F366367

General Info

Members Datasets Scaffolds Average Seq Length
256 183 252 136

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10220801|Ga0075365_102208012
Length 147
Sequence MPITRGYRALVDQAMAEVKTYSVADVRARLGEAGLQLVDIRDVRELQAEGTVPGSYHAPRGMLEFWVDPDSPYHKKVFADEGREFVLFCGAGWRSALAAKTLQDMGMANVAHIEGGFAEWVKQGGPTETLEARKAKKAIGRNDDPTN

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
3 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
4 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
5 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
6 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
62 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
67 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
68 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
69 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
70 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
71 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
72 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
101 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
110 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
111 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
112 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
113 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
114 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
115 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
116 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
117 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
118 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
119 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
120 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
121 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
122 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
123 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
124 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
125 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
126 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
127 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
128 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
129 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
130 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
131 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
132 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
136 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
137 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
141 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
158 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
162 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
165 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
166 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
167 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
168 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
173 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
174 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
175 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
176 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
177 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
178 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
179 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
180 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
182 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
183 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.09
Metatranscriptomes 2.34
Isolates 1.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.56
Nodule 0.39
Rhizoplane 2.73
Rhizosphere 63.67
Stem 0
Stem Tuber 0
Unclassified 6.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_3250830 2162886011 Bacteria 1567
2 JGI25155J39150_1000059 3300002704 Bacteria 72038
3 JGI25156J39149_1000081 3300002705 Bacteria 72221
4 JGI25154J39366_1000109 3300002738 Bacteria 72431
5 JGI25157J39369_1000103 3300002741 Bacteria 72221
6 JGI25159J45721_1000246 3300002987 Bacteria 25617
7 JGI25159J45721_1023333 3300002987 Bacteria 1124
8 JGI25151J46595_10003461 3300003187 Bacteria 8711
9 JGI25151J46595_10047649 3300003187 Bacteria 1489
10 JGI25160J50197_1000451 3300003354 Bacteria 25633
11 JGI25161J50226_1000077 3300003374 Bacteria 83588
12 Ga0055526_1015582 3300003771 Bacteria 3044
13 Ga0055526_1021290 3300003771 Bacteria 2262
14 Ga0055537_1000872 3300003773 Bacteria 14428
15 Ga0055524_1000344 3300003775 Bacteria 42440
16 Ga0055534_1001218 3300003784 Bacteria 10791
17 Ga0055528_1000729 3300003790 Bacteria 23225
18 Ga0055530_10000853 3300003791 Bacteria 25164
19 Ga0055530_10023756 3300003791 Bacteria 1754
20 Ga0055540_1000139 3300003792 Bacteria 72664
21 Ga0055540_1005099 3300003792 Bacteria 5664
22 Ga0055531_10001011 3300003794 Bacteria 22322
23 Ga0055531_10001428 3300003794 Bacteria 17641
24 Ga0055543_1002213 3300004625 Bacteria 6640
25 Ga0065165_1032134 3300005262 Bacteria 1649
26 Ga0065712_10074751 3300005290 Bacteria 4017
27 Ga0065715_10125655 3300005293 Bacteria 2125
28 Ga0070690_100621272 3300005330 Bacteria 822
29 Ga0070666_10418855 3300005335 Bacteria 964
30 Ga0070660_100910441 3300005339 Bacteria 742
31 Ga0070689_101331409 3300005340 Bacteria 647
32 Ga0070668_100464256 3300005347 Bacteria 1091
33 Ga0070671_100803063 3300005355 Bacteria 819
34 Ga0070659_100189048 3300005366 Bacteria 1692
35 Ga0070667_100220124 3300005367 Bacteria 1690
36 Ga0070709_10174650 3300005434 Bacteria 1504
37 Ga0070713_100077968 3300005436 Bacteria 2819
38 Ga0070662_100024597 3300005457 Bacteria 4151
39 Ga0068867_102134257 3300005459 Bacteria 531
40 Ga0070707_100691281 3300005468 Bacteria 983
41 Ga0070698_100333283 3300005471 Bacteria 1449
42 Ga0070665_100536311 3300005548 Bacteria 1182
43 Ga0070665_101192046 3300005548 Bacteria 772
44 Ga0070704_100133103 3300005549 Bacteria 1930
45 Ga0068854_100900164 3300005578 Bacteria 778
46 Ga0068854_101276747 3300005578 Bacteria 660
47 Ga0068852_100392273 3300005616 Bacteria 1364
48 Ga0068859_100914047 3300005617 Bacteria 962
49 Ga0068859_100985410 3300005617 Bacteria 925
50 Ga0068859_101923231 3300005617 Bacteria 653
51 Ga0068862_100126678 3300005844 Bacteria 2255
52 Ga0068862_100550882 3300005844 Bacteria 1101
53 Ga0075365_10220801 3300006038 Bacteria 1329
54 Ga0075364_10444275 3300006051 Bacteria 886
55 Ga0075432_10061782 3300006058 Bacteria 1335
56 Ga0075366_10425718 3300006195 Bacteria 818
57 Ga0075431_100010649 3300006847 Bacteria 9243
58 Ga0075431_100256447 3300006847 Bacteria 1776
59 Ga0075434_100304445 3300006871 Bacteria 1614
60 Ga0097620_100913824 3300006931 Bacteria 962
61 Ga0097620_100985282 3300006931 Bacteria 925
62 Ga0097620_101924147 3300006931 Bacteria 653
63 Ga0079104_1029942 3300006946 Bacteria 1366
64 Ga0075435_100199990 3300007076 Bacteria 1693
65 Ga0105247_11561544 3300009101 Bacteria 540
66 Ga0114129_10476432 3300009147 Bacteria 1634
67 Ga0105243_10197736 3300009148 Bacteria 1761
68 Ga0105249_10977088 3300009553 Bacteria 915
69 Ga0105249_11081600 3300009553 Bacteria 872
70 Ga0157378_10388803 3300013297 Bacteria 1372
71 Ga0197907_10558889 3300020069 Bacteria 2372
72 Ga0206355_1190750 3300020076 Bacteria 2369
73 Ga0206350_11158194 3300020080 Bacteria 2380
74 Ga0206354_11128637 3300020081 Bacteria 1271
75 Ga0206353_11553818 3300020082 Bacteria 730
76 Ga0224712_10015766 3300022467 Bacteria 2466
77 Ga0209435_100047 3300025206 Bacteria 92749
78 Ga0207425_1008311 3300025245 Bacteria 2665
79 Ga0207425_1015815 3300025245 Bacteria 1685
80 Ga0207425_1057495 3300025245 Bacteria 693
81 Ga0209646_1000038 3300025246 Bacteria 353982
82 Ga0209026_1000180 3300025250 Bacteria 94396
83 Ga0209759_1000205 3300025256 Bacteria 92894
84 Ga0209129_1027855 3300025258 Bacteria 964
85 Ga0209565_1000016 3300025263 Bacteria 477707
86 Ga0209565_1007248 3300025263 Bacteria 3011
87 Ga0209673_1000495 3300025273 Bacteria 65000
88 Ga0209130_1000040 3300025284 Bacteria 262926
89 Ga0209130_1000354 3300025284 Bacteria 52516
90 Ga0209675_1000122 3300025291 Bacteria 106769
91 Ga0209675_1047196 3300025291 Bacteria 906
92 Ga0209676_1000395 3300025292 Bacteria 79555
93 Ga0209676_1007866 3300025292 Bacteria 4897
94 Ga0209676_1065839 3300025292 Bacteria 881
95 Ga0209025_1008715 3300025294 Bacteria 7233
96 Ga0209025_1020298 3300025294 Bacteria 3643
97 Ga0209025_1029250 3300025294 Bacteria 2673
98 Ga0209025_1100568 3300025294 Bacteria 916
99 Ga0209025_1121473 3300025294 Bacteria 779
100 Ga0209564_1001246 3300025295 Bacteria 28344
101 Ga0209564_1001744 3300025295 Bacteria 20355
102 Ga0209758_1007698 3300025297 Bacteria 7238
103 Ga0209050_1000084 3300025298 Bacteria 263245
104 Ga0209050_1005630 3300025298 Bacteria 7768
105 Ga0209050_1033887 3300025298 Bacteria 1540
106 Ga0209256_1000313 3300025299 Bacteria 84424
107 Ga0209256_1054753 3300025299 Bacteria 949
108 Ga0207426_1000359 3300025302 Bacteria 82359
109 Ga0207426_1001223 3300025302 Bacteria 22633
110 Ga0209051_1000058 3300025303 Bacteria 263137
111 Ga0209051_1000454 3300025303 Bacteria 54312
112 Ga0209257_1000022 3300025304 Bacteria 765258
113 Ga0209257_1000092 3300025304 Bacteria 263137
114 Ga0207699_10171532 3300025906 Unclassified 1452
115 Ga0207660_11234936 3300025917 Bacteria 608
116 Ga0207646_11235764 3300025922 Bacteria 654
117 Ga0207700_10385853 3300025928 Bacteria 1226
118 Ga0207644_10585779 3300025931 Bacteria 925
119 Ga0207690_10482845 3300025932 Bacteria 1000
120 Ga0207706_10000439 3300025933 Bacteria 44418
121 Ga0207668_10132364 3300025972 Bacteria 1906
122 Ga0207640_11841406 3300025981 Bacteria 547
123 Ga0207658_10237913 3300025986 Bacteria 1541
124 Ga0207639_10324730 3300026041 Bacteria 1367
125 Ga0207648_11784161 3300026089 Bacteria 577
126 Ga0207674_10898953 3300026116 Bacteria 854
127 Ga0268266_10915251 3300028379 Bacteria 848
128 Ga0268265_10157134 3300028380 Bacteria 1926
129 Ga0268265_10932536 3300028380 Bacteria 854
130 Ga0265332_10000005 3300031238 Bacteria 377525
131 Ga0307513_10000070 3300031456 Bacteria 139895
132 Ga0307513_10000072 3300031456 Bacteria 138840
133 Ga0307513_10286135 3300031456 Bacteria 1423
134 Ga0307408_100016984 3300031548 Bacteria 4866
135 Ga0307516_10008280 3300031730 Bacteria 11794
136 Ga0307516_10094859 3300031730 Bacteria 2807
137 Ga0307516_10136100 3300031730 Bacteria 2231
138 Ga0307405_10148526 3300031731 Bacteria 1645
139 Ga0307410_10367053 3300031852 Bacteria 1155
140 Ga0307410_10831803 3300031852 Bacteria 787
141 Ga0307406_10367753 3300031901 Bacteria 1129
142 Ga0307412_10977562 3300031911 Bacteria 747
143 Ga0307416_100924198 3300032002 Bacteria 973
144 Ga0373940_0054469 3300035088 Bacteria 1131
145 Ga0373951_0157188 3300035091 Bacteria 641
146 Ga0439436_0044231 3300041404 Bacteria 1269
147 Ga0451789_0728777 3300041443 Bacteria 708
148 Ga0451791_0238609 3300041451 Bacteria 599
149 Ga0451797_1393286 3300041453 Bacteria 697
150 Ga0451807_0018555 3300041486 Bacteria 1064
151 Ga0439433_0044838 3300041999 Bacteria 1034
152 Ga0439449_0000171 3300042007 Bacteria 22436
153 Ga0439449_0082645 3300042007 Bacteria 1185
154 Ga0439451_120773 3300042009 Bacteria 533
155 Ga0439462_0005486 3300042015 Bacteria 3127
156 Ga0450912_017246 3300042116 Bacteria 674
157 Ga0439460_0214996 3300042461 Bacteria 658
158 Ga0451577_0005030 3300042876 Bacteria 13670
159 Ga0451577_0479063 3300042876 Bacteria 1130
160 Ga0451577_0526423 3300042876 Bacteria 1073
161 Ga0451577_0729372 3300042876 Bacteria 897
162 Ga0451577_0775641 3300042876 Bacteria 867
163 Ga0466969_0000080 3300044656 Bacteria 51012
164 Ga0466969_0218506 3300044656 Bacteria 867
165 Ga0466972_0000388 3300044658 Bacteria 23520
166 Ga0466972_0632850 3300044658 Bacteria 506
167 Ga0453683_0003217 3300044673 Bacteria 12148
168 Ga0453683_0004154 3300044673 Bacteria 10369
169 Ga0466965_0009264 3300044683 Bacteria 4576
170 Ga0466966_0005303 3300044684 Bacteria 8477
171 Ga0466966_0009016 3300044684 Bacteria 6611
172 Ga0466961_0009757 3300044693 Bacteria 6110
173 Ga0466964_0249366 3300044706 Bacteria 875
174 Ga0453684_0006276 3300044712 Bacteria 22752
175 Ga0453684_0035398 3300044712 Bacteria 6901
176 Ga0453684_1536820 3300044712 Bacteria 685
177 Ga0466971_0065850 3300044719 Bacteria 1641
178 Ga0466970_0216257 3300044765 Bacteria 1069
179 Ga0466959_0067296 3300045049 Bacteria 2597
180 Ga0451576_0003410 3300045051 Bacteria 21876
181 Ga0451576_0007650 3300045051 Bacteria 12845
182 Ga0451576_0291281 3300045051 Bacteria 1707
183 Ga0451576_0589453 3300045051 Bacteria 1168
184 Ga0451576_2046172 3300045051 Bacteria 589
185 Ga0495603_0158729 3300046455 Bacteria 1312
186 Ga0495598_0438483 3300046537 Bacteria 515
187 Ga0495615_0215294 3300048090 Bacteria 598
188 Ga0496102_0583782 3300048905 Bacteria 1040
189 Ga0496102_1116279 3300048905 Bacteria 708
190 Ga0496110_0167164 3300048913 Bacteria 1995
191 Ga0501300_082071 3300049523 Bacteria 532
192 Ga0501032_0783243 3300049569 Bacteria 603
193 Ga0501033_0072603 3300049570 Bacteria 2527
194 Ga0501033_0099107 3300049570 Bacteria 2127
195 Ga0501034_0061539 3300049571 Bacteria 3769
196 Ga0501034_0136970 3300049571 Bacteria 2429
197 Ga0501036_0073662 3300049572 Bacteria 2887
198 Ga0501036_0718855 3300049572 Bacteria 825
199 Ga0501037_0270574 3300049573 Bacteria 1186
200 Ga0501039_1464702 3300049575 Bacteria 525
201 Ga0501043_0056940 3300049579 Bacteria 3070
202 Ga0501043_0702435 3300049579 Bacteria 739
203 Ga0501047_0112972 3300049581 Bacteria 2598
204 Ga0501047_0210718 3300049581 Bacteria 1802
205 Ga0501047_0418947 3300049581 Bacteria 1171
206 Ga0501047_0879229 3300049581 Bacteria 710
207 Ga0501048_0623029 3300049582 Bacteria 775
208 Ga0501067_0545579 3300049583 Bacteria 649
209 Ga0501068_0609243 3300049584 Bacteria 712
210 Ga0501071_0144997 3300049587 Bacteria 1770
211 Ga0501072_0134879 3300049588 Bacteria 1968
212 Ga0501073_0054217 3300049589 Bacteria 2807
213 Ga0501075_0062159 3300049591 Bacteria 2815
214 Ga0501076_0078703 3300049592 Bacteria 2646
215 Ga0501076_0871750 3300049592 Bacteria 742
216 Ga0501077_0160977 3300049593 Bacteria 1425
217 Ga0501077_0215978 3300049593 Bacteria 1219
218 Ga0501225_0260566 3300049705 Bacteria 574
219 Ga0501079_0422677 3300049741 Bacteria 1046
220 Ga0501079_1652287 3300049741 Bacteria 504
221 Ga0501080_0090780 3300049742 Bacteria 2837
222 Ga0501080_0996391 3300049742 Bacteria 727
223 Ga0501083_0592903 3300049744 Bacteria 721
224 Ga0501035_0441649 3300049822 Bacteria 1077
225 Ga0501044_0016456 3300049823 Bacteria 7938
226 Ga0501044_0197083 3300049823 Bacteria 1973
227 Ga0501044_0853357 3300049823 Bacteria 787
228 Ga0501044_1197992 3300049823 Bacteria 627
229 Ga0501045_0374416 3300049824 Bacteria 1060
230 Ga0501045_0510463 3300049824 Bacteria 893
231 nmdc:mga03683_441271_c1 3300050489 Bacteria 625
232 nmdc:mga00v17_404919_c1 3300050491 Bacteria 886
233 nmdc:mga0yw44_355671_c1 3300050492 Bacteria 986
234 nmdc:mga0k408_366045_c1 3300050493 Bacteria 859
235 nmdc:mga05p37_2183134_c1 3300050507 Bacteria 515
236 nmdc:mga09592_308839_c1 3300050508 Bacteria 1371
237 nmdc:mga06r32_69874_c1 3300050510 Bacteria 3395
238 Ga0500644_0042511 3300053088 Bacteria 1515
239 Ga0500566_0063961 3300053094 Bacteria 2077
240 Ga0500593_000627 3300053117 Bacteria 13548
241 Ga0500604_0295265 3300053151 Bacteria 562
242 Ga0500645_001312 3300053730 Bacteria 12902
243 Ga0500645_095877 3300053730 Bacteria 839
244 Ga0500645_101314 3300053730 Bacteria 812
245 Ga0501084_0192463 3300054114 Bacteria 1721
246 Ga0500661_002137 3300055283 Bacteria 3728
247 Ga0590074_010784 3300059423 Bacteria 1529
248 Ga0590077_014197 3300059426 Bacteria 1658
249 Ga0501082_0132866 3300060353 Bacteria 2159
250 Ga0466962_0029884 3300061719 Bacteria 2609
251 Ga0530510_0104015 3300061734 Bacteria 2077
252 Ga0530510_1252020 3300061734 Bacteria 569

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049823 Ga0501044_1197992 Ga0501044_1197992_11_361 111
2 3300044658 Ga0466972_0632850 Ga0466972_0632850_131_490 116
3 3300005340 Ga0070689_101331409 Ga0070689_1013314091 118
4 3300005355 Ga0070671_100803063 Ga0070671_1008030631 118
5 3300005367 Ga0070667_100220124 Ga0070667_1002201242 118
6 3300005459 Ga0068867_102134257 Ga0068867_1021342571 118
7 3300005548 Ga0070665_101192046 Ga0070665_1011920462 118
8 3300005617 Ga0068859_100985410 Ga0068859_1009854102 118
9 3300006931 Ga0097620_100985282 Ga0097620_1009852822 118
10 3300007076 Ga0075435_100199990 Ga0075435_1001999902 118
11 3300013297 Ga0157378_10388803 Ga0157378_103888032 118
12 3300025931 Ga0207644_10585779 Ga0207644_105857792 118
13 3300026089 Ga0207648_11784161 Ga0207648_117841611 118
14 3300028379 Ga0268266_10915251 Ga0268266_109152512 118
15 3300035088 Ga0373940_0054469 Ga0373940_0054469_207_620 118
16 3300035091 Ga0373951_0157188 Ga0373951_0157188_167_580 118
17 3300048905 Ga0496102_1116279 Ga0496102_1116279_10_423 118
18 3300005335 Ga0070666_10418855 Ga0070666_104188552 119
19 3300005347 Ga0070668_100464256 Ga0070668_1004642562 119
20 3300005844 Ga0068862_100550882 Ga0068862_1005508822 119
21 3300009553 Ga0105249_11081600 Ga0105249_110816002 119
22 3300025972 Ga0207668_10132364 Ga0207668_101323642 119
23 3300041453 Ga0451797_1393286 Ga0451797_1393286_85_486 121
24 3300005339 Ga0070660_100910441 Ga0070660_1009104411 122
25 3300005578 Ga0068854_100900164 Ga0068854_1009001642 122
26 3300025981 Ga0207640_11841406 Ga0207640_118414061 122
27 3300049588 Ga0501072_0134879 Ga0501072_0134879_1126_1503 122
28 3300049591 Ga0501075_0062159 Ga0501075_0062159_468_845 122
29 3300049592 Ga0501076_0078703 Ga0501076_0078703_642_1019 122
30 3300049593 Ga0501077_0160977 Ga0501077_0160977_516_893 122
31 3300049741 Ga0501079_0422677 Ga0501079_0422677_566_943 122
32 3300049742 Ga0501080_0996391 Ga0501080_0996391_240_626 122
33 3300060353 Ga0501082_0132866 Ga0501082_0132866_1767_2144 122
34 3300061734 Ga0530510_0104015 Ga0530510_0104015_1105_1482 122
35 3300042876 Ga0451577_0479063 Ga0451577_0479063_522_902 124
36 3300049592 Ga0501076_0871750 Ga0501076_0871750_114_533 124
37 3300049824 Ga0501045_0374416 Ga0501045_0374416_99_518 124
38 3300050507 nmdc:mga05p37_2183134_c1 nmdc:mga05p37_2183134_c1_34_435 124
39 3300050508 nmdc:mga09592_308839_c1 nmdc:mga09592_308839_c1_688_1089 124
40 3300050510 nmdc:mga06r32_69874_c1 nmdc:mga06r32_69874_c1_2745_3146 124
41 3300061734 Ga0530510_1252020 Ga0530510_1252020_66_452 124
42 iso_pu_bacteria 2834578030 2834580796 124
43 iso_pu_bacteria 2996310559 2996314726 124
44 3300042009 Ga0439451_120773 Ga0439451_120773_47_466 125
45 iso_pu_bacteria 2511231002 2511244441 126
46 iso_pu_bacteria 2919704043 2919708410 127
47 3300005457 Ga0070662_100024597 Ga0070662_1000245975 128
48 3300005471 Ga0070698_100333283 Ga0070698_1003332832 128
49 3300005616 Ga0068852_100392273 Ga0068852_1003922732 128
50 3300025917 Ga0207660_11234936 Ga0207660_112349362 128
51 3300025933 Ga0207706_10000439 Ga0207706_1000043934 128
52 3300028380 Ga0268265_10932536 Ga0268265_109325362 128
53 3300031852 Ga0307410_10367053 Ga0307410_103670532 128
54 3300032002 Ga0307416_100924198 Ga0307416_1009241982 128
55 3300044656 Ga0466969_0000080 Ga0466969_0000080_39798_40193 128
56 3300044656 Ga0466969_0218506 Ga0466969_0218506_381_776 128
57 3300044658 Ga0466972_0000388 Ga0466972_0000388_8581_8976 128
58 3300044683 Ga0466965_0009264 Ga0466965_0009264_3079_3474 128
59 3300044684 Ga0466966_0005303 Ga0466966_0005303_4314_4709 128
60 3300044684 Ga0466966_0009016 Ga0466966_0009016_4047_4442 128
61 3300044693 Ga0466961_0009757 Ga0466961_0009757_3084_3479 128
62 3300044706 Ga0466964_0249366 Ga0466964_0249366_350_745 128
63 3300044719 Ga0466971_0065850 Ga0466971_0065850_381_776 128
64 3300044765 Ga0466970_0216257 Ga0466970_0216257_76_471 128
65 3300045049 Ga0466959_0067296 Ga0466959_0067296_708_1103 128
66 3300049593 Ga0501077_0215978 Ga0501077_0215978_607_999 128
67 3300061719 Ga0466962_0029884 Ga0466962_0029884_653_1048 128
68 3300031852 Ga0307410_10831803 Ga0307410_108318032 129
69 3300046537 Ga0495598_0438483 Ga0495598_0438483_28_423 129
70 3300002704 JGI25155J39150_1000059 JGI25155J39150_100005915 130
71 3300002705 JGI25156J39149_1000081 JGI25156J39149_100008115 130
72 3300002738 JGI25154J39366_1000109 JGI25154J39366_100010915 130
73 3300002741 JGI25157J39369_1000103 JGI25157J39369_100010348 130
74 3300002987 JGI25159J45721_1000246 JGI25159J45721_10002466 130
75 3300002987 JGI25159J45721_1023333 JGI25159J45721_10233332 130
76 3300003187 JGI25151J46595_10003461 JGI25151J46595_100034616 130
77 3300003187 JGI25151J46595_10047649 JGI25151J46595_100476492 130
78 3300003354 JGI25160J50197_1000451 JGI25160J50197_10004516 130
79 3300003374 JGI25161J50226_1000077 JGI25161J50226_100007728 130
80 3300003771 Ga0055526_1015582 Ga0055526_10155822 130
81 3300003771 Ga0055526_1021290 Ga0055526_10212904 130
82 3300003773 Ga0055537_1000872 Ga0055537_100087211 130
83 3300003775 Ga0055524_1000344 Ga0055524_100034415 130
84 3300003784 Ga0055534_1001218 Ga0055534_100121811 130
85 3300003790 Ga0055528_1000729 Ga0055528_10007296 130
86 3300003791 Ga0055530_10000853 Ga0055530_100008537 130
87 3300003791 Ga0055530_10023756 Ga0055530_100237562 130
88 3300003792 Ga0055540_1000139 Ga0055540_100013941 130
89 3300003792 Ga0055540_1005099 Ga0055540_10050997 130
90 3300003794 Ga0055531_10001011 Ga0055531_100010115 130
91 3300003794 Ga0055531_10001428 Ga0055531_1000142812 130
92 3300004625 Ga0055543_1002213 Ga0055543_10022136 130
93 3300005262 Ga0065165_1032134 Ga0065165_10321341 130
94 3300005468 Ga0070707_100691281 Ga0070707_1006912812 130
95 3300005578 Ga0068854_101276747 Ga0068854_1012767472 130
96 3300005617 Ga0068859_101923231 Ga0068859_1019232312 130
97 3300006051 Ga0075364_10444275 Ga0075364_104442752 130
98 3300006058 Ga0075432_10061782 Ga0075432_100617821 130
99 3300006195 Ga0075366_10425718 Ga0075366_104257182 130
100 3300006931 Ga0097620_101924147 Ga0097620_1019241471 130
101 3300006946 Ga0079104_1029942 Ga0079104_10299422 130
102 3300025206 Ga0209435_100047 Ga0209435_10004747 130
103 3300025245 Ga0207425_1008311 Ga0207425_10083113 130
104 3300025245 Ga0207425_1015815 Ga0207425_10158152 130
105 3300025245 Ga0207425_1057495 Ga0207425_10574951 130
106 3300025246 Ga0209646_1000038 Ga0209646_1000038293 130
107 3300025250 Ga0209026_1000180 Ga0209026_100018047 130
108 3300025256 Ga0209759_1000205 Ga0209759_100020547 130
109 3300025258 Ga0209129_1027855 Ga0209129_10278551 130
110 3300025263 Ga0209565_1000016 Ga0209565_100001653 130
111 3300025263 Ga0209565_1007248 Ga0209565_10072483 130
112 3300025273 Ga0209673_1000495 Ga0209673_100049553 130
113 3300025284 Ga0209130_1000040 Ga0209130_1000040191 130
114 3300025284 Ga0209130_1000354 Ga0209130_100035431 130
115 3300025291 Ga0209675_1000122 Ga0209675_100012238 130
116 3300025291 Ga0209675_1047196 Ga0209675_10471961 130
117 3300025292 Ga0209676_1000395 Ga0209676_100039552 130
118 3300025292 Ga0209676_1007866 Ga0209676_10078665 130
119 3300025292 Ga0209676_1065839 Ga0209676_10658392 130
120 3300025294 Ga0209025_1008715 Ga0209025_10087153 130
121 3300025294 Ga0209025_1020298 Ga0209025_10202982 130
122 3300025294 Ga0209025_1029250 Ga0209025_10292505 130
123 3300025294 Ga0209025_1100568 Ga0209025_11005682 130
124 3300025294 Ga0209025_1121473 Ga0209025_11214732 130
125 3300025295 Ga0209564_1001246 Ga0209564_100124623 130
126 3300025295 Ga0209564_1001744 Ga0209564_10017442 130
127 3300025297 Ga0209758_1007698 Ga0209758_10076984 130
128 3300025298 Ga0209050_1000084 Ga0209050_100008452 130
129 3300025298 Ga0209050_1005630 Ga0209050_10056305 130
130 3300025298 Ga0209050_1033887 Ga0209050_10338872 130
131 3300025299 Ga0209256_1000313 Ga0209256_100031324 130
132 3300025299 Ga0209256_1054753 Ga0209256_10547532 130
133 3300025302 Ga0207426_1000359 Ga0207426_100035922 130
134 3300025302 Ga0207426_1001223 Ga0207426_10012235 130
135 3300025303 Ga0209051_1000058 Ga0209051_100005852 130
136 3300025303 Ga0209051_1000454 Ga0209051_100045431 130
137 3300025304 Ga0209257_1000022 Ga0209257_1000022736 130
138 3300025304 Ga0209257_1000092 Ga0209257_100009252 130
139 3300025922 Ga0207646_11235764 Ga0207646_112357641 130
140 3300026041 Ga0207639_10324730 Ga0207639_103247303 130
141 3300026116 Ga0207674_10898953 Ga0207674_108989532 130
142 3300031238 Ga0265332_10000005 Ga0265332_1000000537 130
143 3300031456 Ga0307513_10000070 Ga0307513_1000007092 130
144 3300031456 Ga0307513_10000072 Ga0307513_1000007271 130
145 3300031456 Ga0307513_10286135 Ga0307513_102861353 130
146 3300031548 Ga0307408_100016984 Ga0307408_1000169845 130
147 3300031730 Ga0307516_10008280 Ga0307516_100082804 130
148 3300031730 Ga0307516_10094859 Ga0307516_100948592 130
149 3300031730 Ga0307516_10136100 Ga0307516_101361003 130
150 3300031731 Ga0307405_10148526 Ga0307405_101485262 130
151 3300031901 Ga0307406_10367753 Ga0307406_103677532 130
152 3300031911 Ga0307412_10977562 Ga0307412_109775621 130
153 3300041443 Ga0451789_0728777 Ga0451789_0728777_183_605 130
154 3300042876 Ga0451577_0729372 Ga0451577_0729372_335_757 130
155 3300045051 Ga0451576_0291281 Ga0451576_0291281_1190_1603 130
156 3300045051 Ga0451576_2046172 Ga0451576_2046172_160_573 130
157 3300049581 Ga0501047_0879229 Ga0501047_0879229_186_590 130
158 3300050489 nmdc:mga03683_441271_c1 nmdc:mga03683_441271_c1_78_500 130
159 3300050491 nmdc:mga00v17_404919_c1 nmdc:mga00v17_404919_c1_420_833 130
160 3300050493 nmdc:mga0k408_366045_c1 nmdc:mga0k408_366045_c1_45_458 130
161 3300053088 Ga0500644_0042511 Ga0500644_0042511_554_985 130
162 3300053094 Ga0500566_0063961 Ga0500566_0063961_388_810 130
163 3300053117 Ga0500593_000627 Ga0500593_000627_255_686 130
164 3300053151 Ga0500604_0295265 Ga0500604_0295265_39_461 130
165 3300053730 Ga0500645_001312 Ga0500645_001312_3772_4194 130
166 3300053730 Ga0500645_095877 Ga0500645_095877_141_563 130
167 3300053730 Ga0500645_101314 Ga0500645_101314_198_629 130
168 3300055283 Ga0500661_002137 Ga0500661_002137_2443_2865 130
169 3300005617 Ga0068859_100914047 Ga0068859_1009140472 131
170 3300005844 Ga0068862_100126678 Ga0068862_1001266782 131
171 3300006038 Ga0075365_10220801 Ga0075365_102208012 131
172 3300006847 Ga0075431_100256447 Ga0075431_1002564472 131
173 3300006931 Ga0097620_100913824 Ga0097620_1009138242 131
174 3300028380 Ga0268265_10157134 Ga0268265_101571342 131
175 3300041486 Ga0451807_0018555 Ga0451807_0018555_157_582 131
176 3300041999 Ga0439433_0044838 Ga0439433_0044838_486_908 131
177 3300042007 Ga0439449_0000171 Ga0439449_0000171_1103_1525 131
178 3300042007 Ga0439449_0082645 Ga0439449_0082645_235_654 131
179 3300042015 Ga0439462_0005486 Ga0439462_0005486_778_1200 131
180 3300042461 Ga0439460_0214996 Ga0439460_0214996_36_467 131
181 3300042876 Ga0451577_0005030 Ga0451577_0005030_6750_7175 131
182 3300042876 Ga0451577_0526423 Ga0451577_0526423_382_807 131
183 3300042876 Ga0451577_0775641 Ga0451577_0775641_49_477 131
184 3300044673 Ga0453683_0003217 Ga0453683_0003217_9926_10351 131
185 3300044673 Ga0453683_0004154 Ga0453683_0004154_7495_7914 131
186 3300044712 Ga0453684_0006276 Ga0453684_0006276_5374_5799 131
187 3300044712 Ga0453684_0035398 Ga0453684_0035398_6294_6719 131
188 3300044712 Ga0453684_1536820 Ga0453684_1536820_77_499 131
189 3300045051 Ga0451576_0003410 Ga0451576_0003410_15231_15656 131
190 3300045051 Ga0451576_0007650 Ga0451576_0007650_3211_3630 131
191 3300045051 Ga0451576_0589453 Ga0451576_0589453_655_1077 131
192 3300049523 Ga0501300_082071 Ga0501300_082071_40_459 131
193 3300049569 Ga0501032_0783243 Ga0501032_0783243_52_471 131
194 3300049570 Ga0501033_0072603 Ga0501033_0072603_1019_1438 131
195 3300049572 Ga0501036_0718855 Ga0501036_0718855_322_741 131
196 3300049573 Ga0501037_0270574 Ga0501037_0270574_755_1174 131
197 3300049575 Ga0501039_1464702 Ga0501039_1464702_66_485 131
198 3300049581 Ga0501047_0418947 Ga0501047_0418947_245_664 131
199 3300049582 Ga0501048_0623029 Ga0501048_0623029_15_425 131
200 3300049587 Ga0501071_0144997 Ga0501071_0144997_833_1240 131
201 3300049705 Ga0501225_0260566 Ga0501225_0260566_76_495 131
202 3300049741 Ga0501079_1652287 Ga0501079_1652287_14_421 131
203 3300049823 Ga0501044_0197083 Ga0501044_0197083_373_792 131
204 3300049824 Ga0501045_0510463 Ga0501045_0510463_193_600 131
205 3300050492 nmdc:mga0yw44_355671_c1 nmdc:mga0yw44_355671_c1_161_604 131
206 3300059423 Ga0590074_010784 Ga0590074_010784_883_1305 131
207 3300059426 Ga0590077_014197 Ga0590077_014197_1161_1583 131
208 3300041451 Ga0451791_0238609 Ga0451791_0238609_96_587 132
209 3300049579 Ga0501043_0702435 Ga0501043_0702435_139_552 132
210 3300049581 Ga0501047_0210718 Ga0501047_0210718_751_1164 132
211 3300049822 Ga0501035_0441649 Ga0501035_0441649_187_594 132
212 3300049823 Ga0501044_0853357 Ga0501044_0853357_358_771 132
213 2162886011 MRS1b_contig_3250830 MRS1b_0393.00001360 133
214 3300005290 Ga0065712_10074751 Ga0065712_100747514 133
215 3300005293 Ga0065715_10125655 Ga0065715_101256551 133
216 3300005330 Ga0070690_100621272 Ga0070690_1006212722 133
217 3300005366 Ga0070659_100189048 Ga0070659_1001890482 133
218 3300005434 Ga0070709_10174650 Ga0070709_101746502 133
219 3300005436 Ga0070713_100077968 Ga0070713_1000779685 133
220 3300005548 Ga0070665_100536311 Ga0070665_1005363111 133
221 3300005549 Ga0070704_100133103 Ga0070704_1001331032 133
222 3300006847 Ga0075431_100010649 Ga0075431_10001064912 133
223 3300006871 Ga0075434_100304445 Ga0075434_1003044451 133
224 3300009101 Ga0105247_11561544 Ga0105247_115615441 133
225 3300009147 Ga0114129_10476432 Ga0114129_104764322 133
226 3300009148 Ga0105243_10197736 Ga0105243_101977362 133
227 3300009553 Ga0105249_10977088 Ga0105249_109770882 133
228 3300020069 Ga0197907_10558889 Ga0197907_105588893 133
229 3300020076 Ga0206355_1190750 Ga0206355_11907503 133
230 3300020080 Ga0206350_11158194 Ga0206350_111581943 133
231 3300020081 Ga0206354_11128637 Ga0206354_111286373 133
232 3300020082 Ga0206353_11553818 Ga0206353_115538182 133
233 3300022467 Ga0224712_10015766 Ga0224712_100157663 133
234 3300025906 Ga0207699_10171532 Ga0207699_101715322 133
235 3300025928 Ga0207700_10385853 Ga0207700_103858532 133
236 3300025932 Ga0207690_10482845 Ga0207690_104828452 133
237 3300025986 Ga0207658_10237913 Ga0207658_102379133 133
238 3300041404 Ga0439436_0044231 Ga0439436_0044231_423_884 133
239 3300042116 Ga0450912_017246 Ga0450912_017246_130_603 133
240 3300046455 Ga0495603_0158729 Ga0495603_0158729_43_507 133
241 3300048090 Ga0495615_0215294 Ga0495615_0215294_170_580 133
242 3300048905 Ga0496102_0583782 Ga0496102_0583782_377_790 133
243 3300048913 Ga0496110_0167164 Ga0496110_0167164_1001_1402 133
244 3300049570 Ga0501033_0099107 Ga0501033_0099107_1127_1531 133
245 3300049571 Ga0501034_0061539 Ga0501034_0061539_3091_3495 133
246 3300049571 Ga0501034_0136970 Ga0501034_0136970_1154_1561 133
247 3300049572 Ga0501036_0073662 Ga0501036_0073662_1989_2393 133
248 3300049579 Ga0501043_0056940 Ga0501043_0056940_2357_2761 133
249 3300049581 Ga0501047_0112972 Ga0501047_0112972_678_1082 133
250 3300049583 Ga0501067_0545579 Ga0501067_0545579_216_629 133
251 3300049584 Ga0501068_0609243 Ga0501068_0609243_245_649 133
252 3300049589 Ga0501073_0054217 Ga0501073_0054217_1523_1927 133
253 3300049742 Ga0501080_0090780 Ga0501080_0090780_1244_1648 133
254 3300049744 Ga0501083_0592903 Ga0501083_0592903_35_439 133
255 3300049823 Ga0501044_0016456 Ga0501044_0016456_6568_6972 133
256 3300054114 Ga0501084_0192463 Ga0501084_0192463_836_1240 133

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00581

Rhodanese

Rhodanese-like domain

22

123

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hhg-assembly1.cif.gz_A structure of protein of unknown function rpa3614, possible tyrosine phosphatase, from rhodopseudomonas palustris cga009 0.9663 1 128
2hhg-assembly1.cif.gz_A structure of protein of unknown function rpa3614, possible tyrosine phosphatase, from rhodopseudomonas palustris cga009 0.9309 1 128
3gk5-assembly1.cif.gz_A crystal structure of rhodanese-related protein (tvg0868615) from thermoplasma volcanium, northeast structural genomics consortium target tvr109a 0.9121 21 128
5ve4-assembly2.cif.gz_B crystal structure of persulfide dioxygenase-rhodanese fusion protein with rhodanese domain inactivating mutation (c314s) from burkholderia phytofirmans 0.9061 22 128
3foj-assembly1.cif.gz_A crystal structure of ssp1007 from staphylococcus saprophyticus subsp. saprophyticus. northeast structural genomics target syr101a. 0.8852 21 120
ID Description Score Start End Superfamily
2hhgA00 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.941 1 128 3.40.250.10
2hhgA00 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9339 1 128 3.40.250.10
3gk5A00 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9121 21 128 3.40.250.10
af_O53414_1_124_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9031 6 124 3.40.250.10
3ntaA03 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8958 19 123 3.40.250.10
ID Description Score Start End GO Terms
AF-A0A0Q8REZ1-F1-model_v4 Rhodanese 0.9873 5 133 GO:0004792
AF-A0A0R2U0F8-F1-model_v4 Rhodanese 0.9846 5 117 GO:0004792
AF-A0A1I7EFH7-F1-model_v4 Rhodanese-related sulfurtransferase 0.9814 32 133 GO:0004792
AF-A0A4Q7FZ23-F1-model_v4 Rhodanese 0.9783 1 133 GO:0004792
AF-A0A2E6ME15-F1-model_v4 deleted 0.9764 4 131

Feature Viewer

pLDDT pTM Quality
92.86 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map