300005335 Bacteria 2910
9 Ga0070680_100184012 3300005336 Bacteria 1760
10 Ga0070691_10003066 3300005341 Bacteria 7485
11 Ga0070668_100001202 3300005347 Bacteria 18371
12 Ga0070668_100009664 3300005347 Bacteria 7153
13 Ga0070668_100014227 3300005347 Bacteria 5945
14 Ga0070668_100062447 3300005347 Bacteria 2886
15 Ga0070668_100082846 3300005347 Bacteria 2517
16 Ga0070667_100000083 3300005367 Bacteria 118261
17 Ga0070667_100002986 3300005367 Bacteria 14534
18 Ga0070667_100025765 3300005367 Bacteria 4891
19 Ga0070667_100057775 3300005367 Bacteria 3280
20 Ga0070667_100510127 3300005367 Bacteria 1103
21 Ga0070681_10034711 3300005458 Bacteria 5065
22 Ga0070681_10035504 3300005458 Bacteria 5009
23 Ga0070681_10435202 3300005458 Bacteria 1223
24 Ga0070679_100005360 3300005530 Bacteria 11867
25 Ga0068853_100006199 3300005539 Bacteria 9469
26 Ga0070665_100000883 3300005548 Bacteria 38439
27 Ga0070665_100001867 3300005548 Bacteria 23910
28 Ga0070665_100055981 3300005548 Bacteria 3955
29 Ga0068855_100015812 3300005563 Bacteria 9079
30 Ga0068855_100045832 3300005563 Bacteria 5170
31 Ga0068855_100094639 3300005563 Bacteria 3444
32 Ga0068856_100075111 3300005614 Bacteria 3348
33 Ga0068856_100677594 3300005614 Bacteria 1052
34 Ga0068852_100016843 3300005616 Bacteria 5714
35 Ga0068852_100652707 3300005616 Bacteria 1060
36 Ga0068859_100001659 3300005617 Bacteria 22653
37 Ga0068859_100066964 3300005617 Bacteria 3627
38 Ga0068859_100392410 3300005617 Bacteria 1484
39 Ga0068864_100000116 3300005618 Bacteria 79213
40 Ga0068864_100000363 3300005618 Bacteria 39706
41 Ga0068861_100027997 3300005719 Bacteria 4110
42 Ga0068863_100000007 3300005841 Bacteria 257578
43 Ga0068863_100000512 3300005841 Bacteria 39481
44 Ga0068863_100002761 3300005841 Bacteria 17386
45 Ga0068863_100572882 3300005841 Bacteria 1116
46 Ga0068863_101021427 3300005841 Bacteria 830
47 Ga0068858_100003765 3300005842 Bacteria 14999
48 Ga0068858_100012285 3300005842 Bacteria 8078
49 Ga0068860_100000348 3300005843 Bacteria 62147
50 Ga0068860_100001231 3300005843 Bacteria 27931
51 Ga0068860_100026449 3300005843 Bacteria 5593
52 Ga0068862_100000235 3300005844 Bacteria 61301
53 Ga0068862_100004650 3300005844 Bacteria 11565
54 Ga0068862_100217002 3300005844 Bacteria 1731
55 Ga0075368_10000828 3300006042 Bacteria 9530
56 Ga0075364_10026678 3300006051 Bacteria 3687
57 Ga0075362_10248032 3300006177 Bacteria 875
58 Ga0075367_10004477 3300006178 Bacteria 6829
59 Ga0075369_10025901 3300006186 Bacteria 2442
60 Ga0097620_100001659 3300006931 Bacteria 22653
61 Ga0097620_100066964 3300006931 Bacteria 3627
62 Ga0097620_100392398 3300006931 Bacteria 1484
63 Ga0105250_10086537 3300009092 Bacteria 1272
64 Ga0105240_10180393 3300009093 Bacteria 2492
65 Ga0105240_10598339 3300009093 Bacteria 1214
66 Ga0105247_10034840 3300009101 Bacteria 3066
67 Ga0105248_10015678 3300009177 Bacteria 8352
68 Ga0105248_10047414 3300009177 Bacteria 4818
69 Ga0105248_10105813 3300009177 Bacteria 3172
70 Ga0105248_10352073 3300009177 Bacteria 1658
71 Ga0105248_10392423 3300009177 Bacteria 1563
72 Ga0105238_10380460 3300009551 Bacteria 1403
73 Ga0105238_10771904 3300009551 Bacteria 976
74 Ga0105249_10003153 3300009553 Bacteria 14264
75 Ga0105249_10531960 3300009553 Bacteria 1224
76 Ga0105239_10315825 3300010375 Bacteria 1761
77 Ga0157370_10248888 3300013104 Bacteria 1644
78 Ga0157369_10730545 3300013105 Bacteria 1019
79 Ga0163162_10052599 3300013306 Bacteria 4091
80 Ga0163162_10895409 3300013306 Bacteria 1001
81 Ga0163163_10033553 3300014325 Bacteria 4967
82 Ga0163163_10098558 3300014325 Bacteria 2944
83 Ga0157379_10005938 3300014968 Bacteria 10514
84 Ga0157379_10063600 3300014968 Bacteria 3298
85 Ga0157379_10101051 3300014968 Bacteria 2588
86 Ga0163161_10584212 3300017792 Bacteria 919
87 Ga0213872_10023555 3300021361 Bacteria 2833
88 Ga0213872_10067004 3300021361 Bacteria 1621
89 Ga0209676_1000061 3300025292 Bacteria 332674
90 Ga0209676_1003092 3300025292 Bacteria 10710
91 Ga0209257_1000199 3300025304 Bacteria 148045
92 Ga0209257_1004190 3300025304 Bacteria 11433
93 Ga0207710_10298665 3300025900 Bacteria 813
94 Ga0207695_10001229 3300025913 Bacteria 43850
95 Ga0207695_10155087 3300025913 Bacteria 2225
96 Ga0207695_10429496 3300025913 Bacteria 1205
97 Ga0207660_10389173 3300025917 Bacteria 1121
98 Ga0207649_10519463 3300025920 Bacteria 908
99 Ga0207652_10170770 3300025921 Bacteria 1951
100 Ga0207681_10498742 3300025923 Bacteria 996
101 Ga0207650_10000062 3300025925 Bacteria 149776
102 Ga0207650_10046935 3300025925 Bacteria 3182
103 Ga0207644_10005911 3300025931 Bacteria 7979
104 Ga0207704_10352061 3300025938 Bacteria 1147
105 Ga0207711_10004232 3300025941 Bacteria 12282
106 Ga0207711_10010099 3300025941 Bacteria 7844
107 Ga0207711_10019042 3300025941 Bacteria 5712
108 Ga0207711_10270624 3300025941 Bacteria 1563
109 Ga0207667_10008026 3300025949 Bacteria 12594
110 Ga0207667_10235806 3300025949 Bacteria 1873
111 Ga0207668_10000028 3300025972 Bacteria 125361
112 Ga0207668_10000130 3300025972 Bacteria 53528
113 Ga0207668_10006139 3300025972 Bacteria 7088
114 Ga0207668_10014365 3300025972 Bacteria 4900
115 Ga0207668_10224852 3300025972 Bacteria 1509
116 Ga0207640_10505930 3300025981 Bacteria 1007
117 Ga0207658_10000218 3300025986 Bacteria 60270
118 Ga0207658_10002378 3300025986 Bacteria 13790
119 Ga0207658_10004629 3300025986 Bacteria 9536
120 Ga0207658_10057742 3300025986 Bacteria 2885
121 Ga0207658_10119855 3300025986 Bacteria 2096
122 Ga0207703_10000038 3300026035 Bacteria 175917
123 Ga0207703_10001849 3300026035 Bacteria 18837
124 Ga0207639_10017570 3300026041 Bacteria 5073
125 Ga0207639_10509525 3300026041 Bacteria 1101
126 Ga0207639_11076467 3300026041 Bacteria 754
127 Ga0207702_10061963 3300026078 Bacteria 3192
128 Ga0207702_10434975 3300026078 Bacteria 1270
129 Ga0207641_10000012 3300026088 Bacteria 375486
130 Ga0207641_10005569 3300026088 Bacteria 10733
131 Ga0207641_10009593 3300026088 Bacteria 7976
132 Ga0207641_10477280 3300026088 Bacteria 1208
133 Ga0207641_10848645 3300026088 Bacteria 905
134 Ga0207676_10000179 3300026095 Bacteria 55697
135 Ga0207676_10013004 3300026095 Bacteria 5975
136 Ga0207675_100038104 3300026118 Bacteria 4486
137 Ga0207698_10261502 3300026142 Bacteria 1590
138 Ga0207698_10329338 3300026142 Bacteria 1434
139 Ga0209813_10085124 3300027866 Bacteria 1052
140 Ga0268266_10004203 3300028379 Bacteria 13863
141 Ga0268266_10021826 3300028379 Bacteria 5454
142 Ga0268266_10046018 3300028379 Bacteria 3735
143 Ga0268266_10145976 3300028379 Bacteria 2127
144 Ga0268265_10000600 3300028380 Bacteria 36213
145 Ga0268265_10003284 3300028380 Bacteria 11727
146 Ga0268265_10026073 3300028380 Bacteria 4155
147 Ga0268265_10041468 3300028380 Bacteria 3407
148 Ga0268264_10000046 3300028381 Bacteria 364597
149 Ga0268264_10000059 3300028381 Bacteria 306927
150 Ga0268264_10061400 3300028381 Bacteria 3152
151 Ga0268264_10074072 3300028381 Bacteria 2891
152 Ga0265337_1064408 3300028556 Bacteria 1012
153 Ga0265338_10016622 3300028800 Bacteria 7985
154 Ga0265338_10347231 3300028800 Bacteria 1068
155 Ga0307513_10000261 3300031456 Bacteria 76045
156 Ga0307513_10179283 3300031456 Bacteria 1984
157 Ga0307513_10383178 3300031456 Bacteria 1145
158 Ga0307516_10000352 3300031730 Bacteria 59644
159 Ga0307406_10004742 3300031901 Bacteria 7405
160 Ga0307412_10101477 3300031911 Bacteria 2036
161 Ga0373935_0127526 3300035692 Bacteria 1706
162 Ga0373927_0286051 3300035695 Bacteria 1085
163 Ga0373925_0153291 3300037068 Bacteria 1811
164 Ga0395899_0000013 3300037312 Bacteria 510397
165 Ga0395899_0000167 3300037312 Bacteria 100973
166 Ga0395899_0114605 3300037312 Bacteria 1935
167 Ga0395899_0209788 3300037312 Bacteria 1354
168 Ga0395900_0000009 3300037418 Bacteria 476249
169 Ga0395900_0025551 3300037418 Bacteria 6046
170 Ga0395900_0075282 3300037418 Bacteria 3470
171 Ga0395900_0479922 3300037418 Bacteria 1196
172 Ga0395900_0894498 3300037418 Bacteria 811
173 Ga0395898_0262441 3300037466 Bacteria 1647
174 Ga0395898_0505660 3300037466 Bacteria 1149
175 Ga0395905_0025918 3300037471 Bacteria 5526
176 Ga0395905_0057150 3300037471 Bacteria 3649
177 Ga0395905_0067606 3300037471 Bacteria 3347
178 Ga0395905_0150708 3300037471 Bacteria 2188
179 Ga0395905_0198068 3300037471 Bacteria 1883
180 Ga0395905_0249387 3300037471 Bacteria 1658
181 Ga0395905_0336341 3300037471 Bacteria 1401
182 Ga0395905_0508517 3300037471 Bacteria 1105
183 Ga0395905_0534561 3300037471 Bacteria 1073
184 Ga0395901_0000014 3300038443 Bacteria 375100
185 Ga0395901_0176621 3300038443 Bacteria 2240
186 Ga0395901_0286840 3300038443 Bacteria 1709
187 Ga0395901_0476260 3300038443 Bacteria 1274
188 Ga0436361_0201364 3300039447 Bacteria 3538
189 Ga0466959_0024044 3300045049 Bacteria 4512
190 Ga0495629_0025567 3300046459 Bacteria 4195
191 Ga0495664_0093324 3300046477 Bacteria 1811
192 Ga0495594_0009555 3300046499 Bacteria 5014
193 Ga0495583_0109735 3300046506 Bacteria 1170
194 Ga0495643_0004585 3300046522 Bacteria 9622
195 Ga0495609_0009915 3300046538 Bacteria 4591
196 Ga0495597_0000930 3300046542 Bacteria 22738
197 Ga0495645_0030295 3300046543 Bacteria 3940
198 Ga0495622_0001609 3300046557 Bacteria 11147
199 Ga0495669_0000003 3300046684 Bacteria 267741
200 Ga0495669_0000234 3300046684 Bacteria 32800
201 Ga0495669_0062732 3300046684 Bacteria 1684
202 Ga0495613_0041929 3300046689 Bacteria 3387
203 Ga0495687_035241 3300047443 Bacteria 2252
204 Ga0496102_0187652 3300048905 Bacteria 1948
205 Ga0496103_0160817 3300048906 Bacteria 1440
206 Ga0496112_0039818 3300048915 Bacteria 4593
207 Ga0496117_0028070 3300048920 Bacteria 4363
208 Ga0496118_0010326 3300048921 Bacteria 9260
209 Ga0496119_0018966 3300048922 Bacteria 5093
210 Ga0496121_0000009 3300048924 Bacteria 836971
211 Ga0496125_0050636 3300048928 Bacteria 3437
212 Ga0501033_0159162 3300049570 Bacteria 1626
213 Ga0501033_0306716 3300049570 Bacteria 1117
214 Ga0501037_0438774 3300049573 Bacteria 892
215 Ga0501047_0020852 3300049581 Bacteria 6295
216 Ga0501047_0108693 3300049581 Bacteria 2656
217 Ga0501047_0574662 3300049581 Bacteria 950
218 Ga0501035_0451599 3300049822 Bacteria 1063
219 Ga0501044_0032519 3300049823 Bacteria 5483
220 Ga0501044_0479524 3300049823 Bacteria 1147
221 nmdc:mga00v17_6375_c1 3300050491 Bacteria 6258
222 nmdc:mga04h51_101113_c1 3300050495 Bacteria 1051
223 nmdc:mga07m45_187_c1 3300050496 Bacteria 14451
224 nmdc:mga0sz30_24976_c1 3300050516 Bacteria 2442
225 Ga0500635_0000775 3300053080 Bacteria 7950
226 Ga0500578_0169653 3300053086 Bacteria 1350
227 Ga0500644_0155361 3300053088 Bacteria 920
228 Ga0500644_0208753 3300053088 Bacteria 810
229 Ga0500647_0060837 3300053091 Bacteria 1818
230 Ga0500583_0024966 3300053092 Bacteria 2545
231 Ga0500651_0006092 3300053093 Bacteria 6926
232 Ga0500651_0184310 3300053093 Bacteria 1238
233 Ga0500555_004969 3300053103 Bacteria 3773
234 Ga0500556_0123629 3300053104 Bacteria 1011
235 Ga0500562_000145 3300053108 Bacteria 20904
236 Ga0500569_039895 3300053109 Bacteria 1369
237 Ga0500572_034641 3300053111 Bacteria 1431
238 Ga0500595_002803 3300053119 Bacteria 8386
239 Ga0500595_044028 3300053119 Bacteria 1417
240 Ga0500607_128025 3300053121 Bacteria 1216
241 Ga0500642_0079620 3300053130 Bacteria 1503
242 Ga0500559_0006497 3300053136 Bacteria 5276
243 Ga0500590_009133 3300053148 Bacteria 4978
244 Ga0500604_0060842 3300053151 Bacteria 1186
245 Ga0500619_004914 3300053154 Bacteria 2925
246 Ga0500624_004847 3300053157 Bacteria 1779
247 Ga0500639_054137 3300053163 Bacteria 2086
248 Ga0500636_0021332 3300053177 Bacteria 3833
249 Ga0500637_0013338 3300053178 Bacteria 4307
250 Ga0500637_0073511 3300053178 Bacteria 1968
251 Ga0500625_015824 3300053729 Bacteria 3504
252 Ga0500645_065054 3300053730 Bacteria 1051
253 Ga0500596_000346 3300053735 Bacteria 8329
254 Ga0500601_005288 3300053737 Bacteria 1413

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046684 Ga0495669_0000234 Ga0495669_0000234_16273_16962 203
2 3300037418 Ga0395900_0894498 Ga0395900_0894498_11_634 207
3 3300037471 Ga0395905_0534561 Ga0395905_0534561_207_893 209
4 3300046684 Ga0495669_0000003 Ga0495669_0000003_244142_244828 211
5 3300046689 Ga0495613_0041929 Ga0495613_0041929_1517_2272 218
6 3300037466 Ga0395898_0505660 Ga0395898_0505660_480_1139 219
7 iso_pu_bacteria 2643221598 2644000269 224
8 3300009093 Ga0105240_10598339 Ga0105240_105983391 225
9 3300013104 Ga0157370_10248888 Ga0157370_102488882 225
10 3300037312 Ga0395899_0000167 Ga0395899_0000167_67870_68550 226
11 3300037418 Ga0395900_0000009 Ga0395900_0000009_337828_338508 226
12 3300037466 Ga0395898_0262441 Ga0395898_0262441_892_1572 226
13 3300037471 Ga0395905_0057150 Ga0395905_0057150_625_1305 226
14 3300038443 Ga0395901_0000014 Ga0395901_0000014_289033_289713 226
15 3300049570 Ga0501033_0159162 Ga0501033_0159162_694_1374 226
16 3300049573 Ga0501037_0438774 Ga0501037_0438774_65_745 226
17 3300049581 Ga0501047_0108693 Ga0501047_0108693_875_1555 226
18 3300049822 Ga0501035_0451599 Ga0501035_0451599_288_968 226
19 3300049823 Ga0501044_0032519 Ga0501044_0032519_3878_4558 226
20 iso_pu_bacteria 2757320392 2757572521 226
21 3300005331 Ga0070670_100053591 Ga0070670_1000535912 227
22 3300005563 Ga0068855_100094639 Ga0068855_1000946394 227
23 3300005617 Ga0068859_100392410 Ga0068859_1003924102 227
24 3300005841 Ga0068863_101021427 Ga0068863_1010214272 227
25 3300006931 Ga0097620_100392398 Ga0097620_1003923982 227
26 3300009551 Ga0105238_10771904 Ga0105238_107719041 227
27 3300009553 Ga0105249_10531960 Ga0105249_105319602 227
28 3300025913 Ga0207695_10429496 Ga0207695_104294962 227
29 3300025972 Ga0207668_10014365 Ga0207668_100143654 227
30 3300026041 Ga0207639_11076467 Ga0207639_110764671 227
31 3300026088 Ga0207641_10848645 Ga0207641_108486452 227
32 3300037471 Ga0395905_0336341 Ga0395905_0336341_490_1173 227
33 3300003794 Ga0055531_10031836 Ga0055531_100318362 228
34 3300005335 Ga0070666_10046554 Ga0070666_100465543 228
35 3300005616 Ga0068852_100652707 Ga0068852_1006527072 228
36 3300025304 Ga0209257_1004190 Ga0209257_10041906 228
37 3300025938 Ga0207704_10352061 Ga0207704_103520612 228
38 3300026142 Ga0207698_10329338 Ga0207698_103293382 228
39 3300028556 Ga0265337_1064408 Ga0265337_10644082 228
40 3300028800 Ga0265338_10347231 Ga0265338_103472311 228
41 3300005262 Ga0065165_1045965 Ga0065165_10459652 229
42 3300005331 Ga0070670_100000037 Ga0070670_10000003719 229
43 3300005331 Ga0070670_100052858 Ga0070670_1000528582 229
44 3300005335 Ga0070666_10004507 Ga0070666_100045078 229
45 3300005347 Ga0070668_100001202 Ga0070668_10000120215 229
46 3300005347 Ga0070668_100009664 Ga0070668_1000096646 229
47 3300005347 Ga0070668_100014227 Ga0070668_1000142273 229
48 3300005347 Ga0070668_100082846 Ga0070668_1000828461 229
49 3300005367 Ga0070667_100000083 Ga0070667_10000008319 229
50 3300005367 Ga0070667_100025765 Ga0070667_1000257653 229
51 3300005367 Ga0070667_100057775 Ga0070667_1000577752 229
52 3300005367 Ga0070667_100510127 Ga0070667_1005101272 229
53 3300005458 Ga0070681_10435202 Ga0070681_104352021 229
54 3300005548 Ga0070665_100001867 Ga0070665_10000186718 229
55 3300005617 Ga0068859_100001659 Ga0068859_10000165912 229
56 3300005617 Ga0068859_100066964 Ga0068859_1000669643 229
57 3300005618 Ga0068864_100000116 Ga0068864_10000011647 229
58 3300005618 Ga0068864_100000363 Ga0068864_10000036322 229
59 3300005719 Ga0068861_100027997 Ga0068861_1000279973 229
60 3300005841 Ga0068863_100000007 Ga0068863_100000007210 229
61 3300005841 Ga0068863_100000512 Ga0068863_10000051210 229
62 3300005841 Ga0068863_100002761 Ga0068863_10000276114 229
63 3300005842 Ga0068858_100003765 Ga0068858_10000376513 229
64 3300005842 Ga0068858_100012285 Ga0068858_1000122859 229
65 3300005843 Ga0068860_100000348 Ga0068860_10000034841 229
66 3300005843 Ga0068860_100001231 Ga0068860_10000123114 229
67 3300005843 Ga0068860_100026449 Ga0068860_1000264495 229
68 3300005844 Ga0068862_100000235 Ga0068862_10000023546 229
69 3300005844 Ga0068862_100004650 Ga0068862_1000046509 229
70 3300005844 Ga0068862_100217002 Ga0068862_1002170022 229
71 3300006042 Ga0075368_10000828 Ga0075368_1000082810 229
72 3300006051 Ga0075364_10026678 Ga0075364_100266782 229
73 3300006177 Ga0075362_10248032 Ga0075362_102480321 229
74 3300006178 Ga0075367_10004477 Ga0075367_100044773 229
75 3300006186 Ga0075369_10025901 Ga0075369_100259012 229
76 3300006931 Ga0097620_100001659 Ga0097620_10000165912 229
77 3300006931 Ga0097620_100066964 Ga0097620_1000669643 229
78 3300009092 Ga0105250_10086537 Ga0105250_100865372 229
79 3300009101 Ga0105247_10034840 Ga0105247_100348402 229
80 3300009177 Ga0105248_10015678 Ga0105248_100156784 229
81 3300009177 Ga0105248_10047414 Ga0105248_100474142 229
82 3300009177 Ga0105248_10105813 Ga0105248_101058133 229
83 3300009177 Ga0105248_10352073 Ga0105248_103520732 229
84 3300009553 Ga0105249_10003153 Ga0105249_100031531 229
85 3300013306 Ga0163162_10052599 Ga0163162_100525993 229
86 3300013306 Ga0163162_10895409 Ga0163162_108954092 229
87 3300014325 Ga0163163_10033553 Ga0163163_100335536 229
88 3300014325 Ga0163163_10098558 Ga0163163_100985583 229
89 3300014968 Ga0157379_10005938 Ga0157379_1000593811 229
90 3300014968 Ga0157379_10063600 Ga0157379_100636002 229
91 3300014968 Ga0157379_10101051 Ga0157379_101010513 229
92 3300025900 Ga0207710_10298665 Ga0207710_102986652 229
93 3300025923 Ga0207681_10498742 Ga0207681_104987422 229
94 3300025925 Ga0207650_10000062 Ga0207650_1000006270 229
95 3300025925 Ga0207650_10046935 Ga0207650_100469353 229
96 3300025931 Ga0207644_10005911 Ga0207644_100059114 229
97 3300025941 Ga0207711_10004232 Ga0207711_100042328 229
98 3300025941 Ga0207711_10010099 Ga0207711_100100992 229
99 3300025941 Ga0207711_10019042 Ga0207711_100190422 229
100 3300025972 Ga0207668_10000130 Ga0207668_100001307 229
101 3300025972 Ga0207668_10006139 Ga0207668_100061394 229
102 3300025972 Ga0207668_10224852 Ga0207668_102248522 229
103 3300025986 Ga0207658_10000218 Ga0207658_1000021835 229
104 3300025986 Ga0207658_10004629 Ga0207658_100046293 229
105 3300025986 Ga0207658_10057742 Ga0207658_100577422 229
106 3300025986 Ga0207658_10119855 Ga0207658_101198552 229
107 3300026035 Ga0207703_10000038 Ga0207703_1000003838 229
108 3300026035 Ga0207703_10001849 Ga0207703_100018493 229
109 3300026088 Ga0207641_10000012 Ga0207641_1000001299 229
110 3300026088 Ga0207641_10005569 Ga0207641_1000556910 229
111 3300026088 Ga0207641_10009593 Ga0207641_100095933 229
112 3300026095 Ga0207676_10000179 Ga0207676_1000017920 229
113 3300026095 Ga0207676_10013004 Ga0207676_100130042 229
114 3300026118 Ga0207675_100038104 Ga0207675_1000381045 229
115 3300027866 Ga0209813_10085124 Ga0209813_100851242 229
116 3300028379 Ga0268266_10021826 Ga0268266_100218264 229
117 3300028379 Ga0268266_10046018 Ga0268266_100460183 229
118 3300028380 Ga0268265_10000600 Ga0268265_1000060022 229
119 3300028380 Ga0268265_10003284 Ga0268265_1000328410 229
120 3300028380 Ga0268265_10026073 Ga0268265_100260735 229
121 3300028381 Ga0268264_10000046 Ga0268264_10000046179 229
122 3300028381 Ga0268264_10000059 Ga0268264_10000059289 229
123 3300028381 Ga0268264_10061400 Ga0268264_100614005 229
124 3300028381 Ga0268264_10074072 Ga0268264_100740722 229
125 3300031456 Ga0307513_10179283 Ga0307513_101792832 229
126 3300031456 Ga0307513_10383178 Ga0307513_103831782 229
127 3300037418 Ga0395900_0479922 Ga0395900_0479922_340_1029 229
128 3300046459 Ga0495629_0025567 Ga0495629_0025567_2044_2733 229
129 3300046477 Ga0495664_0093324 Ga0495664_0093324_122_811 229
130 3300046499 Ga0495594_0009555 Ga0495594_0009555_3671_4360 229
131 3300046506 Ga0495583_0109735 Ga0495583_0109735_447_1136 229
132 3300046522 Ga0495643_0004585 Ga0495643_0004585_474_1163 229
133 3300046538 Ga0495609_0009915 Ga0495609_0009915_2426_3115 229
134 3300046542 Ga0495597_0000930 Ga0495597_0000930_12717_13406 229
135 3300046557 Ga0495622_0001609 Ga0495622_0001609_2294_2983 229
136 3300046684 Ga0495669_0062732 Ga0495669_0062732_840_1529 229
137 3300047443 Ga0495687_035241 Ga0495687_035241_823_1512 229
138 3300048905 Ga0496102_0187652 Ga0496102_0187652_198_887 229
139 3300048906 Ga0496103_0160817 Ga0496103_0160817_108_797 229
140 3300048915 Ga0496112_0039818 Ga0496112_0039818_1833_2522 229
141 3300048920 Ga0496117_0028070 Ga0496117_0028070_2750_3439 229
142 3300048921 Ga0496118_0010326 Ga0496118_0010326_6832_7521 229
143 3300048922 Ga0496119_0018966 Ga0496119_0018966_3421_4110 229
144 3300048924 Ga0496121_0000009 Ga0496121_0000009_688230_688919 229
145 3300050491 nmdc:mga00v17_6375_c1 nmdc:mga00v17_6375_c1_3843_4532 229
146 3300050495 nmdc:mga04h51_101113_c1 nmdc:mga04h51_101113_c1_262_951 229
147 3300050516 nmdc:mga0sz30_24976_c1 nmdc:mga0sz30_24976_c1_613_1302 229
148 3300053080 Ga0500635_0000775 Ga0500635_0000775_4195_4884 229
149 3300053086 Ga0500578_0169653 Ga0500578_0169653_420_1109 229
150 3300053088 Ga0500644_0208753 Ga0500644_0208753_70_759 229
151 3300053091 Ga0500647_0060837 Ga0500647_0060837_203_892 229
152 3300053092 Ga0500583_0024966 Ga0500583_0024966_1196_1885 229
153 3300053093 Ga0500651_0184310 Ga0500651_0184310_91_780 229
154 3300053104 Ga0500556_0123629 Ga0500556_0123629_49_738 229
155 3300053109 Ga0500569_039895 Ga0500569_039895_348_1037 229
156 3300053111 Ga0500572_034641 Ga0500572_034641_453_1142 229
157 3300053119 Ga0500595_002803 Ga0500595_002803_7607_8296 229
158 3300053119 Ga0500595_044028 Ga0500595_044028_39_728 229
159 3300053121 Ga0500607_128025 Ga0500607_128025_256_945 229
160 3300053136 Ga0500559_0006497 Ga0500559_0006497_456_1145 229
161 3300053148 Ga0500590_009133 Ga0500590_009133_1564_2253 229
162 3300053151 Ga0500604_0060842 Ga0500604_0060842_279_968 229
163 3300053154 Ga0500619_004914 Ga0500619_004914_1127_1816 229
164 3300053157 Ga0500624_004847 Ga0500624_004847_473_1162 229
165 3300053163 Ga0500639_054137 Ga0500639_054137_1332_2021 229
166 3300053177 Ga0500636_0021332 Ga0500636_0021332_103_792 229
167 3300053178 Ga0500637_0013338 Ga0500637_0013338_439_1128 229
168 3300053178 Ga0500637_0073511 Ga0500637_0073511_698_1387 229
169 3300053729 Ga0500625_015824 Ga0500625_015824_1191_1880 229
170 3300053730 Ga0500645_065054 Ga0500645_065054_281_970 229
171 3300053735 Ga0500596_000346 Ga0500596_000346_6903_7592 229
172 3300053737 Ga0500601_005288 Ga0500601_005288_32_721 229
173 3300005347 Ga0070668_100062447 Ga0070668_1000624472 230
174 3300005367 Ga0070667_100002986 Ga0070667_10000298610 230
175 3300005548 Ga0070665_100000883 Ga0070665_10000088319 230
176 3300005841 Ga0068863_100572882 Ga0068863_1005728822 230
177 3300009177 Ga0105248_10392423 Ga0105248_103924232 230
178 3300025941 Ga0207711_10270624 Ga0207711_102706242 230
179 3300025972 Ga0207668_10000028 Ga0207668_10000028123 230
180 3300025986 Ga0207658_10002378 Ga0207658_1000237810 230
181 3300026088 Ga0207641_10477280 Ga0207641_104772802 230
182 3300028379 Ga0268266_10004203 Ga0268266_100042031 230
183 3300028380 Ga0268265_10041468 Ga0268265_100414682 230
184 3300037312 Ga0395899_0114605 Ga0395899_0114605_301_993 230
185 3300053130 Ga0500642_0079620 Ga0500642_0079620_38_730 230
186 3300005336 Ga0070680_100184012 Ga0070680_1001840122 231
187 3300005341 Ga0070691_10003066 Ga0070691_100030666 231
188 3300005458 Ga0070681_10035504 Ga0070681_100355044 231
189 3300005530 Ga0070679_100005360 Ga0070679_1000053609 231
190 3300005548 Ga0070665_100055981 Ga0070665_1000559813 231
191 3300005563 Ga0068855_100045832 Ga0068855_1000458324 231
192 3300005614 Ga0068856_100677594 Ga0068856_1006775942 231
193 3300009551 Ga0105238_10380460 Ga0105238_103804601 231
194 3300025913 Ga0207695_10001229 Ga0207695_100012295 231
195 3300025917 Ga0207660_10389173 Ga0207660_103891732 231
196 3300025920 Ga0207649_10519463 Ga0207649_105194631 231
197 3300025921 Ga0207652_10170770 Ga0207652_101707702 231
198 3300026041 Ga0207639_10509525 Ga0207639_105095252 231
199 3300026078 Ga0207702_10434975 Ga0207702_104349752 231
200 3300028379 Ga0268266_10145976 Ga0268266_101459762 231
201 3300031456 Ga0307513_10000261 Ga0307513_100002615 231
202 3300037418 Ga0395900_0075282 Ga0395900_0075282_57_752 231
203 3300037471 Ga0395905_0025918 Ga0395905_0025918_1077_1772 231
204 3300037471 Ga0395905_0067606 Ga0395905_0067606_2318_3013 231
205 3300037471 Ga0395905_0198068 Ga0395905_0198068_528_1223 231
206 3300037471 Ga0395905_0249387 Ga0395905_0249387_835_1530 231
207 3300037471 Ga0395905_0508517 Ga0395905_0508517_183_878 231
208 3300038443 Ga0395901_0176621 Ga0395901_0176621_502_1197 231
209 3300048928 Ga0496125_0050636 Ga0496125_0050636_296_991 231
210 3300049581 Ga0501047_0574662 Ga0501047_0574662_20_727 231
211 3300053103 Ga0500555_004969 Ga0500555_004969_1214_1909 231
212 3300005614 Ga0068856_100075111 Ga0068856_1000751112 232
213 3300009093 Ga0105240_10180393 Ga0105240_101803932 232
214 3300010375 Ga0105239_10315825 Ga0105239_103158252 232
215 3300025913 Ga0207695_10155087 Ga0207695_101550872 232
216 3300026078 Ga0207702_10061963 Ga0207702_100619633 232
217 3300035692 Ga0373935_0127526 Ga0373935_0127526_217_915 232
218 3300035695 Ga0373927_0286051 Ga0373927_0286051_159_857 232
219 3300037068 Ga0373925_0153291 Ga0373925_0153291_718_1416 232
220 3300037312 Ga0395899_0209788 Ga0395899_0209788_417_1166 232
221 3300037418 Ga0395900_0025551 Ga0395900_0025551_3179_3928 232
222 3300037471 Ga0395905_0150708 Ga0395905_0150708_172_921 232
223 3300038443 Ga0395901_0286840 Ga0395901_0286840_360_1109 232
224 3300046543 Ga0495645_0030295 Ga0495645_0030295_47_754 232
225 3300050496 nmdc:mga07m45_187_c1 nmdc:mga07m45_187_c1_12408_13109 232
226 3300005539 Ga0068853_100006199 Ga0068853_1000061996 233
227 3300017792 Ga0163161_10584212 Ga0163161_105842121 233
228 3300025949 Ga0207667_10235806 Ga0207667_102358062 233
229 3300026041 Ga0207639_10017570 Ga0207639_100175703 233
230 3300028800 Ga0265338_10016622 Ga0265338_100166221 233
231 3300031730 Ga0307516_10000352 Ga0307516_1000035258 233
232 3300038443 Ga0395901_0476260 Ga0395901_0476260_131_883 233
233 3300049570 Ga0501033_0306716 Ga0501033_0306716_350_1051 233
234 3300049581 Ga0501047_0020852 Ga0501047_0020852_1961_2662 233
235 3300049823 Ga0501044_0479524 Ga0501044_0479524_425_1126 233
236 3300053108 Ga0500562_000145 Ga0500562_000145_13527_14228 233
237 3300005458 Ga0070681_10034711 Ga0070681_100347112 234
238 3300005563 Ga0068855_100015812 Ga0068855_1000158127 234
239 3300005616 Ga0068852_100016843 Ga0068852_1000168433 234
240 3300013105 Ga0157369_10730545 Ga0157369_107305452 234
241 3300021361 Ga0213872_10023555 Ga0213872_100235552 234
242 3300021361 Ga0213872_10067004 Ga0213872_100670042 234
243 3300025949 Ga0207667_10008026 Ga0207667_100080269 234
244 3300025981 Ga0207640_10505930 Ga0207640_105059302 234
245 3300026142 Ga0207698_10261502 Ga0207698_102615022 234
246 3300037312 Ga0395899_0000013 Ga0395899_0000013_257596_258312 234
247 3300039447 Ga0436361_0201364 Ga0436361_0201364_398_1114 234
248 3300045049 Ga0466959_0024044 Ga0466959_0024044_3117_3833 234
249 3300003781 Ga0055536_1000596 Ga0055536_100059611 236
250 3300025292 Ga0209676_1000061 Ga0209676_1000061250 236
251 3300025292 Ga0209676_1003092 Ga0209676_10030923 236
252 3300025304 Ga0209257_1000199 Ga0209257_100019967 236
253 3300031901 Ga0307406_10004742 Ga0307406_100047426 236
254 3300031911 Ga0307412_10101477 Ga0307412_101014772 236
255 3300053088 Ga0500644_0155361 Ga0500644_0155361_188_898 236
256 3300053093 Ga0500651_0006092 Ga0500651_0006092_3962_4672 236

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

45

194

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.951 9 227
7w7b-assembly2.cif.gz_G heme exporter hrtba in complex with protoporphyrin ix containing manganese(iii), high resolution data 0.9489 5 228
7w7a-assembly2.cif.gz_E heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data 0.9469 7 225
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9437 7 227
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9435 6 229
ID Description Score Start End Superfamily
af_P9WQK1_1_231_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9641 4 233 3.40.50.300
af_Q2G0D8_1_227_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.96 7 226 3.40.50.300
af_A4I4M8_123_401_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9596 33 229 3.40.50.300
2pclA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9596 6 227 3.40.50.300
af_P9WQK1_1_231_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.956 4 233 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2D4VMT8-F1-model_v4 ABC transporter 0.9837 7 229 GO:0005524
GO:0005886
GO:0016887
GO:0022857
GO:0044874
GO:0089705
AF-A0A089I4Y8-F1-model_v4 ABC transporter ATP-binding protein 0.9691 9 227 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A7C9JAV8-F1-model_v4 ATP-binding cassette domain-containing protein 0.9684 7 229 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A1V4IVY5-F1-model_v4 Bacitracin export ATP-binding protein BceA 0.9645 7 233 GO:0005524
GO:0016887
AF-A0A6P2F744-F1-model_v4 Lipoprotein-releasing system ATP-binding protein LolD (EC 7.6.2.-) 0.9619 4 230 GO:0005524
GO:0005886
GO:0016887
GO:0022857
GO:0044874
GO:0089705

Feature Viewer

pLDDT pTM Quality
90.58 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map