F366353

General Info

Members Datasets Scaffolds Average Seq Length
256 192 256 245

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10037091|Ga0081455_100370914
Length 232
Sequence MQWSDEGIVLGIRRHGEANAILELLTRAHGRHLGLVRGGAGTRLQAVLQPGNRIISTWRARLDEHLGHYAVEALDSRAASFLSVPHALYGMTHLAALCRLLPERDPHPDLARAGASVVRFELLLLGELGFGLDLATCAVSGRTDDLVYVSPKSGRAVSRREGEPWKDKLLALPAFLREPCDPSPQDIADGFALTGFFLLRHALEPRGLGFADARANFIAALERDGRDALAVG

Samples

Sample ID Description Type Environment
1 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
44 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
62 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
63 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
96 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
97 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
98 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
99 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
100 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
101 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
102 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
103 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
104 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
112 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
113 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
114 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
115 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
116 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
117 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
122 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
123 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
124 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
125 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
126 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
127 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
128 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
129 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
130 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
131 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
132 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
155 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
156 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
157 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
158 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
166 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
167 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
168 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
169 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
170 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
171 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
178 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
179 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
180 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
181 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
182 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
183 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
184 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
185 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
186 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
187 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
188 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
189 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
190 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
191 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
192 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0.39
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.77
Nodule 0
Rhizoplane 3.91
Rhizosphere 82.03
Stem 0
Stem Tuber 0
Unclassified 4.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10093318 3300003316 Bacteria 1516
2 rootH1_10093318 3300003323 Bacteria 1480
3 JGI25405J52794_10007168 3300003911 Bacteria 2051
4 Ga0070683_100261331 3300005329 Bacteria 1647
5 Ga0070680_100082617 3300005336 Bacteria 2652
6 Ga0070682_100092986 3300005337 Bacteria 1977
7 Ga0070689_100255379 3300005340 Bacteria 1447
8 Ga0070692_10249342 3300005345 Bacteria 1062
9 Ga0070675_100132103 3300005354 Bacteria 2128
10 Ga0070674_100010528 3300005356 Bacteria 5596
11 Ga0070688_100583511 3300005365 Bacteria 854
12 Ga0070667_100224216 3300005367 Bacteria 1674
13 Ga0070714_100401166 3300005435 Bacteria 1296
14 Ga0070713_100025816 3300005436 Bacteria 4601
15 Ga0070713_100466622 3300005436 Bacteria 1188
16 Ga0070713_100742224 3300005436 Bacteria 939
17 Ga0070711_100058857 3300005439 Bacteria 2666
18 Ga0070711_100151530 3300005439 Bacteria 1749
19 Ga0070678_100013045 3300005456 Bacteria 5193
20 Ga0070681_10641915 3300005458 Bacteria 976
21 Ga0070672_100242426 3300005543 Bacteria 1516
22 Ga0070693_100080412 3300005547 Bacteria 1942
23 Ga0070693_100418145 3300005547 Bacteria 933
24 Ga0070665_100167962 3300005548 Bacteria 2196
25 Ga0068855_100309355 3300005563 Bacteria 1748
26 Ga0068857_100386445 3300005577 Bacteria 1300
27 Ga0068856_100184259 3300005614 Bacteria 2101
28 Ga0068859_100416089 3300005617 Bacteria 1440
29 Ga0068861_100414443 3300005719 Bacteria 1199
30 Ga0068858_100211173 3300005842 Bacteria 1837
31 Ga0068858_100494151 3300005842 Bacteria 1182
32 Ga0081455_10037091 3300005937 Bacteria 4333
33 Ga0070717_10498151 3300006028 Bacteria 1101
34 Ga0075365_10159272 3300006038 Bacteria 1572
35 Ga0075363_100009047 3300006048 Bacteria 4672
36 Ga0075364_10039820 3300006051 Bacteria 3047
37 Ga0075364_10217415 3300006051 Bacteria 1296
38 Ga0070716_100194483 3300006173 Bacteria 1343
39 Ga0070712_100006908 3300006175 Bacteria 7072
40 Ga0075362_10003265 3300006177 Bacteria 5635
41 Ga0075362_10101461 3300006177 Bacteria 1346
42 Ga0075366_10005988 3300006195 Bacteria 6623
43 Ga0075428_100005019 3300006844 Bacteria 14707
44 Ga0075430_100003454 3300006846 Bacteria 13221
45 Ga0075431_100075149 3300006847 Bacteria 3487
46 Ga0075434_100084692 3300006871 Bacteria 3169
47 Ga0075429_100011493 3300006880 Bacteria 7676
48 Ga0068865_100652236 3300006881 Bacteria 895
49 Ga0097620_100416104 3300006931 Bacteria 1440
50 Ga0099794_10026795 3300007265 Bacteria 2668
51 Ga0099795_10018656 3300007788 Bacteria 2233
52 Ga0105240_10927241 3300009093 Bacteria 935
53 Ga0111539_10003464 3300009094 Bacteria 20784
54 Ga0111539_10018734 3300009094 Bacteria 8570
55 Ga0105245_10126286 3300009098 Bacteria 2395
56 Ga0105245_10287432 3300009098 Bacteria 1609
57 Ga0105247_10009531 3300009101 Bacteria 5892
58 Ga0114129_10003903 3300009147 Bacteria 21043
59 Ga0105243_10313930 3300009148 Bacteria 1425
60 Ga0105241_10080010 3300009174 Bacteria 2556
61 Ga0105241_10225546 3300009174 Bacteria 1577
62 Ga0105238_10085445 3300009551 Bacteria 3143
63 Ga0099796_10066271 3300010159 Unclassified 1293
64 Ga0157370_10172647 3300013104 Bacteria 2009
65 Ga0157369_10432465 3300013105 Bacteria 1364
66 Ga0157378_10273561 3300013297 Bacteria 1625
67 Ga0157380_10109386 3300014326 Bacteria 2319
68 Ga0206356_10955678 3300020070 Bacteria 1152
69 Ga0213874_10047407 3300021377 Bacteria 1307
70 Ga0213876_10158128 3300021384 Bacteria 1205
71 Ga0213875_10000025 3300021388 Bacteria 197787
72 Ga0209233_1006564 3300025261 Bacteria 3740
73 Ga0207682_10001000 3300025893 Bacteria 13076
74 Ga0207688_10094012 3300025901 Bacteria 1724
75 Ga0207699_10009691 3300025906 Bacteria 4807
76 Ga0207643_10075204 3300025908 Bacteria 1949
77 Ga0207643_10210374 3300025908 Bacteria 1187
78 Ga0207707_10207526 3300025912 Bacteria 1707
79 Ga0207695_10596393 3300025913 Bacteria 986
80 Ga0207693_10013245 3300025915 Bacteria 6653
81 Ga0207693_10035798 3300025915 Bacteria 3914
82 Ga0207663_10030050 3300025916 Bacteria 3200
83 Ga0207663_10037008 3300025916 Bacteria 2939
84 Ga0207663_10158751 3300025916 Bacteria 1594
85 Ga0207663_10224966 3300025916 Bacteria 1367
86 Ga0207662_10029966 3300025918 Bacteria 3155
87 Ga0207681_10177141 3300025923 Bacteria 1621
88 Ga0207694_10144899 3300025924 Bacteria 1911
89 Ga0207687_10089373 3300025927 Bacteria 2243
90 Ga0207700_10006284 3300025928 Bacteria 7169
91 Ga0207700_10146716 3300025928 Bacteria 1945
92 Ga0207669_10017878 3300025937 Bacteria 3649
93 Ga0207704_10202224 3300025938 Bacteria 1455
94 Ga0207704_10348227 3300025938 Bacteria 1153
95 Ga0207691_10008196 3300025940 Bacteria 10037
96 Ga0207711_10236615 3300025941 Bacteria 1674
97 Ga0207689_10042470 3300025942 Bacteria 3761
98 Ga0207679_10313452 3300025945 Bacteria 1356
99 Ga0207667_10122490 3300025949 Bacteria 2679
100 Ga0207651_10167537 3300025960 Bacteria 1729
101 Ga0207651_10426585 3300025960 Bacteria 1133
102 Ga0207658_10328588 3300025986 Bacteria 1326
103 Ga0207703_10158780 3300026035 Bacteria 1979
104 Ga0207639_10340837 3300026041 Bacteria 1336
105 Ga0207676_10076512 3300026095 Bacteria 2704
106 Ga0207674_10576810 3300026116 Bacteria 1087
107 Ga0207683_10072471 3300026121 Bacteria 3046
108 Ga0209813_10026082 3300027866 Bacteria 1687
109 Ga0207428_10028509 3300027907 Bacteria 4638
110 Ga0207428_10041467 3300027907 Bacteria 3726
111 Ga0268265_10228369 3300028380 Bacteria 1634
112 Ga0268265_10554800 3300028380 Bacteria 1091
113 Ga0265337_1012331 3300028556 Bacteria 2909
114 Ga0265338_10261627 3300028800 Bacteria 1272
115 Ga0265325_10014439 3300031241 Bacteria 4464
116 Ga0307513_10309038 3300031456 Bacteria 1344
117 Ga0265313_10111798 3300031595 Bacteria 1200
118 Ga0265314_10086344 3300031711 Bacteria 2055
119 Ga0373950_0007236 3300034818 Bacteria 1718
120 Ga0373960_0050596 3300035121 Bacteria 1232
121 Ga0373946_0022794 3300035171 Bacteria 2441
122 Ga0373955_0070670 3300035172 Bacteria 1951
123 Ga0373931_0030255 3300035691 Bacteria 2786
124 Ga0373935_0051874 3300035692 Bacteria 2606
125 Ga0373933_0151381 3300035724 Bacteria 1469
126 Ga0373937_0091006 3300036401 Bacteria 2826
127 Ga0373937_0272891 3300036401 Bacteria 1596
128 Ga0316584_0026489 3300036712 Bacteria 4262
129 Ga0373925_0053300 3300037068 Bacteria 3023
130 Ga0373925_0167227 3300037068 Bacteria 1735
131 Ga0436364_0318172 3300037853 Bacteria 79481
132 Ga0436365_0015900 3300039437 Bacteria 1026
133 Ga0436365_0555806 3300039437 Bacteria 3466
134 Ga0436365_0580827 3300039437 Bacteria 3925
135 Ga0436363_0490513 3300039450 Bacteria 3798
136 Ga0439443_002033 3300042003 Bacteria 2363
137 Ga0439446_0090252 3300042156 Bacteria 959
138 Ga0439435_0060113 3300042436 Bacteria 1106
139 Ga0439460_0006973 3300042461 Bacteria 2817
140 Ga0495592_0008136 3300046454 Bacteria 7877
141 Ga0495638_0000936 3300046460 Bacteria 29581
142 Ga0495651_0052684 3300046462 Bacteria 3134
143 Ga0495605_0150899 3300046474 Bacteria 1037
144 Ga0495628_0002339 3300046516 Bacteria 17109
145 Ga0495637_0173273 3300046520 Bacteria 804
146 Ga0495652_0007265 3300046529 Bacteria 10223
147 Ga0495640_0323121 3300046533 Bacteria 955
148 Ga0495645_0000537 3300046543 Bacteria 26052
149 Ga0495668_0309730 3300046616 Bacteria 866
150 Ga0495635_0005336 3300046663 Bacteria 8947
151 Ga0495599_0005425 3300046678 Bacteria 7621
152 Ga0495600_0025030 3300046809 Bacteria 3845
153 Ga0495680_0016448 3300047322 Bacteria 6352
154 Ga0495675_0075269 3300047444 Bacteria 2128
155 Ga0495685_100879 3300047447 Bacteria 953
156 Ga0495615_0050164 3300048090 Bacteria 1072
157 Ga0496104_0000761 3300048907 Bacteria 27599
158 Ga0496104_0049016 3300048907 Bacteria 3983
159 Ga0496104_0196900 3300048907 Bacteria 1927
160 Ga0496105_0000600 3300048908 Bacteria 24051
161 Ga0496106_0082259 3300048909 Bacteria 2475
162 Ga0496107_0221281 3300048910 Bacteria 1408
163 Ga0496112_0701412 3300048915 Bacteria 940
164 Ga0496114_0022959 3300048917 Bacteria 5086
165 Ga0496115_0211829 3300048918 Bacteria 1600
166 Ga0496115_0339172 3300048918 Bacteria 1227
167 Ga0501031_0049323 3300049568 Bacteria 2744
168 Ga0501032_0092658 3300049569 Bacteria 2004
169 Ga0501033_0035224 3300049570 Bacteria 3753
170 Ga0501034_0000097 3300049571 Bacteria 161027
171 Ga0501034_0002259 3300049571 Bacteria 23638
172 Ga0501034_0047106 3300049571 Bacteria 4355
173 Ga0501034_0321728 3300049571 Bacteria 1480
174 Ga0501034_0527208 3300049571 Bacteria 1092
175 Ga0501036_0000954 3300049572 Bacteria 21767
176 Ga0501036_0022035 3300049572 Bacteria 5358
177 Ga0501036_0198883 3300049572 Bacteria 1686
178 Ga0501038_0131646 3300049574 Bacteria 2053
179 Ga0501038_0227045 3300049574 Bacteria 1487
180 Ga0501041_0317772 3300049577 Bacteria 982
181 Ga0501043_0043237 3300049579 Bacteria 3541
182 Ga0501046_0030532 3300049580 Bacteria 4373
183 Ga0501046_0160892 3300049580 Bacteria 1689
184 Ga0501047_0000218 3300049581 Bacteria 68952
185 Ga0501047_0067483 3300049581 Bacteria 3447
186 Ga0501048_0000313 3300049582 Bacteria 33165
187 Ga0501068_0013944 3300049584 Bacteria 4584
188 Ga0501069_0084219 3300049585 Bacteria 1793
189 Ga0501070_0013530 3300049586 Bacteria 6878
190 Ga0501070_0018953 3300049586 Bacteria 5771
191 Ga0501070_0414992 3300049586 Bacteria 1087
192 Ga0501072_0001601 3300049588 Bacteria 16914
193 Ga0501072_0034802 3300049588 Bacteria 3947
194 Ga0501072_0164976 3300049588 Bacteria 1767
195 Ga0501073_0032682 3300049589 Bacteria 3709
196 Ga0501074_0027394 3300049590 Bacteria 4132
197 Ga0501074_0040419 3300049590 Bacteria 3378
198 Ga0501074_0107164 3300049590 Bacteria 2001
199 Ga0501075_0060800 3300049591 Bacteria 2846
200 Ga0501076_0055802 3300049592 Bacteria 3133
201 Ga0501079_0126617 3300049741 Bacteria 1987
202 Ga0501079_0169314 3300049741 Bacteria 1703
203 Ga0501080_0001471 3300049742 Bacteria 19833
204 Ga0501080_0028798 3300049742 Bacteria 5170
205 Ga0501080_0391749 3300049742 Bacteria 1250
206 Ga0501081_0017467 3300049743 Bacteria 4750
207 Ga0501081_0597163 3300049743 Bacteria 826
208 Ga0501083_0001547 3300049744 Bacteria 15730
209 Ga0501083_0085161 3300049744 Bacteria 2092
210 Ga0501035_0003871 3300049822 Bacteria 14283
211 Ga0501035_0186721 3300049822 Bacteria 1784
212 Ga0501035_0779637 3300049822 Bacteria 765
213 Ga0501044_0003277 3300049823 Bacteria 18223
214 Ga0501044_0078504 3300049823 Bacteria 3345
215 Ga0501044_0112130 3300049823 Bacteria 2735
216 Ga0501044_0236595 3300049823 Bacteria 1772
217 Ga0501044_0265075 3300049823 Bacteria 1655
218 Ga0501045_0269235 3300049824 Bacteria 1268
219 nmdc:mga03683_113696_c1 3300050489 Bacteria 1199
220 nmdc:mga03683_50034_c1 3300050489 Bacteria 1741
221 nmdc:mga00v17_13730_c1 3300050491 Bacteria 4502
222 nmdc:mga0yw44_229402_c1 3300050492 Bacteria 1232
223 nmdc:mga0k408_2346_c1 3300050493 Bacteria 10067
224 nmdc:mga09592_723_c2 3300050508 Bacteria 15482
225 nmdc:mga0qj67_264_c1 3300050509 Bacteria 36047
226 nmdc:mga06r32_62324_c1 3300050510 Bacteria 3593
227 nmdc:mga08y16_54300_c1 3300050511 Bacteria 4186
228 nmdc:mga0n895_11697_c1 3300050512 Bacteria 7842
229 nmdc:mga0a205_94868_c1 3300050515 Bacteria 2882
230 Ga0495601_0000956 3300053077 Bacteria 15775
231 Ga0495601_0188798 3300053077 Bacteria 1347
232 Ga0495612_0004057 3300053078 Bacteria 6065
233 Ga0495595_0002992 3300053084 Bacteria 6676
234 Ga0495595_0025051 3300053084 Bacteria 2639
235 Ga0495619_0000931 3300053085 Bacteria 19252
236 Ga0495619_0058912 3300053085 Bacteria 2551
237 Ga0495619_0179148 3300053085 Bacteria 1466
238 Ga0495619_0184327 3300053085 Bacteria 1444
239 Ga0500578_0228657 3300053086 Bacteria 1128
240 Ga0500651_0238071 3300053093 Bacteria 1062
241 Ga0500641_0040973 3300053096 Bacteria 1872
242 Ga0500595_000002 3300053119 Bacteria 1074388
243 Ga0500642_0159937 3300053130 Bacteria 1056
244 Ga0500652_031566 3300053131 Bacteria 2079
245 Ga0500658_0030775 3300053134 Bacteria 2096
246 Ga0500604_0062862 3300053151 Bacteria 1169
247 Ga0500616_0000002 3300053153 Bacteria 1611257
248 Ga0500616_0078941 3300053153 Bacteria 1658
249 Ga0500645_000079 3300053730 Bacteria 76832
250 Ga0501084_0111951 3300054114 Bacteria 2294
251 Ga0501084_0120437 3300054114 Bacteria 2206
252 Ga0501084_0571484 3300054114 Bacteria 955
253 Ga0590071_012790 3300059421 Bacteria 1967
254 Ga0530510_0023248 3300061734 Bacteria 4415
255 Ga0530510_0042601 3300061734 Bacteria 3280
256 Ga0530510_0412049 3300061734 Bacteria 1019

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053119 Ga0500595_000002 Ga0500595_000002_303764_304510 214
2 3300046533 Ga0495640_0323121 Ga0495640_0323121_13_693 218
3 3300035172 Ga0373955_0070670 Ga0373955_0070670_637_1377 219
4 3300035724 Ga0373933_0151381 Ga0373933_0151381_546_1286 219
5 3300036401 Ga0373937_0272891 Ga0373937_0272891_828_1568 219
6 3300049743 Ga0501081_0597163 Ga0501081_0597163_113_784 219
7 3300053084 Ga0495595_0025051 Ga0495595_0025051_1775_2515 219
8 3300053085 Ga0495619_0184327 Ga0495619_0184327_370_1110 219
9 3300042156 Ga0439446_0090252 Ga0439446_0090252_12_683 220
10 3300053131 Ga0500652_031566 Ga0500652_031566_252_986 223
11 3300053730 Ga0500645_000079 Ga0500645_000079_20454_21188 223
12 3300003911 JGI25405J52794_10007168 JGI25405J52794_100071682 227
13 3300005937 Ga0081455_10037091 Ga0081455_100370914 227
14 3300053093 Ga0500651_0238071 Ga0500651_0238071_289_1035 230
15 3300007265 Ga0099794_10026795 Ga0099794_100267952 236
16 iso_pu_bacteria 2643221547 2643756079 238
17 3300007788 Ga0099795_10018656 Ga0099795_100186562 239
18 3300010159 Ga0099796_10066271 Ga0099796_100662712 239
19 3300025908 Ga0207643_10210374 Ga0207643_102103741 239
20 3300049577 Ga0501041_0317772 Ga0501041_0317772_239_958 239
21 3300049592 Ga0501076_0055802 Ga0501076_0055802_2344_3063 239
22 3300049743 Ga0501081_0017467 Ga0501081_0017467_1333_2052 239
23 3300054114 Ga0501084_0571484 Ga0501084_0571484_165_884 239
24 3300061734 Ga0530510_0023248 Ga0530510_0023248_167_886 239
25 3300049571 Ga0501034_0047106 Ga0501034_0047106_3278_4003 241
26 3300005329 Ga0070683_100261331 Ga0070683_1002613312 242
27 3300005336 Ga0070680_100082617 Ga0070680_1000826172 242
28 3300005337 Ga0070682_100092986 Ga0070682_1000929862 242
29 3300005345 Ga0070692_10249342 Ga0070692_102493422 242
30 3300005436 Ga0070713_100025816 Ga0070713_1000258164 242
31 3300005439 Ga0070711_100058857 Ga0070711_1000588573 242
32 3300005439 Ga0070711_100151530 Ga0070711_1001515302 242
33 3300005458 Ga0070681_10641915 Ga0070681_106419151 242
34 3300005547 Ga0070693_100080412 Ga0070693_1000804122 242
35 3300005547 Ga0070693_100418145 Ga0070693_1004181451 242
36 3300005563 Ga0068855_100309355 Ga0068855_1003093552 242
37 3300005614 Ga0068856_100184259 Ga0068856_1001842591 242
38 3300006173 Ga0070716_100194483 Ga0070716_1001944832 242
39 3300006881 Ga0068865_100652236 Ga0068865_1006522362 242
40 3300009093 Ga0105240_10927241 Ga0105240_109272411 242
41 3300009148 Ga0105243_10313930 Ga0105243_103139302 242
42 3300009174 Ga0105241_10225546 Ga0105241_102255462 242
43 3300009551 Ga0105238_10085445 Ga0105238_100854451 242
44 3300013104 Ga0157370_10172647 Ga0157370_101726472 242
45 3300013105 Ga0157369_10432465 Ga0157369_104324651 242
46 3300020070 Ga0206356_10955678 Ga0206356_109556781 242
47 3300025261 Ga0209233_1006564 Ga0209233_10065643 242
48 3300025906 Ga0207699_10009691 Ga0207699_100096913 242
49 3300025912 Ga0207707_10207526 Ga0207707_102075262 242
50 3300025913 Ga0207695_10596393 Ga0207695_105963931 242
51 3300025915 Ga0207693_10035798 Ga0207693_100357981 242
52 3300025916 Ga0207663_10037008 Ga0207663_100370083 242
53 3300025916 Ga0207663_10158751 Ga0207663_101587512 242
54 3300025916 Ga0207663_10224966 Ga0207663_102249662 242
55 3300025924 Ga0207694_10144899 Ga0207694_101448992 242
56 3300025928 Ga0207700_10006284 Ga0207700_100062844 242
57 3300025938 Ga0207704_10348227 Ga0207704_103482272 242
58 3300025949 Ga0207667_10122490 Ga0207667_101224901 242
59 3300028556 Ga0265337_1012331 Ga0265337_10123313 242
60 3300028800 Ga0265338_10261627 Ga0265338_102616272 242
61 3300031241 Ga0265325_10014439 Ga0265325_100144394 242
62 3300031595 Ga0265313_10111798 Ga0265313_101117982 242
63 3300034818 Ga0373950_0007236 Ga0373950_0007236_943_1677 242
64 3300035171 Ga0373946_0022794 Ga0373946_0022794_266_1000 242
65 3300035692 Ga0373935_0051874 Ga0373935_0051874_936_1670 242
66 3300036401 Ga0373937_0091006 Ga0373937_0091006_618_1352 242
67 3300036712 Ga0316584_0026489 Ga0316584_0026489_3429_4169 242
68 3300037068 Ga0373925_0053300 Ga0373925_0053300_976_1710 242
69 3300037068 Ga0373925_0167227 Ga0373925_0167227_562_1296 242
70 3300039437 Ga0436365_0015900 Ga0436365_0015900_48_797 242
71 3300046454 Ga0495592_0008136 Ga0495592_0008136_6053_6787 242
72 3300046462 Ga0495651_0052684 Ga0495651_0052684_1545_2279 242
73 3300046516 Ga0495628_0002339 Ga0495628_0002339_799_1533 242
74 3300046529 Ga0495652_0007265 Ga0495652_0007265_8608_9342 242
75 3300046543 Ga0495645_0000537 Ga0495645_0000537_19415_20149 242
76 3300046663 Ga0495635_0005336 Ga0495635_0005336_3304_4038 242
77 3300046678 Ga0495599_0005425 Ga0495599_0005425_1403_2137 242
78 3300046809 Ga0495600_0025030 Ga0495600_0025030_654_1388 242
79 3300047322 Ga0495680_0016448 Ga0495680_0016448_5486_6220 242
80 3300047444 Ga0495675_0075269 Ga0495675_0075269_530_1264 242
81 3300048907 Ga0496104_0000761 Ga0496104_0000761_18722_19456 242
82 3300048908 Ga0496105_0000600 Ga0496105_0000600_18852_19586 242
83 3300048918 Ga0496115_0211829 Ga0496115_0211829_324_1058 242
84 3300048918 Ga0496115_0339172 Ga0496115_0339172_288_1028 242
85 3300049568 Ga0501031_0049323 Ga0501031_0049323_1073_1804 242
86 3300049569 Ga0501032_0092658 Ga0501032_0092658_832_1563 242
87 3300049570 Ga0501033_0035224 Ga0501033_0035224_739_1470 242
88 3300049571 Ga0501034_0000097 Ga0501034_0000097_19039_19770 242
89 3300049571 Ga0501034_0002259 Ga0501034_0002259_18052_18783 242
90 3300049571 Ga0501034_0321728 Ga0501034_0321728_705_1439 242
91 3300049571 Ga0501034_0527208 Ga0501034_0527208_113_844 242
92 3300049572 Ga0501036_0000954 Ga0501036_0000954_1017_1748 242
93 3300049572 Ga0501036_0022035 Ga0501036_0022035_3456_4187 242
94 3300049574 Ga0501038_0227045 Ga0501038_0227045_96_827 242
95 3300049579 Ga0501043_0043237 Ga0501043_0043237_2419_3150 242
96 3300049580 Ga0501046_0030532 Ga0501046_0030532_2492_3223 242
97 3300049581 Ga0501047_0000218 Ga0501047_0000218_48686_49417 242
98 3300049581 Ga0501047_0067483 Ga0501047_0067483_962_1693 242
99 3300049582 Ga0501048_0000313 Ga0501048_0000313_19796_20527 242
100 3300049584 Ga0501068_0013944 Ga0501068_0013944_211_942 242
101 3300049586 Ga0501070_0018953 Ga0501070_0018953_2261_2992 242
102 3300049586 Ga0501070_0414992 Ga0501070_0414992_249_980 242
103 3300049588 Ga0501072_0001601 Ga0501072_0001601_15764_16495 242
104 3300049588 Ga0501072_0164976 Ga0501072_0164976_966_1697 242
105 3300049589 Ga0501073_0032682 Ga0501073_0032682_1740_2471 242
106 3300049590 Ga0501074_0027394 Ga0501074_0027394_89_820 242
107 3300049590 Ga0501074_0040419 Ga0501074_0040419_1424_2155 242
108 3300049741 Ga0501079_0169314 Ga0501079_0169314_534_1265 242
109 3300049742 Ga0501080_0001471 Ga0501080_0001471_17940_18671 242
110 3300049742 Ga0501080_0028798 Ga0501080_0028798_4326_5057 242
111 3300049742 Ga0501080_0391749 Ga0501080_0391749_114_845 242
112 3300049744 Ga0501083_0001547 Ga0501083_0001547_1905_2636 242
113 3300049744 Ga0501083_0085161 Ga0501083_0085161_1272_2003 242
114 3300049822 Ga0501035_0779637 Ga0501035_0779637_19_753 242
115 3300049823 Ga0501044_0003277 Ga0501044_0003277_7149_7880 242
116 3300049823 Ga0501044_0265075 Ga0501044_0265075_609_1340 242
117 3300053077 Ga0495601_0000956 Ga0495601_0000956_14571_15305 242
118 3300053078 Ga0495612_0004057 Ga0495612_0004057_3592_4326 242
119 3300053084 Ga0495595_0002992 Ga0495595_0002992_2234_2968 242
120 3300053085 Ga0495619_0000931 Ga0495619_0000931_10262_10996 242
121 3300053085 Ga0495619_0179148 Ga0495619_0179148_563_1297 242
122 3300053153 Ga0500616_0000002 Ga0500616_0000002_372606_373340 242
123 3300053153 Ga0500616_0078941 Ga0500616_0078941_907_1641 242
124 3300054114 Ga0501084_0120437 Ga0501084_0120437_499_1230 242
125 3300059421 Ga0590071_012790 Ga0590071_012790_963_1721 242
126 3300005436 Ga0070713_100466622 Ga0070713_1004666221 243
127 3300005548 Ga0070665_100167962 Ga0070665_1001679622 243
128 3300006871 Ga0075434_100084692 Ga0075434_1000846924 243
129 3300009094 Ga0111539_10018734 Ga0111539_100187344 243
130 3300021384 Ga0213876_10158128 Ga0213876_101581281 243
131 3300027907 Ga0207428_10041467 Ga0207428_100414673 243
132 3300028380 Ga0268265_10228369 Ga0268265_102283692 243
133 3300035121 Ga0373960_0050596 Ga0373960_0050596_212_955 243
134 3300035691 Ga0373931_0030255 Ga0373931_0030255_1830_2573 243
135 3300039437 Ga0436365_0555806 Ga0436365_0555806_416_1153 243
136 3300042436 Ga0439435_0060113 Ga0439435_0060113_233_976 243
137 3300046520 Ga0495637_0173273 Ga0495637_0173273_31_774 243
138 3300048907 Ga0496104_0196900 Ga0496104_0196900_184_927 243
139 3300048910 Ga0496107_0221281 Ga0496107_0221281_452_1195 243
140 3300049572 Ga0501036_0198883 Ga0501036_0198883_426_1169 243
141 3300049574 Ga0501038_0131646 Ga0501038_0131646_706_1449 243
142 3300049580 Ga0501046_0160892 Ga0501046_0160892_102_845 243
143 3300049585 Ga0501069_0084219 Ga0501069_0084219_578_1312 243
144 3300049586 Ga0501070_0013530 Ga0501070_0013530_1616_2350 243
145 3300049588 Ga0501072_0034802 Ga0501072_0034802_2308_3051 243
146 3300049590 Ga0501074_0107164 Ga0501074_0107164_742_1485 243
147 3300049591 Ga0501075_0060800 Ga0501075_0060800_837_1580 243
148 3300049741 Ga0501079_0126617 Ga0501079_0126617_1074_1817 243
149 3300049822 Ga0501035_0003871 Ga0501035_0003871_8189_8923 243
150 3300049822 Ga0501035_0186721 Ga0501035_0186721_877_1644 243
151 3300049823 Ga0501044_0078504 Ga0501044_0078504_510_1277 243
152 3300049823 Ga0501044_0112130 Ga0501044_0112130_1781_2527 243
153 3300049823 Ga0501044_0236595 Ga0501044_0236595_570_1304 243
154 3300049824 Ga0501045_0269235 Ga0501045_0269235_298_1041 243
155 3300050489 nmdc:mga03683_50034_c1 nmdc:mga03683_50034_c1_78_809 243
156 3300050512 nmdc:mga0n895_11697_c1 nmdc:mga0n895_11697_c1_6636_7373 243
157 3300050515 nmdc:mga0a205_94868_c1 nmdc:mga0a205_94868_c1_315_1058 243
158 3300054114 Ga0501084_0111951 Ga0501084_0111951_761_1504 243
159 3300061734 Ga0530510_0042601 Ga0530510_0042601_1562_2305 243
160 3300061734 Ga0530510_0412049 Ga0530510_0412049_264_1007 243
161 3300003323 rootH1_10093318 rootH1_100933183 244
162 3300005340 Ga0070689_100255379 Ga0070689_1002553791 244
163 3300005354 Ga0070675_100132103 Ga0070675_1001321032 244
164 3300005356 Ga0070674_100010528 Ga0070674_1000105283 244
165 3300005365 Ga0070688_100583511 Ga0070688_1005835111 244
166 3300005367 Ga0070667_100224216 Ga0070667_1002242162 244
167 3300005435 Ga0070714_100401166 Ga0070714_1004011662 244
168 3300005436 Ga0070713_100742224 Ga0070713_1007422241 244
169 3300005456 Ga0070678_100013045 Ga0070678_1000130452 244
170 3300005543 Ga0070672_100242426 Ga0070672_1002424262 244
171 3300005577 Ga0068857_100386445 Ga0068857_1003864452 244
172 3300005617 Ga0068859_100416089 Ga0068859_1004160892 244
173 3300005719 Ga0068861_100414443 Ga0068861_1004144432 244
174 3300005842 Ga0068858_100211173 Ga0068858_1002111731 244
175 3300005842 Ga0068858_100494151 Ga0068858_1004941512 244
176 3300006028 Ga0070717_10498151 Ga0070717_104981512 244
177 3300006038 Ga0075365_10159272 Ga0075365_101592722 244
178 3300006048 Ga0075363_100009047 Ga0075363_1000090474 244
179 3300006051 Ga0075364_10039820 Ga0075364_100398202 244
180 3300006051 Ga0075364_10217415 Ga0075364_102174152 244
181 3300006175 Ga0070712_100006908 Ga0070712_1000069086 244
182 3300006177 Ga0075362_10003265 Ga0075362_100032654 244
183 3300006177 Ga0075362_10101461 Ga0075362_101014612 244
184 3300006195 Ga0075366_10005988 Ga0075366_100059882 244
185 3300006844 Ga0075428_100005019 Ga0075428_1000050198 244
186 3300006846 Ga0075430_100003454 Ga0075430_1000034549 244
187 3300006847 Ga0075431_100075149 Ga0075431_1000751492 244
188 3300006880 Ga0075429_100011493 Ga0075429_1000114932 244
189 3300006931 Ga0097620_100416104 Ga0097620_1004161042 244
190 3300009094 Ga0111539_10003464 Ga0111539_1000346418 244
191 3300009098 Ga0105245_10126286 Ga0105245_101262863 244
192 3300009098 Ga0105245_10287432 Ga0105245_102874322 244
193 3300009101 Ga0105247_10009531 Ga0105247_100095314 244
194 3300009147 Ga0114129_10003903 Ga0114129_100039034 244
195 3300009174 Ga0105241_10080010 Ga0105241_100800102 244
196 3300013297 Ga0157378_10273561 Ga0157378_102735612 244
197 3300014326 Ga0157380_10109386 Ga0157380_101093862 244
198 3300021377 Ga0213874_10047407 Ga0213874_100474071 244
199 3300021388 Ga0213875_10000025 Ga0213875_1000002579 244
200 3300025893 Ga0207682_10001000 Ga0207682_100010005 244
201 3300025901 Ga0207688_10094012 Ga0207688_100940122 244
202 3300025908 Ga0207643_10075204 Ga0207643_100752042 244
203 3300025915 Ga0207693_10013245 Ga0207693_100132453 244
204 3300025916 Ga0207663_10030050 Ga0207663_100300503 244
205 3300025918 Ga0207662_10029966 Ga0207662_100299663 244
206 3300025923 Ga0207681_10177141 Ga0207681_101771411 244
207 3300025927 Ga0207687_10089373 Ga0207687_100893732 244
208 3300025928 Ga0207700_10146716 Ga0207700_101467161 244
209 3300025937 Ga0207669_10017878 Ga0207669_100178783 244
210 3300025938 Ga0207704_10202224 Ga0207704_102022241 244
211 3300025940 Ga0207691_10008196 Ga0207691_1000819610 244
212 3300025941 Ga0207711_10236615 Ga0207711_102366151 244
213 3300025942 Ga0207689_10042470 Ga0207689_100424703 244
214 3300025945 Ga0207679_10313452 Ga0207679_103134521 244
215 3300025960 Ga0207651_10167537 Ga0207651_101675372 244
216 3300025960 Ga0207651_10426585 Ga0207651_104265852 244
217 3300025986 Ga0207658_10328588 Ga0207658_103285882 244
218 3300026035 Ga0207703_10158780 Ga0207703_101587801 244
219 3300026041 Ga0207639_10340837 Ga0207639_103408372 244
220 3300026095 Ga0207676_10076512 Ga0207676_100765122 244
221 3300026116 Ga0207674_10576810 Ga0207674_105768102 244
222 3300026121 Ga0207683_10072471 Ga0207683_100724712 244
223 3300027866 Ga0209813_10026082 Ga0209813_100260822 244
224 3300027907 Ga0207428_10028509 Ga0207428_100285096 244
225 3300028380 Ga0268265_10554800 Ga0268265_105548001 244
226 3300031456 Ga0307513_10309038 Ga0307513_103090382 244
227 3300031711 Ga0265314_10086344 Ga0265314_100863441 244
228 3300037853 Ga0436364_0318172 Ga0436364_0318172_49764_50501 244
229 3300039437 Ga0436365_0580827 Ga0436365_0580827_200_937 244
230 3300039450 Ga0436363_0490513 Ga0436363_0490513_525_1274 244
231 3300042003 Ga0439443_002033 Ga0439443_002033_239_982 244
232 3300042461 Ga0439460_0006973 Ga0439460_0006973_1969_2712 244
233 3300046460 Ga0495638_0000936 Ga0495638_0000936_5930_6679 244
234 3300046474 Ga0495605_0150899 Ga0495605_0150899_200_952 244
235 3300046616 Ga0495668_0309730 Ga0495668_0309730_20_769 244
236 3300047447 Ga0495685_100879 Ga0495685_100879_104_847 244
237 3300048090 Ga0495615_0050164 Ga0495615_0050164_101_844 244
238 3300048907 Ga0496104_0049016 Ga0496104_0049016_82_852 244
239 3300048909 Ga0496106_0082259 Ga0496106_0082259_504_1274 244
240 3300048915 Ga0496112_0701412 Ga0496112_0701412_169_921 244
241 3300048917 Ga0496114_0022959 Ga0496114_0022959_3660_4430 244
242 3300050489 nmdc:mga03683_113696_c1 nmdc:mga03683_113696_c1_109_849 244
243 3300050491 nmdc:mga00v17_13730_c1 nmdc:mga00v17_13730_c1_3595_4335 244
244 3300050492 nmdc:mga0yw44_229402_c1 nmdc:mga0yw44_229402_c1_18_770 244
245 3300050493 nmdc:mga0k408_2346_c1 nmdc:mga0k408_2346_c1_6200_6940 244
246 3300050508 nmdc:mga09592_723_c2 nmdc:mga09592_723_c2_489_1238 244
247 3300050509 nmdc:mga0qj67_264_c1 nmdc:mga0qj67_264_c1_29475_30218 244
248 3300050510 nmdc:mga06r32_62324_c1 nmdc:mga06r32_62324_c1_384_1133 244
249 3300050511 nmdc:mga08y16_54300_c1 nmdc:mga08y16_54300_c1_118_867 244
250 3300053077 Ga0495601_0188798 Ga0495601_0188798_561_1310 244
251 3300053085 Ga0495619_0058912 Ga0495619_0058912_1754_2503 244
252 3300053086 Ga0500578_0228657 Ga0500578_0228657_204_953 244
253 3300053096 Ga0500641_0040973 Ga0500641_0040973_545_1336 244
254 3300053130 Ga0500642_0159937 Ga0500642_0159937_75_824 244
255 3300053134 Ga0500658_0030775 Ga0500658_0030775_1100_1849 244
256 3300053151 Ga0500604_0062862 Ga0500604_0062862_110_859 244

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11967

RecO_N

Recombination protein O N terminal

1

77

0.93

PF02565

RecO_C

Recombination protein O C terminal

111

207

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bay-assembly3.cif.gz_E crystal structure of the prp19 u-box dimer 0.7779 149 186
2bay-assembly2.cif.gz_B crystal structure of the prp19 u-box dimer 0.7628 150 186
3q8d-assembly1.cif.gz_A e. coli reco complex with ssb c-terminus 0.7501 4 235
3q8d-assembly1.cif.gz_A e. coli reco complex with ssb c-terminus 0.7355 4 235
1h9m-assembly1.cif.gz_A two crystal structures of the cytoplasmic molybdate-binding protein modg suggest a novel cooperative binding mechanism and provide insights into ligand-binding specificity. peg-grown form with molybdate bound 0.733 3 60
ID Description Score Start End Superfamily
3q8dB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8678 4 76 2.40.50.140
af_Q2FY07_1_75_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8662 3 75 2.40.50.140
af_P9WHI5_1_82_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8636 1 79 2.40.50.140
af_Q2FY07_1_75_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8351 3 75 2.40.50.140
4jcvF01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8304 3 76 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A1H4LEY0-F1-model_v4 DNA repair protein RecO (Recombination protein O) 0.9762 1 237 GO:0006302
GO:0006310
GO:0043590
AF-A0A6B1HSI7-F1-model_v4 deleted 0.9734 1 70
AF-A0A358PD05-F1-model_v4 DNA repair protein RecO 0.9702 1 74 GO:0006302
GO:0006310
GO:0043590
AF-A0A4R2SXK0-F1-model_v4 deleted 0.9698 1 240
AF-A0A526UX37-F1-model_v4 DNA repair protein RecO 0.9694 25 237 GO:0006302
GO:0006310
GO:0043590

Feature Viewer

pLDDT pTM Quality
93.79 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map