F366333

General Info

Members Datasets Scaffolds Average Seq Length
256 150 512 273

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100020262|Ga0068857_1000202624
Length 316
Sequence MRLGCSGDGHESAPRRMASGTDVFGWYPAHPRRSPLRTSVPCDDTAMTDFRDALRVKPRADIRLGHRDPGDTSGWAKDAATEQTAKELERLAELQDRLWAEAKHPVLVVLQGIDAAGKDGTIKKVMTAFNPQGSPVTAFKVPSAEELAHDFLWRVHKAVPRKGEIGIFNRSHYEEVLVVRVHQLVPKSVWSKRYDLINAFERHLVETGTTVVKFFLFIDKDEQRARFQARYDDPAKRWKFSMGDLSERKLWDDYQAAFDDMLDKTSTDIAPWYLIPANHKWFRDLAVSTILADTIDDLKPEYPPVAADVPKDLVID

Samples

Sample ID Description Type Environment
1 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
48 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
72 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
73 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
74 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
75 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
76 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
77 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
80 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
81 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
82 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
83 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
84 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
85 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
86 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
89 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
90 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
91 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
92 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
93 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
94 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
95 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
96 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
99 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
100 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
101 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
102 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
103 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
104 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
105 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
107 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
110 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
111 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
112 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
113 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
114 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
115 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
116 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
128 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
129 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
130 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
131 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
132 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
133 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
134 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
135 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
136 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
143 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
144 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
145 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
146 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
147 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
148 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
149 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
150 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.38
Rhizosphere 89.45
Stem 0
Stem Tuber 0
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068857_100020262 3300005577 Bacteria 5847
2 Ga0070676_10187383 3300005328 Bacteria 1349
3 Ga0070680_100000008 3300005336 Bacteria 100309
4 Ga0070680_100196934 3300005336 Bacteria 1698
5 Ga0070692_10001463 3300005345 Bacteria 8593
6 Ga0070675_100280372 3300005354 Bacteria 1464
7 Ga0070674_100085287 3300005356 Bacteria 2266
8 Ga0070694_100003458 3300005444 Bacteria 9459
9 Ga0070694_100113815 3300005444 Bacteria 1931
10 Ga0070694_100150515 3300005444 Bacteria 1699
11 Ga0070708_100249143 3300005445 Bacteria 1668
12 Ga0070706_100100049 3300005467 Bacteria 2693
13 Ga0070706_100178180 3300005467 Bacteria 1984
14 Ga0070698_100029953 3300005471 Bacteria 5648
15 Ga0070698_100105417 3300005471 Bacteria 2789
16 Ga0070698_100143234 3300005471 Bacteria 2340
17 Ga0070699_100519184 3300005518 Bacteria 1083
18 Ga0070697_100113665 3300005536 Bacteria 2259
19 Ga0070697_100218160 3300005536 Bacteria 1625
20 Ga0070695_100008499 3300005545 Bacteria 6093
21 Ga0070696_100005148 3300005546 Bacteria 8742
22 Ga0070696_100061251 3300005546 Bacteria 2632
23 Ga0070696_100087923 3300005546 Bacteria 2207
24 Ga0070704_100015263 3300005549 Bacteria 4821
25 Ga0070704_100148217 3300005549 Bacteria 1841
26 Ga0070704_100245504 3300005549 Bacteria 1467
27 Ga0070664_100111116 3300005564 Bacteria 2392
28 Ga0068854_100294060 3300005578 Bacteria 1312
29 Ga0068852_100524441 3300005616 Bacteria 1182
30 Ga0068859_100016478 3300005617 Bacteria 7422
31 Ga0068864_100018322 3300005618 Bacteria 5847
32 Ga0068870_10200346 3300005840 Bacteria 1210
33 Ga0068863_100041326 3300005841 Bacteria 4384
34 Ga0068862_100658053 3300005844 Bacteria 1011
35 Ga0075428_100075177 3300006844 Bacteria 3690
36 Ga0075433_10143436 3300006852 Bacteria 2123
37 Ga0075434_100209678 3300006871 Bacteria 1968
38 Ga0068865_100038758 3300006881 Bacteria 3227
39 Ga0097620_100016478 3300006931 Bacteria 7422
40 Ga0105251_10079246 3300009011 Bacteria 1520
41 Ga0111539_10011070 3300009094 Bacteria 11349
42 Ga0111539_10146764 3300009094 Bacteria 2762
43 Ga0105245_10184341 3300009098 Bacteria 1996
44 Ga0105245_10279756 3300009098 Bacteria 1630
45 Ga0114129_10202219 3300009147 Bacteria 2690
46 Ga0105243_10038073 3300009148 Bacteria 3744
47 Ga0105243_10087807 3300009148 Bacteria 2553
48 Ga0105243_10461633 3300009148 Bacteria 1194
49 Ga0105241_10242866 3300009174 Bacteria 1523
50 Ga0105242_10081839 3300009176 Bacteria 2700
51 Ga0105242_10494037 3300009176 Bacteria 1163
52 Ga0105242_10589358 3300009176 Bacteria 1072
53 Ga0105248_10127462 3300009177 Bacteria 2871
54 Ga0105249_10002356 3300009553 Bacteria 16407
55 Ga0105239_10022337 3300010375 Bacteria 6976
56 Ga0105239_10149971 3300010375 Bacteria 2602
57 Ga0105246_10089653 3300011119 Bacteria 2213
58 Ga0157378_10122676 3300013297 Bacteria 2397
59 Ga0163162_10386278 3300013306 Bacteria 1533
60 Ga0163162_10563827 3300013306 Bacteria 1266
61 Ga0157375_10180765 3300013308 Bacteria 2260
62 Ga0163163_10019769 3300014325 Bacteria 6333
63 Ga0163163_10157005 3300014325 Bacteria 2319
64 Ga0157380_10083104 3300014326 Bacteria 2622
65 Ga0157380_10143908 3300014326 Bacteria 2052
66 Ga0157377_10134525 3300014745 Bacteria 1513
67 Ga0163161_10163377 3300017792 Bacteria 1699
68 Ga0213874_10030803 3300021377 Bacteria 1548
69 Ga0207642_10073293 3300025899 Bacteria 1637
70 Ga0207684_10019964 3300025910 Bacteria 5726
71 Ga0207684_10483784 3300025910 Bacteria 1062
72 Ga0207654_10196892 3300025911 Bacteria 1324
73 Ga0207660_10000001 3300025917 Bacteria 1034169
74 Ga0207660_10097090 3300025917 Bacteria 2195
75 Ga0207662_10001429 3300025918 Bacteria 11572
76 Ga0207646_10139612 3300025922 Bacteria 2182
77 Ga0207646_10151942 3300025922 Bacteria 2088
78 Ga0207646_10588366 3300025922 Bacteria 999
79 Ga0207681_10514332 3300025923 Bacteria 982
80 Ga0207659_10093249 3300025926 Bacteria 2253
81 Ga0207687_10077255 3300025927 Bacteria 2394
82 Ga0207644_10338545 3300025931 Bacteria 1220
83 Ga0207706_10003108 3300025933 Bacteria 15966
84 Ga0207686_10184468 3300025934 Bacteria 1482
85 Ga0207711_10026604 3300025941 Bacteria 4855
86 Ga0207689_10041201 3300025942 Bacteria 3821
87 Ga0207661_10037243 3300025944 Bacteria 3803
88 Ga0207678_10014514 3300026067 Bacteria 6928
89 Ga0207708_10008018 3300026075 Bacteria 7829
90 Ga0207641_10125631 3300026088 Bacteria 2296
91 Ga0207648_10001488 3300026089 Bacteria 25803
92 Ga0207648_10187812 3300026089 Bacteria 1830
93 Ga0207676_10054061 3300026095 Bacteria 3145
94 Ga0207676_10401779 3300026095 Bacteria 1281
95 Ga0207674_10008836 3300026116 Bacteria 11593
96 Ga0207675_100064602 3300026118 Bacteria 3421
97 Ga0209974_10023736 3300027876 Bacteria 2030
98 Ga0209974_10061533 3300027876 Bacteria 1271
99 Ga0265326_10001698 3300028558 Bacteria 7620
100 Ga0265326_10013796 3300028558 Bacteria 2358
101 Ga0265319_1006733 3300028563 Bacteria 5275
102 Ga0265334_10005324 3300028573 Bacteria 5624
103 Ga0265334_10032967 3300028573 Bacteria 2063
104 Ga0265318_10007189 3300028577 Bacteria 5060
105 Ga0265318_10025661 3300028577 Bacteria 2325
106 Ga0265323_10004815 3300028653 Bacteria 5781
107 Ga0265322_10034690 3300028654 Bacteria 1437
108 Ga0265322_10035124 3300028654 Bacteria 1428
109 Ga0265336_10004251 3300028666 Bacteria 5448
110 Ga0265336_10021769 3300028666 Bacteria 2048
111 Ga0265338_10026325 3300028800 Bacteria 5870
112 Ga0265338_10161949 3300028800 Bacteria 1727
113 Ga0265338_10282474 3300028800 Bacteria 1212
114 Ga0265324_10032078 3300029957 Bacteria 1837
115 Ga0265330_10012943 3300031235 Bacteria 3895
116 Ga0265332_10003604 3300031238 Bacteria 7430
117 Ga0265320_10031392 3300031240 Bacteria 2728
118 Ga0265325_10004307 3300031241 Bacteria 9017
119 Ga0265325_10017790 3300031241 Bacteria 3948
120 Ga0265329_10028785 3300031242 Bacteria 1819
121 Ga0265340_10044907 3300031247 Bacteria 2160
122 Ga0265340_10084113 3300031247 Bacteria 1494
123 Ga0265339_10059293 3300031249 Bacteria 2064
124 Ga0265331_10027720 3300031250 Bacteria 2838
125 Ga0265331_10058183 3300031250 Unclassified 1831
126 Ga0265316_10012368 3300031344 Bacteria 7659
127 Ga0265316_10035718 3300031344 Bacteria 4024
128 Ga0265316_10094380 3300031344 Bacteria 2279
129 Ga0265313_10044766 3300031595 Bacteria 2158
130 Ga0265313_10141783 3300031595 Bacteria 1033
131 Ga0316579_10056537 3300031691 Bacteria 1842
132 Ga0265314_10056705 3300031711 Bacteria 2695
133 Ga0265314_10130951 3300031711 Bacteria 1565
134 Ga0265342_10025732 3300031712 Bacteria 3694
135 Ga0265342_10157675 3300031712 Bacteria 1256
136 Ga0316577_10000547 3300031733 Bacteria 15248
137 Ga0316582_0064342 3300036647 Bacteria 2359
138 Ga0316584_0014044 3300036712 Bacteria 5687
139 Ga0373925_0065269 3300037068 Bacteria 2742
140 Ga0436365_1596774 3300039437 Bacteria 1055
141 Ga0436361_0127626 3300039447 Bacteria 69494
142 Ga0436361_0243572 3300039447 Bacteria 13022
143 Ga0436363_0079851 3300039450 Bacteria 1705
144 Ga0439461_0042743 3300041410 Bacteria 984
145 Ga0439446_0045532 3300042156 Bacteria 1301
146 Ga0495630_0085712 3300046517 Bacteria 2378
147 Ga0495644_0077584 3300046523 Bacteria 1252
148 Ga0495634_0222592 3300046642 Bacteria 1164
149 Ga0495680_0308780 3300047322 Bacteria 1109
150 Ga0496102_0009183 3300048905 Bacteria 8482
151 Ga0496102_0019873 3300048905 Bacteria 5922
152 Ga0496102_0210779 3300048905 Bacteria 1832
153 Ga0496102_0714103 3300048905 Bacteria 925
154 Ga0496103_0007459 3300048906 Bacteria 6520
155 Ga0496104_0010549 3300048907 Bacteria 8250
156 Ga0496104_0300905 3300048907 Bacteria 1516
157 Ga0496104_0505364 3300048907 Bacteria 1120
158 Ga0496105_0160030 3300048908 Bacteria 1849
159 Ga0496106_0054327 3300048909 Bacteria 3026
160 Ga0496107_0039533 3300048910 Bacteria 3384
161 Ga0496108_0005769 3300048911 Bacteria 10030
162 Ga0496108_0023726 3300048911 Bacteria 5048
163 Ga0496108_0176535 3300048911 Bacteria 1849
164 Ga0496109_0018458 3300048912 Bacteria 6127
165 Ga0496109_0030388 3300048912 Bacteria 4842
166 Ga0496111_0033875 3300048914 Bacteria 3644
167 Ga0496111_0035094 3300048914 Bacteria 3583
168 Ga0496112_0048694 3300048915 Bacteria 4154
169 Ga0496112_0336239 3300048915 Bacteria 1454
170 Ga0496113_0083471 3300048916 Bacteria 2451
171 Ga0496114_0160520 3300048917 Bacteria 1954
172 Ga0496114_0280824 3300048917 Bacteria 1468
173 Ga0496114_0634814 3300048917 Bacteria 940
174 Ga0501031_0147264 3300049568 Bacteria 1538
175 Ga0501033_0112575 3300049570 Bacteria 1980
176 Ga0501036_0063391 3300049572 Bacteria 3130
177 Ga0501036_0147277 3300049572 Bacteria 1986
178 Ga0501036_0205131 3300049572 Bacteria 1657
179 Ga0501039_0022449 3300049575 Bacteria 4844
180 Ga0501040_0049401 3300049576 Bacteria 2876
181 Ga0501040_0078155 3300049576 Bacteria 2290
182 Ga0501040_0112274 3300049576 Bacteria 1906
183 Ga0501040_0139119 3300049576 Bacteria 1709
184 Ga0501040_0148926 3300049576 Bacteria 1650
185 Ga0501040_0304017 3300049576 Bacteria 1140
186 Ga0501041_0013602 3300049577 Bacteria 4826
187 Ga0501041_0048389 3300049577 Bacteria 2590
188 Ga0501042_0043484 3300049578 Bacteria 3199
189 Ga0501042_0083887 3300049578 Bacteria 2284
190 Ga0501043_0241246 3300049579 Bacteria 1394
191 Ga0501048_0090513 3300049582 Bacteria 2158
192 Ga0501067_0073511 3300049583 Bacteria 1894
193 Ga0501068_0071572 3300049584 Bacteria 2117
194 Ga0501068_0242295 3300049584 Bacteria 1148
195 Ga0501069_0039882 3300049585 Bacteria 2595
196 Ga0501071_0067064 3300049587 Bacteria 2609
197 Ga0501071_0077170 3300049587 Bacteria 2433
198 Ga0501071_0135996 3300049587 Bacteria 1829
199 Ga0501072_0025674 3300049588 Bacteria 4590
200 Ga0501072_0037345 3300049588 Bacteria 3809
201 Ga0501072_0086980 3300049588 Bacteria 2480
202 Ga0501072_0113531 3300049588 Bacteria 2157
203 Ga0501072_0135786 3300049588 Bacteria 1961
204 Ga0501072_0313123 3300049588 Bacteria 1248
205 Ga0501072_0362007 3300049588 Bacteria 1151
206 Ga0501074_0091223 3300049590 Bacteria 2182
207 Ga0501074_0340810 3300049590 Bacteria 1064
208 Ga0501075_0032291 3300049591 Bacteria 3889
209 Ga0501076_0092074 3300049592 Bacteria 2439
210 Ga0501076_0119255 3300049592 Bacteria 2136
211 Ga0501076_0160097 3300049592 Bacteria 1833
212 Ga0501076_0190268 3300049592 Bacteria 1674
213 Ga0501076_0574807 3300049592 Bacteria 929
214 Ga0501077_0129017 3300049593 Bacteria 1603
215 Ga0501077_0239544 3300049593 Bacteria 1153
216 Ga0501079_0029331 3300049741 Bacteria 4224
217 Ga0501079_0067627 3300049741 Bacteria 2758
218 Ga0501079_0447630 3300049741 Bacteria 1014
219 Ga0501080_0005064 3300049742 Bacteria 11737
220 Ga0501080_0198584 3300049742 Bacteria 1842
221 Ga0501080_0261435 3300049742 Bacteria 1577
222 Ga0501081_0036712 3300049743 Bacteria 3342
223 Ga0501081_0216781 3300049743 Bacteria 1391
224 Ga0501081_0249919 3300049743 Bacteria 1294
225 Ga0501081_0283895 3300049743 Bacteria 1212
226 Ga0501081_0513057 3300049743 Bacteria 894
227 Ga0501035_0137422 3300049822 Bacteria 2127
228 Ga0501045_0019590 3300049824 Bacteria 4827
229 Ga0501045_0023333 3300049824 Bacteria 4434
230 Ga0501045_0057141 3300049824 Bacteria 2855
231 Ga0501045_0059267 3300049824 Bacteria 2804
232 Ga0501045_0096507 3300049824 Bacteria 2187
233 Ga0501045_0159047 3300049824 Bacteria 1681
234 nmdc:mga05p37_334320_c1 3300050507 Bacteria 1788
235 nmdc:mga05p37_661605_c1 3300050507 Bacteria 1167
236 nmdc:mga06r32_88913_c1 3300050510 Bacteria 3015
237 nmdc:mga08y16_96014_c1 3300050511 Bacteria 3087
238 nmdc:mga0a205_11727_c1 3300050515 Bacteria 7796
239 nmdc:mga0a205_121377_c1 3300050515 Bacteria 2512
240 Ga0501084_0044193 3300054114 Bacteria 3729
241 Ga0501084_0099972 3300054114 Bacteria 2435
242 Ga0501084_0127089 3300054114 Bacteria 2145
243 Ga0501084_0223903 3300054114 Bacteria 1587
244 Ga0501084_0276527 3300054114 Bacteria 1418
245 Ga0590074_007450 3300059423 Bacteria 1819
246 Ga0590075_002153 3300059424 Bacteria 4736
247 Ga0590077_004330 3300059426 Bacteria 2917
248 Ga0501082_0148830 3300060353 Bacteria 2033
249 Ga0501082_0165388 3300060353 Bacteria 1922
250 Ga0501082_0182530 3300060353 Bacteria 1825
251 Ga0501082_0201361 3300060353 Bacteria 1732
252 Ga0501082_0251942 3300060353 Bacteria 1536
253 Ga0530510_0004815 3300061734 Bacteria 9338
254 Ga0530510_0060644 3300061734 Bacteria 2738
255 Ga0530510_0068999 3300061734 Bacteria 2565
256 Ga0530510_0090891 3300061734 Bacteria 2227
257 Ga0068857_100020262
258 Ga0070676_10187383
259 Ga0070680_100000008
260 Ga0070680_100196934
261 Ga0070692_10001463
262 Ga0070675_100280372
263 Ga0070674_100085287
264 Ga0070694_100003458
265 Ga0070694_100113815
266 Ga0070694_100150515
267 Ga0070708_100249143
268 Ga0070706_100100049
269 Ga0070706_100178180
270 Ga0070698_100029953
271 Ga0070698_100105417
272 Ga0070698_100143234
273 Ga0070699_100519184
274 Ga0070697_100113665
275 Ga0070697_100218160
276 Ga0070695_100008499
277 Ga0070696_100005148
278 Ga0070696_100061251
279 Ga0070696_100087923
280 Ga0070704_100015263
281 Ga0070704_100148217
282 Ga0070704_100245504
283 Ga0070664_100111116
284 Ga0068854_100294060
285 Ga0068852_100524441
286 Ga0068859_100016478
287 Ga0068864_100018322
288 Ga0068870_10200346
289 Ga0068863_100041326
290 Ga0068862_100658053
291 Ga0075428_100075177
292 Ga0075433_10143436
293 Ga0075434_100209678
294 Ga0068865_100038758
295 Ga0097620_100016478
296 Ga0105251_10079246
297 Ga0111539_10011070
298 Ga0111539_10146764
299 Ga0105245_10184341
300 Ga0105245_10279756
301 Ga0114129_10202219
302 Ga0105243_10038073
303 Ga0105243_10087807
304 Ga0105243_10461633
305 Ga0105241_10242866
306 Ga0105242_10081839
307 Ga0105242_10494037
308 Ga0105242_10589358
309 Ga0105248_10127462
310 Ga0105249_10002356
311 Ga0105239_10022337
312 Ga0105239_10149971
313 Ga0105246_10089653
314 Ga0157378_10122676
315 Ga0163162_10386278
316 Ga0163162_10563827
317 Ga0157375_10180765
318 Ga0163163_10019769
319 Ga0163163_10157005
320 Ga0157380_10083104
321 Ga0157380_10143908
322 Ga0157377_10134525
323 Ga0163161_10163377
324 Ga0213874_10030803
325 Ga0207642_10073293
326 Ga0207684_10019964
327 Ga0207684_10483784
328 Ga0207654_10196892
329 Ga0207660_10000001
330 Ga0207660_10097090
331 Ga0207662_10001429
332 Ga0207646_10139612
333 Ga0207646_10151942
334 Ga0207646_10588366
335 Ga0207681_10514332
336 Ga0207659_10093249
337 Ga0207687_10077255
338 Ga0207644_10338545
339 Ga0207706_10003108
340 Ga0207686_10184468
341 Ga0207711_10026604
342 Ga0207689_10041201
343 Ga0207661_10037243
344 Ga0207678_10014514
345 Ga0207708_10008018
346 Ga0207641_10125631
347 Ga0207648_10001488
348 Ga0207648_10187812
349 Ga0207676_10054061
350 Ga0207676_10401779
351 Ga0207674_10008836
352 Ga0207675_100064602
353 Ga0209974_10023736
354 Ga0209974_10061533
355 Ga0265326_10001698
356 Ga0265326_10013796
357 Ga0265319_1006733
358 Ga0265334_10005324
359 Ga0265334_10032967
360 Ga0265318_10007189
361 Ga0265318_10025661
362 Ga0265323_10004815
363 Ga0265322_10034690
364 Ga0265322_10035124
365 Ga0265336_10004251
366 Ga0265336_10021769
367 Ga0265338_10026325
368 Ga0265338_10161949
369 Ga0265338_10282474
370 Ga0265324_10032078
371 Ga0265330_10012943
372 Ga0265332_10003604
373 Ga0265320_10031392
374 Ga0265325_10004307
375 Ga0265325_10017790
376 Ga0265329_10028785
377 Ga0265340_10044907
378 Ga0265340_10084113
379 Ga0265339_10059293
380 Ga0265331_10027720
381 Ga0265331_10058183
382 Ga0265316_10012368
383 Ga0265316_10035718
384 Ga0265316_10094380
385 Ga0265313_10044766
386 Ga0265313_10141783
387 Ga0316579_10056537
388 Ga0265314_10056705
389 Ga0265314_10130951
390 Ga0265342_10025732
391 Ga0265342_10157675
392 Ga0316577_10000547
393 Ga0316582_0064342
394 Ga0316584_0014044
395 Ga0373925_0065269
396 Ga0436365_1596774
397 Ga0436361_0127626
398 Ga0436361_0243572
399 Ga0436363_0079851
400 Ga0439461_0042743
401 Ga0439446_0045532
402 Ga0495630_0085712
403 Ga0495644_0077584
404 Ga0495634_0222592
405 Ga0495680_0308780
406 Ga0496102_0009183
407 Ga0496102_0019873
408 Ga0496102_0210779
409 Ga0496102_0714103
410 Ga0496103_0007459
411 Ga0496104_0010549
412 Ga0496104_0300905
413 Ga0496104_0505364
414 Ga0496105_0160030
415 Ga0496106_0054327
416 Ga0496107_0039533
417 Ga0496108_0005769
418 Ga0496108_0023726
419 Ga0496108_0176535
420 Ga0496109_0018458
421 Ga0496109_0030388
422 Ga0496111_0033875
423 Ga0496111_0035094
424 Ga0496112_0048694
425 Ga0496112_0336239
426 Ga0496113_0083471
427 Ga0496114_0160520
428 Ga0496114_0280824
429 Ga0496114_0634814
430 Ga0501031_0147264
431 Ga0501033_0112575
432 Ga0501036_0063391
433 Ga0501036_0147277
434 Ga0501036_0205131
435 Ga0501039_0022449
436 Ga0501040_0049401
437 Ga0501040_0078155
438 Ga0501040_0112274
439 Ga0501040_0139119
440 Ga0501040_0148926
441 Ga0501040_0304017
442 Ga0501041_0013602
443 Ga0501041_0048389
444 Ga0501042_0043484
445 Ga0501042_0083887
446 Ga0501043_0241246
447 Ga0501048_0090513
448 Ga0501067_0073511
449 Ga0501068_0071572
450 Ga0501068_0242295
451 Ga0501069_0039882
452 Ga0501071_0067064
453 Ga0501071_0077170
454 Ga0501071_0135996
455 Ga0501072_0025674
456 Ga0501072_0037345
457 Ga0501072_0086980
458 Ga0501072_0113531
459 Ga0501072_0135786
460 Ga0501072_0313123
461 Ga0501072_0362007
462 Ga0501074_0091223
463 Ga0501074_0340810
464 Ga0501075_0032291
465 Ga0501076_0092074
466 Ga0501076_0119255
467 Ga0501076_0160097
468 Ga0501076_0190268
469 Ga0501076_0574807
470 Ga0501077_0129017
471 Ga0501077_0239544
472 Ga0501079_0029331
473 Ga0501079_0067627
474 Ga0501079_0447630
475 Ga0501080_0005064
476 Ga0501080_0198584
477 Ga0501080_0261435
478 Ga0501081_0036712
479 Ga0501081_0216781
480 Ga0501081_0249919
481 Ga0501081_0283895
482 Ga0501081_0513057
483 Ga0501035_0137422
484 Ga0501045_0019590
485 Ga0501045_0023333
486 Ga0501045_0057141
487 Ga0501045_0059267
488 Ga0501045_0096507
489 Ga0501045_0159047
490 nmdc:mga05p37_334320_c1
491 nmdc:mga05p37_661605_c1
492 nmdc:mga06r32_88913_c1
493 nmdc:mga08y16_96014_c1
494 nmdc:mga0a205_11727_c1
495 nmdc:mga0a205_121377_c1
496 Ga0501084_0044193
497 Ga0501084_0099972
498 Ga0501084_0127089
499 Ga0501084_0223903
500 Ga0501084_0276527
501 Ga0590074_007450
502 Ga0590075_002153
503 Ga0590077_004330
504 Ga0501082_0148830
505 Ga0501082_0165388
506 Ga0501082_0182530
507 Ga0501082_0201361
508 Ga0501082_0251942
509 Ga0530510_0004815
510 Ga0530510_0060644
511 Ga0530510_0068999
512 Ga0530510_0090891

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03976

PPK2

Polyphosphate kinase 2 (PPK2)

74

303

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o6m-assembly1.cif.gz_A structure of polyphosphate kinase from meiothermus ruber n121d bound to atp 0.9837 9 260
5lcd-assembly1.cif.gz_A structure of polyphosphate kinase from meiothermus ruber bound to amp 0.9829 9 260
7bmm-assembly2.cif.gz_C crystal structure of polyphosphate kinase 2 from deinococcus radiodurans in apo form 0.9705 8 272
5o6k-assembly1.cif.gz_D structure of polyphosphate kinase from meiothermus ruber n121d 0.9699 9 265
5o6m-assembly1.cif.gz_A structure of polyphosphate kinase from meiothermus ruber n121d bound to atp 0.9648 9 260
ID Description Score Start End Superfamily
6aqeA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9711 8 272 3.40.50.300
5ldbC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9662 9 272 3.40.50.300
6aqeA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9639 8 272 3.40.50.300
5ldbC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.959 9 272 3.40.50.300
6angA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9566 1 260 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7V1RBX5-F1-model_v4 Polyphosphate kinase 2 family protein 0.99 12 256 GO:0006797
GO:0016301
GO:0016776
AF-A0A6J4UDU4-F1-model_v4 Polyphosphate kinase 2 (EC 2.-.-.-) 0.9881 12 256 GO:0006797
GO:0016301
GO:0016776
AF-Q09C39-F1-model_v4 PvdS 0.9877 65 256 GO:0006797
GO:0008976
AF-A0A7V8YVV4-F1-model_v4 Polyphosphate kinase 2 family protein 0.9872 9 263 GO:0006797
GO:0008976
AF-A0A3C1L7Q9-F1-model_v4 Polyphosphate kinase 0.9863 76 228 GO:0016301

Map