F366677
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 256 | 143 | 254 | 230 |
Family's Representative Sequence
| Representative Sequence | 3300038443|Ga0395901_0476260|Ga0395901_0476260_131_883 |
| Length | 250 |
| Sequence | MSEALKPASRSSRRTSPAATTGAPVLSLRGVVRSYPSGDRLLEVLKGVDLDVQAGDMVGLIGPSGSGKSSLLHAAGLLEHPDAGQIMVEGRDCSVLREADRTKVRLHKIGFVYQFHHLLPEFTALDNVAMPLRIAGKSRMAARDRAKALLEQLGLGERLHHQPAQMSGGEQQRVAIARALANSPKVVLADEPTGNLDPVTSEAVFTSLFELCRREGVAAVVATHNMELARYMDRVFALKDGHLEAKDFAT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 2 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 3 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 4 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 5 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 15 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 17 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 18 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 19 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 20 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 21 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 22 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 23 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 24 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 25 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 26 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 27 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 28 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 29 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 30 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 31 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 46 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 47 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 48 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 74 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 75 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 76 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 77 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 78 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 79 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 80 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 81 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 82 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 83 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 84 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 85 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 86 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 87 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 88 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 89 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 102 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 103 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 104 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 105 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 106 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 107 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 108 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 109 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 110 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 111 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 112 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 113 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 114 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 115 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 116 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 117 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 118 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 119 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 120 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 121 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 122 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 123 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 124 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 125 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 126 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 127 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 128 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 129 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 130 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 131 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 132 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 133 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 134 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 135 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 136 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 137 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 138 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 139 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 140 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 141 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 142 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 143 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.22 |
| Metatranscriptomes | 0 |
| Isolates | 0.78 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.36 |
| Nodule | 0.39 |
| Rhizoplane | 1.17 |
| Rhizosphere | 76.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.91 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055536_1000596 | 3300003781 | Bacteria | 24634 |
| 2 | Ga0055531_10031836 | 3300003794 | Bacteria | 1736 |
| 3 | Ga0065165_1045965 | 3300005262 | Bacteria | 1269 |
| 4 | Ga0070670_100000037 | 3300005331 | Bacteria | 156070 |
| 5 | Ga0070670_100052858 | 3300005331 | Bacteria | 3489 |
| 6 | Ga0070670_100053591 | 3300005331 | Bacteria | 3464 |
| 7 | Ga0070666_10004507 | 3300005335 | Bacteria | 8488 |
| 8 | Ga0070666_10046554 | 3300005335 | Bacteria | 2910 |
| 9 | Ga0070680_100184012 | 3300005336 | Bacteria | 1760 |
| 10 | Ga0070691_10003066 | 3300005341 | Bacteria | 7485 |
| 11 | Ga0070668_100001202 | 3300005347 | Bacteria | 18371 |
| 12 | Ga0070668_100009664 | 3300005347 | Bacteria | 7153 |
| 13 | Ga0070668_100014227 | 3300005347 | Bacteria | 5945 |
| 14 | Ga0070668_100062447 | 3300005347 | Bacteria | 2886 |
| 15 | Ga0070668_100082846 | 3300005347 | Bacteria | 2517 |
| 16 | Ga0070667_100000083 | 3300005367 | Bacteria | 118261 |
| 17 | Ga0070667_100002986 | 3300005367 | Bacteria | 14534 |
| 18 | Ga0070667_100025765 | 3300005367 | Bacteria | 4891 |
| 19 | Ga0070667_100057775 | 3300005367 | Bacteria | 3280 |
| 20 | Ga0070667_100510127 | 3300005367 | Bacteria | 1103 |
| 21 | Ga0070681_10034711 | 3300005458 | Bacteria | 5065 |
| 22 | Ga0070681_10035504 | 3300005458 | Bacteria | 5009 |
| 23 | Ga0070681_10435202 | 3300005458 | Bacteria | 1223 |
| 24 | Ga0070679_100005360 | 3300005530 | Bacteria | 11867 |
| 25 | Ga0068853_100006199 | 3300005539 | Bacteria | 9469 |
| 26 | Ga0070665_100000883 | 3300005548 | Bacteria | 38439 |
| 27 | Ga0070665_100001867 | 3300005548 | Bacteria | 23910 |
| 28 | Ga0070665_100055981 | 3300005548 | Bacteria | 3955 |
| 29 | Ga0068855_100015812 | 3300005563 | Bacteria | 9079 |
| 30 | Ga0068855_100045832 | 3300005563 | Bacteria | 5170 |
| 31 | Ga0068855_100094639 | 3300005563 | Bacteria | 3444 |
| 32 | Ga0068856_100075111 | 3300005614 | Bacteria | 3348 |
| 33 | Ga0068856_100677594 | 3300005614 | Bacteria | 1052 |
| 34 | Ga0068852_100016843 | 3300005616 | Bacteria | 5714 |
| 35 | Ga0068852_100652707 | 3300005616 | Bacteria | 1060 |
| 36 | Ga0068859_100001659 | 3300005617 | Bacteria | 22653 |
| 37 | Ga0068859_100066964 | 3300005617 | Bacteria | 3627 |
| 38 | Ga0068859_100392410 | 3300005617 | Bacteria | 1484 |
| 39 | Ga0068864_100000116 | 3300005618 | Bacteria | 79213 |
| 40 | Ga0068864_100000363 | 3300005618 | Bacteria | 39706 |
| 41 | Ga0068861_100027997 | 3300005719 | Bacteria | 4110 |
| 42 | Ga0068863_100000007 | 3300005841 | Bacteria | 257578 |
| 43 | Ga0068863_100000512 | 3300005841 | Bacteria | 39481 |
| 44 | Ga0068863_100002761 | 3300005841 | Bacteria | 17386 |
| 45 | Ga0068863_100572882 | 3300005841 | Bacteria | 1116 |
| 46 | Ga0068863_101021427 | 3300005841 | Bacteria | 830 |
| 47 | Ga0068858_100003765 | 3300005842 | Bacteria | 14999 |
| 48 | Ga0068858_100012285 | 3300005842 | Bacteria | 8078 |
| 49 | Ga0068860_100000348 | 3300005843 | Bacteria | 62147 |
| 50 | Ga0068860_100001231 | 3300005843 | Bacteria | 27931 |
| 51 | Ga0068860_100026449 | 3300005843 | Bacteria | 5593 |
| 52 | Ga0068862_100000235 | 3300005844 | Bacteria | 61301 |
| 53 | Ga0068862_100004650 | 3300005844 | Bacteria | 11565 |
| 54 | Ga0068862_100217002 | 3300005844 | Bacteria | 1731 |
| 55 | Ga0075368_10000828 | 3300006042 | Bacteria | 9530 |
| 56 | Ga0075364_10026678 | 3300006051 | Bacteria | 3687 |
| 57 | Ga0075362_10248032 | 3300006177 | Bacteria | 875 |
| 58 | Ga0075367_10004477 | 3300006178 | Bacteria | 6829 |
| 59 | Ga0075369_10025901 | 3300006186 | Bacteria | 2442 |
| 60 | Ga0097620_100001659 | 3300006931 | Bacteria | 22653 |
| 61 | Ga0097620_100066964 | 3300006931 | Bacteria | 3627 |
| 62 | Ga0097620_100392398 | 3300006931 | Bacteria | 1484 |
| 63 | Ga0105250_10086537 | 3300009092 | Bacteria | 1272 |
| 64 | Ga0105240_10180393 | 3300009093 | Bacteria | 2492 |
| 65 | Ga0105240_10598339 | 3300009093 | Bacteria | 1214 |
| 66 | Ga0105247_10034840 | 3300009101 | Bacteria | 3066 |
| 67 | Ga0105248_10015678 | 3300009177 | Bacteria | 8352 |
| 68 | Ga0105248_10047414 | 3300009177 | Bacteria | 4818 |
| 69 | Ga0105248_10105813 | 3300009177 | Bacteria | 3172 |
| 70 | Ga0105248_10352073 | 3300009177 | Bacteria | 1658 |
| 71 | Ga0105248_10392423 | 3300009177 | Bacteria | 1563 |
| 72 | Ga0105238_10380460 | 3300009551 | Bacteria | 1403 |
| 73 | Ga0105238_10771904 | 3300009551 | Bacteria | 976 |
| 74 | Ga0105249_10003153 | 3300009553 | Bacteria | 14264 |
| 75 | Ga0105249_10531960 | 3300009553 | Bacteria | 1224 |
| 76 | Ga0105239_10315825 | 3300010375 | Bacteria | 1761 |
| 77 | Ga0157370_10248888 | 3300013104 | Bacteria | 1644 |
| 78 | Ga0157369_10730545 | 3300013105 | Bacteria | 1019 |
| 79 | Ga0163162_10052599 | 3300013306 | Bacteria | 4091 |
| 80 | Ga0163162_10895409 | 3300013306 | Bacteria | 1001 |
| 81 | Ga0163163_10033553 | 3300014325 | Bacteria | 4967 |
| 82 | Ga0163163_10098558 | 3300014325 | Bacteria | 2944 |
| 83 | Ga0157379_10005938 | 3300014968 | Bacteria | 10514 |
| 84 | Ga0157379_10063600 | 3300014968 | Bacteria | 3298 |
| 85 | Ga0157379_10101051 | 3300014968 | Bacteria | 2588 |
| 86 | Ga0163161_10584212 | 3300017792 | Bacteria | 919 |
| 87 | Ga0213872_10023555 | 3300021361 | Bacteria | 2833 |
| 88 | Ga0213872_10067004 | 3300021361 | Bacteria | 1621 |
| 89 | Ga0209676_1000061 | 3300025292 | Bacteria | 332674 |
| 90 | Ga0209676_1003092 | 3300025292 | Bacteria | 10710 |
| 91 | Ga0209257_1000199 | 3300025304 | Bacteria | 148045 |
| 92 | Ga0209257_1004190 | 3300025304 | Bacteria | 11433 |
| 93 | Ga0207710_10298665 | 3300025900 | Bacteria | 813 |
| 94 | Ga0207695_10001229 | 3300025913 | Bacteria | 43850 |
| 95 | Ga0207695_10155087 | 3300025913 | Bacteria | 2225 |
| 96 | Ga0207695_10429496 | 3300025913 | Bacteria | 1205 |
| 97 | Ga0207660_10389173 | 3300025917 | Bacteria | 1121 |
| 98 | Ga0207649_10519463 | 3300025920 | Bacteria | 908 |
| 99 | Ga0207652_10170770 | 3300025921 | Bacteria | 1951 |
| 100 | Ga0207681_10498742 | 3300025923 | Bacteria | 996 |
| 101 | Ga0207650_10000062 | 3300025925 | Bacteria | 149776 |
| 102 | Ga0207650_10046935 | 3300025925 | Bacteria | 3182 |
| 103 | Ga0207644_10005911 | 3300025931 | Bacteria | 7979 |
| 104 | Ga0207704_10352061 | 3300025938 | Bacteria | 1147 |
| 105 | Ga0207711_10004232 | 3300025941 | Bacteria | 12282 |
| 106 | Ga0207711_10010099 | 3300025941 | Bacteria | 7844 |
| 107 | Ga0207711_10019042 | 3300025941 | Bacteria | 5712 |
| 108 | Ga0207711_10270624 | 3300025941 | Bacteria | 1563 |
| 109 | Ga0207667_10008026 | 3300025949 | Bacteria | 12594 |
| 110 | Ga0207667_10235806 | 3300025949 | Bacteria | 1873 |
| 111 | Ga0207668_10000028 | 3300025972 | Bacteria | 125361 |
| 112 | Ga0207668_10000130 | 3300025972 | Bacteria | 53528 |
| 113 | Ga0207668_10006139 | 3300025972 | Bacteria | 7088 |
| 114 | Ga0207668_10014365 | 3300025972 | Bacteria | 4900 |
| 115 | Ga0207668_10224852 | 3300025972 | Bacteria | 1509 |
| 116 | Ga0207640_10505930 | 3300025981 | Bacteria | 1007 |
| 117 | Ga0207658_10000218 | 3300025986 | Bacteria | 60270 |
| 118 | Ga0207658_10002378 | 3300025986 | Bacteria | 13790 |
| 119 | Ga0207658_10004629 | 3300025986 | Bacteria | 9536 |
| 120 | Ga0207658_10057742 | 3300025986 | Bacteria | 2885 |
| 121 | Ga0207658_10119855 | 3300025986 | Bacteria | 2096 |
| 122 | Ga0207703_10000038 | 3300026035 | Bacteria | 175917 |
| 123 | Ga0207703_10001849 | 3300026035 | Bacteria | 18837 |
| 124 | Ga0207639_10017570 | 3300026041 | Bacteria | 5073 |
| 125 | Ga0207639_10509525 | 3300026041 | Bacteria | 1101 |
| 126 | Ga0207639_11076467 | 3300026041 | Bacteria | 754 |
| 127 | Ga0207702_10061963 | 3300026078 | Bacteria | 3192 |
| 128 | Ga0207702_10434975 | 3300026078 | Bacteria | 1270 |
| 129 | Ga0207641_10000012 | 3300026088 | Bacteria | 375486 |
| 130 | Ga0207641_10005569 | 3300026088 | Bacteria | 10733 |
| 131 | Ga0207641_10009593 | 3300026088 | Bacteria | 7976 |
| 132 | Ga0207641_10477280 | 3300026088 | Bacteria | 1208 |
| 133 | Ga0207641_10848645 | 3300026088 | Bacteria | 905 |
| 134 | Ga0207676_10000179 | 3300026095 | Bacteria | 55697 |
| 135 | Ga0207676_10013004 | 3300026095 | Bacteria | 5975 |
| 136 | Ga0207675_100038104 | 3300026118 | Bacteria | 4486 |
| 137 | Ga0207698_10261502 | 3300026142 | Bacteria | 1590 |
| 138 | Ga0207698_10329338 | 3300026142 | Bacteria | 1434 |
| 139 | Ga0209813_10085124 | 3300027866 | Bacteria | 1052 |
| 140 | Ga0268266_10004203 | 3300028379 | Bacteria | 13863 |
| 141 | Ga0268266_10021826 | 3300028379 | Bacteria | 5454 |
| 142 | Ga0268266_10046018 | 3300028379 | Bacteria | 3735 |
| 143 | Ga0268266_10145976 | 3300028379 | Bacteria | 2127 |
| 144 | Ga0268265_10000600 | 3300028380 | Bacteria | 36213 |
| 145 | Ga0268265_10003284 | 3300028380 | Bacteria | 11727 |
| 146 | Ga0268265_10026073 | 3300028380 | Bacteria | 4155 |
| 147 | Ga0268265_10041468 | 3300028380 | Bacteria | 3407 |
| 148 | Ga0268264_10000046 | 3300028381 | Bacteria | 364597 |
| 149 | Ga0268264_10000059 | 3300028381 | Bacteria | 306927 |
| 150 | Ga0268264_10061400 | 3300028381 | Bacteria | 3152 |
| 151 | Ga0268264_10074072 | 3300028381 | Bacteria | 2891 |
| 152 | Ga0265337_1064408 | 3300028556 | Bacteria | 1012 |
| 153 | Ga0265338_10016622 | 3300028800 | Bacteria | 7985 |
| 154 | Ga0265338_10347231 | 3300028800 | Bacteria | 1068 |
| 155 | Ga0307513_10000261 | 3300031456 | Bacteria | 76045 |
| 156 | Ga0307513_10179283 | 3300031456 | Bacteria | 1984 |
| 157 | Ga0307513_10383178 | 3300031456 | Bacteria | 1145 |
| 158 | Ga0307516_10000352 | 3300031730 | Bacteria | 59644 |
| 159 | Ga0307406_10004742 | 3300031901 | Bacteria | 7405 |
| 160 | Ga0307412_10101477 | 3300031911 | Bacteria | 2036 |
| 161 | Ga0373935_0127526 | 3300035692 | Bacteria | 1706 |
| 162 | Ga0373927_0286051 | 3300035695 | Bacteria | 1085 |
| 163 | Ga0373925_0153291 | 3300037068 | Bacteria | 1811 |
| 164 | Ga0395899_0000013 | 3300037312 | Bacteria | 510397 |
| 165 | Ga0395899_0000167 | 3300037312 | Bacteria | 100973 |
| 166 | Ga0395899_0114605 | 3300037312 | Bacteria | 1935 |
| 167 | Ga0395899_0209788 | 3300037312 | Bacteria | 1354 |
| 168 | Ga0395900_0000009 | 3300037418 | Bacteria | 476249 |
| 169 | Ga0395900_0025551 | 3300037418 | Bacteria | 6046 |
| 170 | Ga0395900_0075282 | 3300037418 | Bacteria | 3470 |
| 171 | Ga0395900_0479922 | 3300037418 | Bacteria | 1196 |
| 172 | Ga0395900_0894498 | 3300037418 | Bacteria | 811 |
| 173 | Ga0395898_0262441 | 3300037466 | Bacteria | 1647 |
| 174 | Ga0395898_0505660 | 3300037466 | Bacteria | 1149 |
| 175 | Ga0395905_0025918 | 3300037471 | Bacteria | 5526 |
| 176 | Ga0395905_0057150 | 3300037471 | Bacteria | 3649 |
| 177 | Ga0395905_0067606 | 3300037471 | Bacteria | 3347 |
| 178 | Ga0395905_0150708 | 3300037471 | Bacteria | 2188 |
| 179 | Ga0395905_0198068 | 3300037471 | Bacteria | 1883 |
| 180 | Ga0395905_0249387 | 3300037471 | Bacteria | 1658 |
| 181 | Ga0395905_0336341 | 3300037471 | Bacteria | 1401 |
| 182 | Ga0395905_0508517 | 3300037471 | Bacteria | 1105 |
| 183 | Ga0395905_0534561 | 3300037471 | Bacteria | 1073 |
| 184 | Ga0395901_0000014 | 3300038443 | Bacteria | 375100 |
| 185 | Ga0395901_0176621 | 3300038443 | Bacteria | 2240 |
| 186 | Ga0395901_0286840 | 3300038443 | Bacteria | 1709 |
| 187 | Ga0395901_0476260 | 3300038443 | Bacteria | 1274 |
| 188 | Ga0436361_0201364 | 3300039447 | Bacteria | 3538 |
| 189 | Ga0466959_0024044 | 3300045049 | Bacteria | 4512 |
| 190 | Ga0495629_0025567 | 3300046459 | Bacteria | 4195 |
| 191 | Ga0495664_0093324 | 3300046477 | Bacteria | 1811 |
| 192 | Ga0495594_0009555 | 3300046499 | Bacteria | 5014 |
| 193 | Ga0495583_0109735 | 3300046506 | Bacteria | 1170 |
| 194 | Ga0495643_0004585 | 3300046522 | Bacteria | 9622 |
| 195 | Ga0495609_0009915 | 3300046538 | Bacteria | 4591 |
| 196 | Ga0495597_0000930 | 3300046542 | Bacteria | 22738 |
| 197 | Ga0495645_0030295 | 3300046543 | Bacteria | 3940 |
| 198 | Ga0495622_0001609 | 3300046557 | Bacteria | 11147 |
| 199 | Ga0495669_0000003 | 3300046684 | Bacteria | 267741 |
| 200 | Ga0495669_0000234 | 3300046684 | Bacteria | 32800 |
| 201 | Ga0495669_0062732 | 3300046684 | Bacteria | 1684 |
| 202 | Ga0495613_0041929 | 3300046689 | Bacteria | 3387 |
| 203 | Ga0495687_035241 | 3300047443 | Bacteria | 2252 |
| 204 | Ga0496102_0187652 | 3300048905 | Bacteria | 1948 |
| 205 | Ga0496103_0160817 | 3300048906 | Bacteria | 1440 |
| 206 | Ga0496112_0039818 | 3300048915 | Bacteria | 4593 |
| 207 | Ga0496117_0028070 | 3300048920 | Bacteria | 4363 |
| 208 | Ga0496118_0010326 | 3300048921 | Bacteria | 9260 |
| 209 | Ga0496119_0018966 | 3300048922 | Bacteria | 5093 |
| 210 | Ga0496121_0000009 | 3300048924 | Bacteria | 836971 |
| 211 | Ga0496125_0050636 | 3300048928 | Bacteria | 3437 |
| 212 | Ga0501033_0159162 | 3300049570 | Bacteria | 1626 |
| 213 | Ga0501033_0306716 | 3300049570 | Bacteria | 1117 |
| 214 | Ga0501037_0438774 | 3300049573 | Bacteria | 892 |
| 215 | Ga0501047_0020852 | 3300049581 | Bacteria | 6295 |
| 216 | Ga0501047_0108693 | 3300049581 | Bacteria | 2656 |
| 217 | Ga0501047_0574662 | 3300049581 | Bacteria | 950 |
| 218 | Ga0501035_0451599 | 3300049822 | Bacteria | 1063 |
| 219 | Ga0501044_0032519 | 3300049823 | Bacteria | 5483 |
| 220 | Ga0501044_0479524 | 3300049823 | Bacteria | 1147 |
| 221 | nmdc:mga00v17_6375_c1 | 3300050491 | Bacteria | 6258 |
| 222 | nmdc:mga04h51_101113_c1 | 3300050495 | Bacteria | 1051 |
| 223 | nmdc:mga07m45_187_c1 | 3300050496 | Bacteria | 14451 |
| 224 | nmdc:mga0sz30_24976_c1 | 3300050516 | Bacteria | 2442 |
| 225 | Ga0500635_0000775 | 3300053080 | Bacteria | 7950 |
| 226 | Ga0500578_0169653 | 3300053086 | Bacteria | 1350 |
| 227 | Ga0500644_0155361 | 3300053088 | Bacteria | 920 |
| 228 | Ga0500644_0208753 | 3300053088 | Bacteria | 810 |
| 229 | Ga0500647_0060837 | 3300053091 | Bacteria | 1818 |
| 230 | Ga0500583_0024966 | 3300053092 | Bacteria | 2545 |
| 231 | Ga0500651_0006092 | 3300053093 | Bacteria | 6926 |
| 232 | Ga0500651_0184310 | 3300053093 | Bacteria | 1238 |
| 233 | Ga0500555_004969 | 3300053103 | Bacteria | 3773 |
| 234 | Ga0500556_0123629 | 3300053104 | Bacteria | 1011 |
| 235 | Ga0500562_000145 | 3300053108 | Bacteria | 20904 |
| 236 | Ga0500569_039895 | 3300053109 | Bacteria | 1369 |
| 237 | Ga0500572_034641 | 3300053111 | Bacteria | 1431 |
| 238 | Ga0500595_002803 | 3300053119 | Bacteria | 8386 |
| 239 | Ga0500595_044028 | 3300053119 | Bacteria | 1417 |
| 240 | Ga0500607_128025 | 3300053121 | Bacteria | 1216 |
| 241 | Ga0500642_0079620 | 3300053130 | Bacteria | 1503 |
| 242 | Ga0500559_0006497 | 3300053136 | Bacteria | 5276 |
| 243 | Ga0500590_009133 | 3300053148 | Bacteria | 4978 |
| 244 | Ga0500604_0060842 | 3300053151 | Bacteria | 1186 |
| 245 | Ga0500619_004914 | 3300053154 | Bacteria | 2925 |
| 246 | Ga0500624_004847 | 3300053157 | Bacteria | 1779 |
| 247 | Ga0500639_054137 | 3300053163 | Bacteria | 2086 |
| 248 | Ga0500636_0021332 | 3300053177 | Bacteria | 3833 |
| 249 | Ga0500637_0013338 | 3300053178 | Bacteria | 4307 |
| 250 | Ga0500637_0073511 | 3300053178 | Bacteria | 1968 |
| 251 | Ga0500625_015824 | 3300053729 | Bacteria | 3504 |
| 252 | Ga0500645_065054 | 3300053730 | Bacteria | 1051 |
| 253 | Ga0500596_000346 | 3300053735 | Bacteria | 8329 |
| 254 | Ga0500601_005288 | 3300053737 | Bacteria | 1413 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046684 | Ga0495669_0000234 | Ga0495669_0000234_16273_16962 | 203 |
| 2 | 3300037418 | Ga0395900_0894498 | Ga0395900_0894498_11_634 | 207 |
| 3 | 3300037471 | Ga0395905_0534561 | Ga0395905_0534561_207_893 | 209 |
| 4 | 3300046684 | Ga0495669_0000003 | Ga0495669_0000003_244142_244828 | 211 |
| 5 | 3300046689 | Ga0495613_0041929 | Ga0495613_0041929_1517_2272 | 218 |
| 6 | 3300037466 | Ga0395898_0505660 | Ga0395898_0505660_480_1139 | 219 |
| 7 | iso_pu_bacteria | 2643221598 | 2644000269 | 224 |
| 8 | 3300009093 | Ga0105240_10598339 | Ga0105240_105983391 | 225 |
| 9 | 3300013104 | Ga0157370_10248888 | Ga0157370_102488882 | 225 |
| 10 | 3300037312 | Ga0395899_0000167 | Ga0395899_0000167_67870_68550 | 226 |
| 11 | 3300037418 | Ga0395900_0000009 | Ga0395900_0000009_337828_338508 | 226 |
| 12 | 3300037466 | Ga0395898_0262441 | Ga0395898_0262441_892_1572 | 226 |
| 13 | 3300037471 | Ga0395905_0057150 | Ga0395905_0057150_625_1305 | 226 |
| 14 | 3300038443 | Ga0395901_0000014 | Ga0395901_0000014_289033_289713 | 226 |
| 15 | 3300049570 | Ga0501033_0159162 | Ga0501033_0159162_694_1374 | 226 |
| 16 | 3300049573 | Ga0501037_0438774 | Ga0501037_0438774_65_745 | 226 |
| 17 | 3300049581 | Ga0501047_0108693 | Ga0501047_0108693_875_1555 | 226 |
| 18 | 3300049822 | Ga0501035_0451599 | Ga0501035_0451599_288_968 | 226 |
| 19 | 3300049823 | Ga0501044_0032519 | Ga0501044_0032519_3878_4558 | 226 |
| 20 | iso_pu_bacteria | 2757320392 | 2757572521 | 226 |
| 21 | 3300005331 | Ga0070670_100053591 | Ga0070670_1000535912 | 227 |
| 22 | 3300005563 | Ga0068855_100094639 | Ga0068855_1000946394 | 227 |
| 23 | 3300005617 | Ga0068859_100392410 | Ga0068859_1003924102 | 227 |
| 24 | 3300005841 | Ga0068863_101021427 | Ga0068863_1010214272 | 227 |
| 25 | 3300006931 | Ga0097620_100392398 | Ga0097620_1003923982 | 227 |
| 26 | 3300009551 | Ga0105238_10771904 | Ga0105238_107719041 | 227 |
| 27 | 3300009553 | Ga0105249_10531960 | Ga0105249_105319602 | 227 |
| 28 | 3300025913 | Ga0207695_10429496 | Ga0207695_104294962 | 227 |
| 29 | 3300025972 | Ga0207668_10014365 | Ga0207668_100143654 | 227 |
| 30 | 3300026041 | Ga0207639_11076467 | Ga0207639_110764671 | 227 |
| 31 | 3300026088 | Ga0207641_10848645 | Ga0207641_108486452 | 227 |
| 32 | 3300037471 | Ga0395905_0336341 | Ga0395905_0336341_490_1173 | 227 |
| 33 | 3300003794 | Ga0055531_10031836 | Ga0055531_100318362 | 228 |
| 34 | 3300005335 | Ga0070666_10046554 | Ga0070666_100465543 | 228 |
| 35 | 3300005616 | Ga0068852_100652707 | Ga0068852_1006527072 | 228 |
| 36 | 3300025304 | Ga0209257_1004190 | Ga0209257_10041906 | 228 |
| 37 | 3300025938 | Ga0207704_10352061 | Ga0207704_103520612 | 228 |
| 38 | 3300026142 | Ga0207698_10329338 | Ga0207698_103293382 | 228 |
| 39 | 3300028556 | Ga0265337_1064408 | Ga0265337_10644082 | 228 |
| 40 | 3300028800 | Ga0265338_10347231 | Ga0265338_103472311 | 228 |
| 41 | 3300005262 | Ga0065165_1045965 | Ga0065165_10459652 | 229 |
| 42 | 3300005331 | Ga0070670_100000037 | Ga0070670_10000003719 | 229 |
| 43 | 3300005331 | Ga0070670_100052858 | Ga0070670_1000528582 | 229 |
| 44 | 3300005335 | Ga0070666_10004507 | Ga0070666_100045078 | 229 |
| 45 | 3300005347 | Ga0070668_100001202 | Ga0070668_10000120215 | 229 |
| 46 | 3300005347 | Ga0070668_100009664 | Ga0070668_1000096646 | 229 |
| 47 | 3300005347 | Ga0070668_100014227 | Ga0070668_1000142273 | 229 |
| 48 | 3300005347 | Ga0070668_100082846 | Ga0070668_1000828461 | 229 |
| 49 | 3300005367 | Ga0070667_100000083 | Ga0070667_10000008319 | 229 |
| 50 | 3300005367 | Ga0070667_100025765 | Ga0070667_1000257653 | 229 |
| 51 | 3300005367 | Ga0070667_100057775 | Ga0070667_1000577752 | 229 |
| 52 | 3300005367 | Ga0070667_100510127 | Ga0070667_1005101272 | 229 |
| 53 | 3300005458 | Ga0070681_10435202 | Ga0070681_104352021 | 229 |
| 54 | 3300005548 | Ga0070665_100001867 | Ga0070665_10000186718 | 229 |
| 55 | 3300005617 | Ga0068859_100001659 | Ga0068859_10000165912 | 229 |
| 56 | 3300005617 | Ga0068859_100066964 | Ga0068859_1000669643 | 229 |
| 57 | 3300005618 | Ga0068864_100000116 | Ga0068864_10000011647 | 229 |
| 58 | 3300005618 | Ga0068864_100000363 | Ga0068864_10000036322 | 229 |
| 59 | 3300005719 | Ga0068861_100027997 | Ga0068861_1000279973 | 229 |
| 60 | 3300005841 | Ga0068863_100000007 | Ga0068863_100000007210 | 229 |
| 61 | 3300005841 | Ga0068863_100000512 | Ga0068863_10000051210 | 229 |
| 62 | 3300005841 | Ga0068863_100002761 | Ga0068863_10000276114 | 229 |
| 63 | 3300005842 | Ga0068858_100003765 | Ga0068858_10000376513 | 229 |
| 64 | 3300005842 | Ga0068858_100012285 | Ga0068858_1000122859 | 229 |
| 65 | 3300005843 | Ga0068860_100000348 | Ga0068860_10000034841 | 229 |
| 66 | 3300005843 | Ga0068860_100001231 | Ga0068860_10000123114 | 229 |
| 67 | 3300005843 | Ga0068860_100026449 | Ga0068860_1000264495 | 229 |
| 68 | 3300005844 | Ga0068862_100000235 | Ga0068862_10000023546 | 229 |
| 69 | 3300005844 | Ga0068862_100004650 | Ga0068862_1000046509 | 229 |
| 70 | 3300005844 | Ga0068862_100217002 | Ga0068862_1002170022 | 229 |
| 71 | 3300006042 | Ga0075368_10000828 | Ga0075368_1000082810 | 229 |
| 72 | 3300006051 | Ga0075364_10026678 | Ga0075364_100266782 | 229 |
| 73 | 3300006177 | Ga0075362_10248032 | Ga0075362_102480321 | 229 |
| 74 | 3300006178 | Ga0075367_10004477 | Ga0075367_100044773 | 229 |
| 75 | 3300006186 | Ga0075369_10025901 | Ga0075369_100259012 | 229 |
| 76 | 3300006931 | Ga0097620_100001659 | Ga0097620_10000165912 | 229 |
| 77 | 3300006931 | Ga0097620_100066964 | Ga0097620_1000669643 | 229 |
| 78 | 3300009092 | Ga0105250_10086537 | Ga0105250_100865372 | 229 |
| 79 | 3300009101 | Ga0105247_10034840 | Ga0105247_100348402 | 229 |
| 80 | 3300009177 | Ga0105248_10015678 | Ga0105248_100156784 | 229 |
| 81 | 3300009177 | Ga0105248_10047414 | Ga0105248_100474142 | 229 |
| 82 | 3300009177 | Ga0105248_10105813 | Ga0105248_101058133 | 229 |
| 83 | 3300009177 | Ga0105248_10352073 | Ga0105248_103520732 | 229 |
| 84 | 3300009553 | Ga0105249_10003153 | Ga0105249_100031531 | 229 |
| 85 | 3300013306 | Ga0163162_10052599 | Ga0163162_100525993 | 229 |
| 86 | 3300013306 | Ga0163162_10895409 | Ga0163162_108954092 | 229 |
| 87 | 3300014325 | Ga0163163_10033553 | Ga0163163_100335536 | 229 |
| 88 | 3300014325 | Ga0163163_10098558 | Ga0163163_100985583 | 229 |
| 89 | 3300014968 | Ga0157379_10005938 | Ga0157379_1000593811 | 229 |
| 90 | 3300014968 | Ga0157379_10063600 | Ga0157379_100636002 | 229 |
| 91 | 3300014968 | Ga0157379_10101051 | Ga0157379_101010513 | 229 |
| 92 | 3300025900 | Ga0207710_10298665 | Ga0207710_102986652 | 229 |
| 93 | 3300025923 | Ga0207681_10498742 | Ga0207681_104987422 | 229 |
| 94 | 3300025925 | Ga0207650_10000062 | Ga0207650_1000006270 | 229 |
| 95 | 3300025925 | Ga0207650_10046935 | Ga0207650_100469353 | 229 |
| 96 | 3300025931 | Ga0207644_10005911 | Ga0207644_100059114 | 229 |
| 97 | 3300025941 | Ga0207711_10004232 | Ga0207711_100042328 | 229 |
| 98 | 3300025941 | Ga0207711_10010099 | Ga0207711_100100992 | 229 |
| 99 | 3300025941 | Ga0207711_10019042 | Ga0207711_100190422 | 229 |
| 100 | 3300025972 | Ga0207668_10000130 | Ga0207668_100001307 | 229 |
| 101 | 3300025972 | Ga0207668_10006139 | Ga0207668_100061394 | 229 |
| 102 | 3300025972 | Ga0207668_10224852 | Ga0207668_102248522 | 229 |
| 103 | 3300025986 | Ga0207658_10000218 | Ga0207658_1000021835 | 229 |
| 104 | 3300025986 | Ga0207658_10004629 | Ga0207658_100046293 | 229 |
| 105 | 3300025986 | Ga0207658_10057742 | Ga0207658_100577422 | 229 |
| 106 | 3300025986 | Ga0207658_10119855 | Ga0207658_101198552 | 229 |
| 107 | 3300026035 | Ga0207703_10000038 | Ga0207703_1000003838 | 229 |
| 108 | 3300026035 | Ga0207703_10001849 | Ga0207703_100018493 | 229 |
| 109 | 3300026088 | Ga0207641_10000012 | Ga0207641_1000001299 | 229 |
| 110 | 3300026088 | Ga0207641_10005569 | Ga0207641_1000556910 | 229 |
| 111 | 3300026088 | Ga0207641_10009593 | Ga0207641_100095933 | 229 |
| 112 | 3300026095 | Ga0207676_10000179 | Ga0207676_1000017920 | 229 |
| 113 | 3300026095 | Ga0207676_10013004 | Ga0207676_100130042 | 229 |
| 114 | 3300026118 | Ga0207675_100038104 | Ga0207675_1000381045 | 229 |
| 115 | 3300027866 | Ga0209813_10085124 | Ga0209813_100851242 | 229 |
| 116 | 3300028379 | Ga0268266_10021826 | Ga0268266_100218264 | 229 |
| 117 | 3300028379 | Ga0268266_10046018 | Ga0268266_100460183 | 229 |
| 118 | 3300028380 | Ga0268265_10000600 | Ga0268265_1000060022 | 229 |
| 119 | 3300028380 | Ga0268265_10003284 | Ga0268265_1000328410 | 229 |
| 120 | 3300028380 | Ga0268265_10026073 | Ga0268265_100260735 | 229 |
| 121 | 3300028381 | Ga0268264_10000046 | Ga0268264_10000046179 | 229 |
| 122 | 3300028381 | Ga0268264_10000059 | Ga0268264_10000059289 | 229 |
| 123 | 3300028381 | Ga0268264_10061400 | Ga0268264_100614005 | 229 |
| 124 | 3300028381 | Ga0268264_10074072 | Ga0268264_100740722 | 229 |
| 125 | 3300031456 | Ga0307513_10179283 | Ga0307513_101792832 | 229 |
| 126 | 3300031456 | Ga0307513_10383178 | Ga0307513_103831782 | 229 |
| 127 | 3300037418 | Ga0395900_0479922 | Ga0395900_0479922_340_1029 | 229 |
| 128 | 3300046459 | Ga0495629_0025567 | Ga0495629_0025567_2044_2733 | 229 |
| 129 | 3300046477 | Ga0495664_0093324 | Ga0495664_0093324_122_811 | 229 |
| 130 | 3300046499 | Ga0495594_0009555 | Ga0495594_0009555_3671_4360 | 229 |
| 131 | 3300046506 | Ga0495583_0109735 | Ga0495583_0109735_447_1136 | 229 |
| 132 | 3300046522 | Ga0495643_0004585 | Ga0495643_0004585_474_1163 | 229 |
| 133 | 3300046538 | Ga0495609_0009915 | Ga0495609_0009915_2426_3115 | 229 |
| 134 | 3300046542 | Ga0495597_0000930 | Ga0495597_0000930_12717_13406 | 229 |
| 135 | 3300046557 | Ga0495622_0001609 | Ga0495622_0001609_2294_2983 | 229 |
| 136 | 3300046684 | Ga0495669_0062732 | Ga0495669_0062732_840_1529 | 229 |
| 137 | 3300047443 | Ga0495687_035241 | Ga0495687_035241_823_1512 | 229 |
| 138 | 3300048905 | Ga0496102_0187652 | Ga0496102_0187652_198_887 | 229 |
| 139 | 3300048906 | Ga0496103_0160817 | Ga0496103_0160817_108_797 | 229 |
| 140 | 3300048915 | Ga0496112_0039818 | Ga0496112_0039818_1833_2522 | 229 |
| 141 | 3300048920 | Ga0496117_0028070 | Ga0496117_0028070_2750_3439 | 229 |
| 142 | 3300048921 | Ga0496118_0010326 | Ga0496118_0010326_6832_7521 | 229 |
| 143 | 3300048922 | Ga0496119_0018966 | Ga0496119_0018966_3421_4110 | 229 |
| 144 | 3300048924 | Ga0496121_0000009 | Ga0496121_0000009_688230_688919 | 229 |
| 145 | 3300050491 | nmdc:mga00v17_6375_c1 | nmdc:mga00v17_6375_c1_3843_4532 | 229 |
| 146 | 3300050495 | nmdc:mga04h51_101113_c1 | nmdc:mga04h51_101113_c1_262_951 | 229 |
| 147 | 3300050516 | nmdc:mga0sz30_24976_c1 | nmdc:mga0sz30_24976_c1_613_1302 | 229 |
| 148 | 3300053080 | Ga0500635_0000775 | Ga0500635_0000775_4195_4884 | 229 |
| 149 | 3300053086 | Ga0500578_0169653 | Ga0500578_0169653_420_1109 | 229 |
| 150 | 3300053088 | Ga0500644_0208753 | Ga0500644_0208753_70_759 | 229 |
| 151 | 3300053091 | Ga0500647_0060837 | Ga0500647_0060837_203_892 | 229 |
| 152 | 3300053092 | Ga0500583_0024966 | Ga0500583_0024966_1196_1885 | 229 |
| 153 | 3300053093 | Ga0500651_0184310 | Ga0500651_0184310_91_780 | 229 |
| 154 | 3300053104 | Ga0500556_0123629 | Ga0500556_0123629_49_738 | 229 |
| 155 | 3300053109 | Ga0500569_039895 | Ga0500569_039895_348_1037 | 229 |
| 156 | 3300053111 | Ga0500572_034641 | Ga0500572_034641_453_1142 | 229 |
| 157 | 3300053119 | Ga0500595_002803 | Ga0500595_002803_7607_8296 | 229 |
| 158 | 3300053119 | Ga0500595_044028 | Ga0500595_044028_39_728 | 229 |
| 159 | 3300053121 | Ga0500607_128025 | Ga0500607_128025_256_945 | 229 |
| 160 | 3300053136 | Ga0500559_0006497 | Ga0500559_0006497_456_1145 | 229 |
| 161 | 3300053148 | Ga0500590_009133 | Ga0500590_009133_1564_2253 | 229 |
| 162 | 3300053151 | Ga0500604_0060842 | Ga0500604_0060842_279_968 | 229 |
| 163 | 3300053154 | Ga0500619_004914 | Ga0500619_004914_1127_1816 | 229 |
| 164 | 3300053157 | Ga0500624_004847 | Ga0500624_004847_473_1162 | 229 |
| 165 | 3300053163 | Ga0500639_054137 | Ga0500639_054137_1332_2021 | 229 |
| 166 | 3300053177 | Ga0500636_0021332 | Ga0500636_0021332_103_792 | 229 |
| 167 | 3300053178 | Ga0500637_0013338 | Ga0500637_0013338_439_1128 | 229 |
| 168 | 3300053178 | Ga0500637_0073511 | Ga0500637_0073511_698_1387 | 229 |
| 169 | 3300053729 | Ga0500625_015824 | Ga0500625_015824_1191_1880 | 229 |
| 170 | 3300053730 | Ga0500645_065054 | Ga0500645_065054_281_970 | 229 |
| 171 | 3300053735 | Ga0500596_000346 | Ga0500596_000346_6903_7592 | 229 |
| 172 | 3300053737 | Ga0500601_005288 | Ga0500601_005288_32_721 | 229 |
| 173 | 3300005347 | Ga0070668_100062447 | Ga0070668_1000624472 | 230 |
| 174 | 3300005367 | Ga0070667_100002986 | Ga0070667_10000298610 | 230 |
| 175 | 3300005548 | Ga0070665_100000883 | Ga0070665_10000088319 | 230 |
| 176 | 3300005841 | Ga0068863_100572882 | Ga0068863_1005728822 | 230 |
| 177 | 3300009177 | Ga0105248_10392423 | Ga0105248_103924232 | 230 |
| 178 | 3300025941 | Ga0207711_10270624 | Ga0207711_102706242 | 230 |
| 179 | 3300025972 | Ga0207668_10000028 | Ga0207668_10000028123 | 230 |
| 180 | 3300025986 | Ga0207658_10002378 | Ga0207658_1000237810 | 230 |
| 181 | 3300026088 | Ga0207641_10477280 | Ga0207641_104772802 | 230 |
| 182 | 3300028379 | Ga0268266_10004203 | Ga0268266_100042031 | 230 |
| 183 | 3300028380 | Ga0268265_10041468 | Ga0268265_100414682 | 230 |
| 184 | 3300037312 | Ga0395899_0114605 | Ga0395899_0114605_301_993 | 230 |
| 185 | 3300053130 | Ga0500642_0079620 | Ga0500642_0079620_38_730 | 230 |
| 186 | 3300005336 | Ga0070680_100184012 | Ga0070680_1001840122 | 231 |
| 187 | 3300005341 | Ga0070691_10003066 | Ga0070691_100030666 | 231 |
| 188 | 3300005458 | Ga0070681_10035504 | Ga0070681_100355044 | 231 |
| 189 | 3300005530 | Ga0070679_100005360 | Ga0070679_1000053609 | 231 |
| 190 | 3300005548 | Ga0070665_100055981 | Ga0070665_1000559813 | 231 |
| 191 | 3300005563 | Ga0068855_100045832 | Ga0068855_1000458324 | 231 |
| 192 | 3300005614 | Ga0068856_100677594 | Ga0068856_1006775942 | 231 |
| 193 | 3300009551 | Ga0105238_10380460 | Ga0105238_103804601 | 231 |
| 194 | 3300025913 | Ga0207695_10001229 | Ga0207695_100012295 | 231 |
| 195 | 3300025917 | Ga0207660_10389173 | Ga0207660_103891732 | 231 |
| 196 | 3300025920 | Ga0207649_10519463 | Ga0207649_105194631 | 231 |
| 197 | 3300025921 | Ga0207652_10170770 | Ga0207652_101707702 | 231 |
| 198 | 3300026041 | Ga0207639_10509525 | Ga0207639_105095252 | 231 |
| 199 | 3300026078 | Ga0207702_10434975 | Ga0207702_104349752 | 231 |
| 200 | 3300028379 | Ga0268266_10145976 | Ga0268266_101459762 | 231 |
| 201 | 3300031456 | Ga0307513_10000261 | Ga0307513_100002615 | 231 |
| 202 | 3300037418 | Ga0395900_0075282 | Ga0395900_0075282_57_752 | 231 |
| 203 | 3300037471 | Ga0395905_0025918 | Ga0395905_0025918_1077_1772 | 231 |
| 204 | 3300037471 | Ga0395905_0067606 | Ga0395905_0067606_2318_3013 | 231 |
| 205 | 3300037471 | Ga0395905_0198068 | Ga0395905_0198068_528_1223 | 231 |
| 206 | 3300037471 | Ga0395905_0249387 | Ga0395905_0249387_835_1530 | 231 |
| 207 | 3300037471 | Ga0395905_0508517 | Ga0395905_0508517_183_878 | 231 |
| 208 | 3300038443 | Ga0395901_0176621 | Ga0395901_0176621_502_1197 | 231 |
| 209 | 3300048928 | Ga0496125_0050636 | Ga0496125_0050636_296_991 | 231 |
| 210 | 3300049581 | Ga0501047_0574662 | Ga0501047_0574662_20_727 | 231 |
| 211 | 3300053103 | Ga0500555_004969 | Ga0500555_004969_1214_1909 | 231 |
| 212 | 3300005614 | Ga0068856_100075111 | Ga0068856_1000751112 | 232 |
| 213 | 3300009093 | Ga0105240_10180393 | Ga0105240_101803932 | 232 |
| 214 | 3300010375 | Ga0105239_10315825 | Ga0105239_103158252 | 232 |
| 215 | 3300025913 | Ga0207695_10155087 | Ga0207695_101550872 | 232 |
| 216 | 3300026078 | Ga0207702_10061963 | Ga0207702_100619633 | 232 |
| 217 | 3300035692 | Ga0373935_0127526 | Ga0373935_0127526_217_915 | 232 |
| 218 | 3300035695 | Ga0373927_0286051 | Ga0373927_0286051_159_857 | 232 |
| 219 | 3300037068 | Ga0373925_0153291 | Ga0373925_0153291_718_1416 | 232 |
| 220 | 3300037312 | Ga0395899_0209788 | Ga0395899_0209788_417_1166 | 232 |
| 221 | 3300037418 | Ga0395900_0025551 | Ga0395900_0025551_3179_3928 | 232 |
| 222 | 3300037471 | Ga0395905_0150708 | Ga0395905_0150708_172_921 | 232 |
| 223 | 3300038443 | Ga0395901_0286840 | Ga0395901_0286840_360_1109 | 232 |
| 224 | 3300046543 | Ga0495645_0030295 | Ga0495645_0030295_47_754 | 232 |
| 225 | 3300050496 | nmdc:mga07m45_187_c1 | nmdc:mga07m45_187_c1_12408_13109 | 232 |
| 226 | 3300005539 | Ga0068853_100006199 | Ga0068853_1000061996 | 233 |
| 227 | 3300017792 | Ga0163161_10584212 | Ga0163161_105842121 | 233 |
| 228 | 3300025949 | Ga0207667_10235806 | Ga0207667_102358062 | 233 |
| 229 | 3300026041 | Ga0207639_10017570 | Ga0207639_100175703 | 233 |
| 230 | 3300028800 | Ga0265338_10016622 | Ga0265338_100166221 | 233 |
| 231 | 3300031730 | Ga0307516_10000352 | Ga0307516_1000035258 | 233 |
| 232 | 3300038443 | Ga0395901_0476260 | Ga0395901_0476260_131_883 | 233 |
| 233 | 3300049570 | Ga0501033_0306716 | Ga0501033_0306716_350_1051 | 233 |
| 234 | 3300049581 | Ga0501047_0020852 | Ga0501047_0020852_1961_2662 | 233 |
| 235 | 3300049823 | Ga0501044_0479524 | Ga0501044_0479524_425_1126 | 233 |
| 236 | 3300053108 | Ga0500562_000145 | Ga0500562_000145_13527_14228 | 233 |
| 237 | 3300005458 | Ga0070681_10034711 | Ga0070681_100347112 | 234 |
| 238 | 3300005563 | Ga0068855_100015812 | Ga0068855_1000158127 | 234 |
| 239 | 3300005616 | Ga0068852_100016843 | Ga0068852_1000168433 | 234 |
| 240 | 3300013105 | Ga0157369_10730545 | Ga0157369_107305452 | 234 |
| 241 | 3300021361 | Ga0213872_10023555 | Ga0213872_100235552 | 234 |
| 242 | 3300021361 | Ga0213872_10067004 | Ga0213872_100670042 | 234 |
| 243 | 3300025949 | Ga0207667_10008026 | Ga0207667_100080269 | 234 |
| 244 | 3300025981 | Ga0207640_10505930 | Ga0207640_105059302 | 234 |
| 245 | 3300026142 | Ga0207698_10261502 | Ga0207698_102615022 | 234 |
| 246 | 3300037312 | Ga0395899_0000013 | Ga0395899_0000013_257596_258312 | 234 |
| 247 | 3300039447 | Ga0436361_0201364 | Ga0436361_0201364_398_1114 | 234 |
| 248 | 3300045049 | Ga0466959_0024044 | Ga0466959_0024044_3117_3833 | 234 |
| 249 | 3300003781 | Ga0055536_1000596 | Ga0055536_100059611 | 236 |
| 250 | 3300025292 | Ga0209676_1000061 | Ga0209676_1000061250 | 236 |
| 251 | 3300025292 | Ga0209676_1003092 | Ga0209676_10030923 | 236 |
| 252 | 3300025304 | Ga0209257_1000199 | Ga0209257_100019967 | 236 |
| 253 | 3300031901 | Ga0307406_10004742 | Ga0307406_100047426 | 236 |
| 254 | 3300031911 | Ga0307412_10101477 | Ga0307412_101014772 | 236 |
| 255 | 3300053088 | Ga0500644_0155361 | Ga0500644_0155361_188_898 | 236 |
| 256 | 3300053093 | Ga0500651_0006092 | Ga0500651_0006092_3962_4672 | 236 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1f3o-assembly1.cif.gz_A-2 | crystal structure of mj0796 atp-binding cassette | 0.951 | 9 | 227 |
| 7w7b-assembly2.cif.gz_G | heme exporter hrtba in complex with protoporphyrin ix containing manganese(iii), high resolution data | 0.9489 | 5 | 228 |
| 7w7a-assembly2.cif.gz_E | heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data | 0.9469 | 7 | 225 |
| 5xu1-assembly1.cif.gz_A | structure of a non-canonical abc transporter from streptococcus pneumoniae r6 | 0.9437 | 7 | 227 |
| 2pcj-assembly1.cif.gz_B | crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 | 0.9435 | 6 | 229 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WQK1_1_231_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9641 | 4 | 233 | 3.40.50.300 |
| af_Q2G0D8_1_227_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.96 | 7 | 226 | 3.40.50.300 |
| af_A4I4M8_123_401_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9596 | 33 | 229 | 3.40.50.300 |
| 2pclA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9596 | 6 | 227 | 3.40.50.300 |
| af_P9WQK1_1_231_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.956 | 4 | 233 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2D4VMT8-F1-model_v4 | ABC transporter | 0.9837 | 7 | 229 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 GO:0044874 GO:0089705 |
| AF-A0A089I4Y8-F1-model_v4 | ABC transporter ATP-binding protein | 0.9691 | 9 | 227 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-A0A7C9JAV8-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9684 | 7 | 229 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-A0A1V4IVY5-F1-model_v4 | Bacitracin export ATP-binding protein BceA | 0.9645 | 7 | 233 |
GO:0005524
GO:0016887 |
| AF-A0A6P2F744-F1-model_v4 | Lipoprotein-releasing system ATP-binding protein LolD (EC 7.6.2.-) | 0.9619 | 4 | 230 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 GO:0044874 GO:0089705 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar