F366163

General Info

Members Datasets Scaffolds Average Seq Length
256 192 512 141

Family's Representative Sequence

Representative Sequence 3300003544|Ga0007417J51691_1059823|Ga0007417J51691_10598231
Length 144
Sequence MPPKKKKIVKTFTLQLKAASATPAPPVGPALGQHGVNIMEFVKAYNAATDSMRGDVVPAQITVYEDRTFTFVLKTPPAAQLLIKAAGVPKGSGVPQKDKVGKVTSAQVREIAEKKMSDLNANDIDQAMKIIAGTARSMGITVGE

Samples

Sample ID Description Type Environment
1 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
116 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
117 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
120 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
121 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
123 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
134 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
135 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
136 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
137 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
138 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
139 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
140 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
148 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
160 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
161 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
167 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
168 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
174 2501939600 Micromonospora sp. L5 Isolate Unclassified
175 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
176 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
177 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
178 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
179 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
180 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
181 2855683550 Micromonospora sp. RP3T Isolate Unclassified
182 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
183 2858868258 Micromonospora sp. MH33 Isolate Unclassified
184 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
185 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
186 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
187 2902582711 Micromonospora sp. AP08 Isolate Unclassified
188 649633069 Micromonospora sp. L5 Isolate Unclassified
189 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
190 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
191 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
192 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.59
Metatranscriptomes 8.98
Isolates 7.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.56
Nodule 0.39
Rhizoplane 4.3
Rhizosphere 88.28
Stem 0
Stem Tuber 0
Unclassified 1.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0007417J51691_1059823 3300003544 Bacteria 765
2 SwRhRL2b_contig_3741095 2162886007 Bacteria 2338
3 JGI24034J26672_10060635 3300002239 Bacteria 664
4 Ga0007410J51695_1037185 3300003574 Bacteria 734
5 Ga0007429J51699_1085805 3300003579 Bacteria 858
6 Ga0058859_11748156 3300004798 Bacteria 2152
7 Ga0058859_11811491 3300004798 Bacteria 1207
8 Ga0058861_11714049 3300004800 Bacteria 597
9 Ga0058861_12007760 3300004800 Bacteria 777
10 Ga0058860_12118084 3300004801 Bacteria 1266
11 Ga0058860_12241562 3300004801 Bacteria 1475
12 Ga0058862_12692948 3300004803 Bacteria 628
13 Ga0065704_10081607 3300005289 Bacteria 3732
14 Ga0070676_10028796 3300005328 Bacteria 3155
15 Ga0070676_10073988 3300005328 Bacteria 2051
16 Ga0070683_100040890 3300005329 Bacteria 4263
17 Ga0070690_100131439 3300005330 Bacteria 1691
18 Ga0070670_100018374 3300005331 Bacteria 5999
19 Ga0070670_100203435 3300005331 Bacteria 1721
20 Ga0068869_100062316 3300005334 Bacteria 2737
21 Ga0068869_101536750 3300005334 Bacteria 592
22 Ga0070682_100875689 3300005337 Bacteria 736
23 Ga0070682_101500344 3300005337 Bacteria 580
24 Ga0068868_100028338 3300005338 Bacteria 4281
25 Ga0068868_100052642 3300005338 Bacteria 3205
26 Ga0070689_100029357 3300005340 Bacteria 4162
27 Ga0070661_100242365 3300005344 Bacteria 1389
28 Ga0070692_10031182 3300005345 Bacteria 2671
29 Ga0070668_100043325 3300005347 Bacteria 3451
30 Ga0070668_100513348 3300005347 Bacteria 1039
31 Ga0070669_100288041 3300005353 Bacteria 1318
32 Ga0070675_100031497 3300005354 Bacteria 4287
33 Ga0070675_100033839 3300005354 Bacteria 4144
34 Ga0070671_101061714 3300005355 Bacteria 711
35 Ga0070674_100008473 3300005356 Bacteria 6122
36 Ga0070674_100081833 3300005356 Bacteria 2308
37 Ga0070673_100037705 3300005364 Bacteria 3684
38 Ga0070688_100003143 3300005365 Bacteria 8449
39 Ga0070659_100091453 3300005366 Bacteria 2439
40 Ga0070714_100036937 3300005435 Bacteria 4101
41 Ga0070705_101145324 3300005440 Bacteria 638
42 Ga0070700_100029333 3300005441 Bacteria 3279
43 Ga0070700_100226599 3300005441 Bacteria 1328
44 Ga0070663_100046620 3300005455 Bacteria 3067
45 Ga0070663_100119320 3300005455 Bacteria 1990
46 Ga0070678_100211995 3300005456 Bacteria 1605
47 Ga0070678_100530320 3300005456 Bacteria 1043
48 Ga0070662_100008427 3300005457 Bacteria 6720
49 Ga0070681_10000289 3300005458 Bacteria 40654
50 Ga0070681_10615577 3300005458 Bacteria 1000
51 Ga0068867_101345958 3300005459 Unclassified 660
52 Ga0070707_100031680 3300005468 Bacteria 5038
53 Ga0070684_100053686 3300005535 Bacteria 3509
54 Ga0070684_100065485 3300005535 Bacteria 3189
55 Ga0070686_100015598 3300005544 Bacteria 4405
56 Ga0070665_100053608 3300005548 Bacteria 4044
57 Ga0070664_100003343 3300005564 Bacteria 12964
58 Ga0070664_100091217 3300005564 Bacteria 2638
59 Ga0070702_100007323 3300005615 Bacteria 5278
60 Ga0068852_100610500 3300005616 Bacteria 1096
61 Ga0068870_10007115 3300005840 Bacteria 4975
62 Ga0068870_10230306 3300005840 Bacteria 1139
63 Ga0068863_100448617 3300005841 Bacteria 1266
64 Ga0068858_100154977 3300005842 Bacteria 2155
65 Ga0068858_100825868 3300005842 Bacteria 905
66 Ga0068860_100222046 3300005843 Bacteria 1835
67 Ga0075365_10009696 3300006038 Bacteria 5557
68 Ga0075428_101931698 3300006844 Bacteria 613
69 Ga0075431_100774559 3300006847 Bacteria 934
70 Ga0075431_100821669 3300006847 Bacteria 902
71 Ga0075429_100650103 3300006880 Bacteria 924
72 Ga0068865_101218690 3300006881 Bacteria 667
73 Ga0111539_10064107 3300009094 Bacteria 4349
74 Ga0111539_11000129 3300009094 Bacteria 972
75 Ga0105245_10457185 3300009098 Bacteria 1286
76 Ga0105245_10600604 3300009098 Bacteria 1127
77 Ga0114129_10000114 3300009147 Bacteria 80730
78 Ga0114129_10154522 3300009147 Bacteria 3139
79 Ga0114129_10156027 3300009147 Bacteria 3121
80 Ga0114129_11343785 3300009147 Bacteria 884
81 Ga0105243_10051861 3300009148 Bacteria 3246
82 Ga0105243_10078294 3300009148 Bacteria 2691
83 Ga0105242_10244344 3300009176 Bacteria 1615
84 Ga0105237_11110163 3300009545 Bacteria 798
85 Ga0105238_10660178 3300009551 Bacteria 1056
86 Ga0105238_10778245 3300009551 Bacteria 972
87 Ga0105249_10225237 3300009553 Bacteria 1847
88 Ga0105239_10187690 3300010375 Bacteria 2314
89 Ga0105239_10981459 3300010375 Bacteria 971
90 Ga0105246_10009303 3300011119 Bacteria 6051
91 Ga0105246_10172691 3300011119 Bacteria 1657
92 Ga0157378_10162515 3300013297 Bacteria 2089
93 Ga0157372_10434779 3300013307 Bacteria 1529
94 Ga0157375_10026124 3300013308 Bacteria 5437
95 Ga0157375_10560386 3300013308 Bacteria 1304
96 Ga0163163_10012417 3300014325 Bacteria 7760
97 Ga0157380_10059121 3300014326 Bacteria 3058
98 Ga0157380_10132475 3300014326 Bacteria 2129
99 Ga0157377_10001184 3300014745 Bacteria 11091
100 Ga0157377_10057344 3300014745 Bacteria 2214
101 Ga0157379_10119099 3300014968 Bacteria 2375
102 Ga0157379_10373425 3300014968 Bacteria 1308
103 Ga0197907_10323729 3300020069 Bacteria 2006
104 Ga0206349_1769847 3300020075 Bacteria 670
105 Ga0206352_10158715 3300020078 Bacteria 906
106 Ga0206350_10562332 3300020080 Bacteria 668
107 Ga0206350_10664288 3300020080 Bacteria 979
108 Ga0213873_10059222 3300021358 Bacteria 1032
109 Ga0213876_10255309 3300021384 Bacteria 931
110 Ga0224712_10024657 3300022467 Bacteria 2104
111 Ga0207682_10073844 3300025893 Bacteria 1449
112 Ga0207688_10009426 3300025901 Bacteria 5315
113 Ga0207645_10031343 3300025907 Bacteria 3422
114 Ga0207645_10076041 3300025907 Bacteria 2150
115 Ga0207643_10070281 3300025908 Bacteria 2013
116 Ga0207707_10000491 3300025912 Bacteria 40909
117 Ga0207663_10278580 3300025916 Bacteria 1241
118 Ga0207657_10070777 3300025919 Bacteria 2955
119 Ga0207649_10624151 3300025920 Bacteria 831
120 Ga0207652_10261228 3300025921 Bacteria 1562
121 Ga0207646_10048284 3300025922 Bacteria 3816
122 Ga0207681_10252008 3300025923 Bacteria 1379
123 Ga0207650_10437722 3300025925 Bacteria 1087
124 Ga0207659_10016549 3300025926 Bacteria 4801
125 Ga0207687_10270499 3300025927 Bacteria 1358
126 Ga0207687_11701919 3300025927 Bacteria 541
127 Ga0207664_10172900 3300025929 Bacteria 1850
128 Ga0207644_11043771 3300025931 Bacteria 686
129 Ga0207690_10071709 3300025932 Bacteria 2390
130 Ga0207706_10041598 3300025933 Bacteria 4073
131 Ga0207686_10193402 3300025934 Bacteria 1452
132 Ga0207709_10038377 3300025935 Bacteria 2852
133 Ga0207709_10041829 3300025935 Bacteria 2752
134 Ga0207670_10058300 3300025936 Bacteria 2622
135 Ga0207670_10691843 3300025936 Bacteria 843
136 Ga0207665_10232013 3300025939 Bacteria 1357
137 Ga0207711_10158539 3300025941 Bacteria 2047
138 Ga0207689_10014990 3300025942 Bacteria 6574
139 Ga0207689_11048002 3300025942 Bacteria 688
140 Ga0207661_10018072 3300025944 Bacteria 5234
141 Ga0207679_10004175 3300025945 Bacteria 8977
142 Ga0207651_10100728 3300025960 Bacteria 2142
143 Ga0207712_10743572 3300025961 Bacteria 859
144 Ga0207712_11429424 3300025961 Bacteria 619
145 Ga0207668_10057071 3300025972 Bacteria 2722
146 Ga0207668_10455767 3300025972 Bacteria 1092
147 Ga0207658_11531736 3300025986 Bacteria 610
148 Ga0207677_10011261 3300026023 Bacteria 5091
149 Ga0207703_10190303 3300026035 Bacteria 1817
150 Ga0207703_10220466 3300026035 Bacteria 1696
151 Ga0207678_10037197 3300026067 Bacteria 4235
152 Ga0207708_10014520 3300026075 Bacteria 5895
153 Ga0207683_10016208 3300026121 Bacteria 6343
154 Ga0207698_10207512 3300026142 Bacteria 1760
155 Ga0207698_11760824 3300026142 Bacteria 635
156 Ga0207428_10016667 3300027907 Bacteria 6319
157 Ga0268264_10195686 3300028381 Bacteria 1846
158 Ga0265319_1011168 3300028563 Bacteria 3697
159 Ga0265334_10286854 3300028573 Unclassified 564
160 Ga0265318_10031509 3300028577 Bacteria 2056
161 Ga0265338_10124739 3300028800 Bacteria 2045
162 Ga0265324_10086041 3300029957 Bacteria 1069
163 Ga0265320_10008285 3300031240 Bacteria 6367
164 Ga0265320_10100501 3300031240 Bacteria 1332
165 Ga0265325_10015102 3300031241 Bacteria 4353
166 Ga0265325_10114104 3300031241 Bacteria 1310
167 Ga0265316_10102385 3300031344 Bacteria 2175
168 Ga0265316_10128008 3300031344 Unclassified 1914
169 Ga0265313_10011601 3300031595 Bacteria 5466
170 Ga0307405_10755563 3300031731 Bacteria 810
171 Ga0307406_10255777 3300031901 Bacteria 1322
172 Ga0307407_10680057 3300031903 Bacteria 773
173 Ga0307407_10925806 3300031903 Bacteria 670
174 Ga0307409_100052647 3300031995 Bacteria 3123
175 Ga0307409_100566765 3300031995 Bacteria 1117
176 Ga0307415_100084396 3300032126 Bacteria 2279
177 Ga0307415_100202208 3300032126 Bacteria 1577
178 Ga0307415_101311397 3300032126 Bacteria 686
179 Ga0316588_1000633 3300033528 Bacteria 5052
180 Ga0395899_0415902 3300037312 Bacteria 887
181 Ga0395898_0612191 3300037466 Bacteria 1032
182 Ga0436365_0453863 3300039437 Bacteria 6719
183 Ga0436362_0804259 3300039453 Bacteria 2593
184 Ga0451793_0621619 3300041452 Bacteria 684
185 Ga0451807_0085772 3300041486 Bacteria 880
186 Ga0439454_030988 3300042011 Bacteria 838
187 Ga0439456_007529 3300042013 Bacteria 2238
188 Ga0451577_0000001 3300042876 Bacteria 2461803
189 Ga0466966_0845770 3300044684 Bacteria 552
190 Ga0466961_0337768 3300044693 Bacteria 918
191 Ga0466963_0056173 3300044694 Bacteria 2619
192 Ga0466963_0150240 3300044694 Bacteria 1617
193 Ga0466963_0594788 3300044694 Bacteria 781
194 Ga0453684_0088581 3300044712 Bacteria 3832
195 Ga0451576_0000067 3300045051 Bacteria 265145
196 Ga0451576_0149610 3300045051 Bacteria 2435
197 Ga0451576_0301562 3300045051 Bacteria 1676
198 Ga0466958_0042925 3300045836 Bacteria 2723
199 Ga0466958_0101856 3300045836 Bacteria 1786
200 Ga0466967_0244589 3300045976 Bacteria 1712
201 Ga0466967_0801824 3300045976 Bacteria 935
202 Ga0495667_0465973 3300046559 Bacteria 793
203 Ga0495656_0386603 3300046615 Bacteria 730
204 Ga0495581_0814490 3300047315 Bacteria 535
205 Ga0496101_0913098 3300048904 Bacteria 691
206 Ga0496104_0330981 3300048907 Bacteria 1436
207 Ga0496108_0048957 3300048911 Bacteria 3534
208 Ga0496108_0088097 3300048911 Bacteria 2637
209 Ga0496109_0089265 3300048912 Bacteria 2849
210 Ga0496109_0523477 3300048912 Bacteria 1119
211 Ga0496110_0334381 3300048913 Bacteria 1380
212 Ga0496110_0344041 3300048913 Bacteria 1358
213 Ga0496111_0299316 3300048914 Bacteria 1192
214 Ga0501318_025239 3300049534 Bacteria 778
215 Ga0501036_1497541 3300049572 Bacteria 546
216 Ga0501040_0548054 3300049576 Bacteria 835
217 Ga0501048_1290565 3300049582 Bacteria 525
218 Ga0501249_000156 3300049679 Bacteria 21248
219 Ga0501083_0000044 3300049744 Bacteria 91900
220 nmdc:mga0yw44_426805_c1 3300050492 Bacteria 898
221 nmdc:mga05p37_1507_c1 3300050507 Bacteria 27071
222 nmdc:mga05p37_60338_c3 3300050507 Bacteria 3055
223 nmdc:mga09592_1107895_c1 3300050508 Bacteria 658
224 nmdc:mga09592_274614_c1 3300050508 Bacteria 1462
225 nmdc:mga06r32_220681_c1 3300050510 Bacteria 1884
226 nmdc:mga06r32_381526_c1 3300050510 Bacteria 1392
227 nmdc:mga06r32_440257_c1 3300050510 Bacteria 1283
228 nmdc:mga08y16_1143137_c1 3300050511 Bacteria 752
229 nmdc:mga08y16_37108_c1 3300050511 Bacteria 5118
230 Ga0500643_160004 3300053087 Bacteria 604
231 Ga0500594_0000002 3300053118 Bacteria 916890
232 Ga0587070_063767 3300059491 Bacteria 769
233 Ga0587077_132668 3300059493 Bacteria 634
234 Ga0587080_088296 3300059503 Bacteria 647
235 Ga0587101_030810 3300059623 Bacteria 836
236 Ga0587062_135405 3300059639 Bacteria 510
237 Ga0466962_0069648 3300061719 Bacteria 1680
238 2501945155 2501939600 Bacteria 6907073
239 2515496714 2515154088 Bacteria 5526283
240 2515718285 2515154129 Bacteria 5584369
241 2515756953 2515154137 Bacteria 5711575
242 2516083555 2515154202 Bacteria 5471270
243 2516089491 2515154203 Bacteria 5458536
244 2676480105 2675903059 Bacteria 8644972
245 2855684494 2855683550 Bacteria 7134265
246 2856858891 2856858025 Bacteria 7255264
247 2858870681 2858868258 Bacteria 7683772
248 2858902912 2858902515 Bacteria 7086037
249 2867307190 2867302475 Bacteria 7087181
250 2887486679 2887478801 Bacteria 8972725
251 2902584298 2902582711 Bacteria 6187705
252 649810799 649633069 Bacteria 6962533
253 8001785191 8001781756 Bacteria 9586736
254 8003861991 8003856774 Bacteria 7675274
255 8003874673 8003870546 Bacteria 7396674
256 8055412867 8055412473 Bacteria 6257500
257 Ga0007417J51691_1059823
258 SwRhRL2b_contig_3741095
259 JGI24034J26672_10060635
260 Ga0007410J51695_1037185
261 Ga0007429J51699_1085805
262 Ga0058859_11748156
263 Ga0058859_11811491
264 Ga0058861_11714049
265 Ga0058861_12007760
266 Ga0058860_12118084
267 Ga0058860_12241562
268 Ga0058862_12692948
269 Ga0065704_10081607
270 Ga0070676_10028796
271 Ga0070676_10073988
272 Ga0070683_100040890
273 Ga0070690_100131439
274 Ga0070670_100018374
275 Ga0070670_100203435
276 Ga0068869_100062316
277 Ga0068869_101536750
278 Ga0070682_100875689
279 Ga0070682_101500344
280 Ga0068868_100028338
281 Ga0068868_100052642
282 Ga0070689_100029357
283 Ga0070661_100242365
284 Ga0070692_10031182
285 Ga0070668_100043325
286 Ga0070668_100513348
287 Ga0070669_100288041
288 Ga0070675_100031497
289 Ga0070675_100033839
290 Ga0070671_101061714
291 Ga0070674_100008473
292 Ga0070674_100081833
293 Ga0070673_100037705
294 Ga0070688_100003143
295 Ga0070659_100091453
296 Ga0070714_100036937
297 Ga0070705_101145324
298 Ga0070700_100029333
299 Ga0070700_100226599
300 Ga0070663_100046620
301 Ga0070663_100119320
302 Ga0070678_100211995
303 Ga0070678_100530320
304 Ga0070662_100008427
305 Ga0070681_10000289
306 Ga0070681_10615577
307 Ga0068867_101345958
308 Ga0070707_100031680
309 Ga0070684_100053686
310 Ga0070684_100065485
311 Ga0070686_100015598
312 Ga0070665_100053608
313 Ga0070664_100003343
314 Ga0070664_100091217
315 Ga0070702_100007323
316 Ga0068852_100610500
317 Ga0068870_10007115
318 Ga0068870_10230306
319 Ga0068863_100448617
320 Ga0068858_100154977
321 Ga0068858_100825868
322 Ga0068860_100222046
323 Ga0075365_10009696
324 Ga0075428_101931698
325 Ga0075431_100774559
326 Ga0075431_100821669
327 Ga0075429_100650103
328 Ga0068865_101218690
329 Ga0111539_10064107
330 Ga0111539_11000129
331 Ga0105245_10457185
332 Ga0105245_10600604
333 Ga0114129_10000114
334 Ga0114129_10154522
335 Ga0114129_10156027
336 Ga0114129_11343785
337 Ga0105243_10051861
338 Ga0105243_10078294
339 Ga0105242_10244344
340 Ga0105237_11110163
341 Ga0105238_10660178
342 Ga0105238_10778245
343 Ga0105249_10225237
344 Ga0105239_10187690
345 Ga0105239_10981459
346 Ga0105246_10009303
347 Ga0105246_10172691
348 Ga0157378_10162515
349 Ga0157372_10434779
350 Ga0157375_10026124
351 Ga0157375_10560386
352 Ga0163163_10012417
353 Ga0157380_10059121
354 Ga0157380_10132475
355 Ga0157377_10001184
356 Ga0157377_10057344
357 Ga0157379_10119099
358 Ga0157379_10373425
359 Ga0197907_10323729
360 Ga0206349_1769847
361 Ga0206352_10158715
362 Ga0206350_10562332
363 Ga0206350_10664288
364 Ga0213873_10059222
365 Ga0213876_10255309
366 Ga0224712_10024657
367 Ga0207682_10073844
368 Ga0207688_10009426
369 Ga0207645_10031343
370 Ga0207645_10076041
371 Ga0207643_10070281
372 Ga0207707_10000491
373 Ga0207663_10278580
374 Ga0207657_10070777
375 Ga0207649_10624151
376 Ga0207652_10261228
377 Ga0207646_10048284
378 Ga0207681_10252008
379 Ga0207650_10437722
380 Ga0207659_10016549
381 Ga0207687_10270499
382 Ga0207687_11701919
383 Ga0207664_10172900
384 Ga0207644_11043771
385 Ga0207690_10071709
386 Ga0207706_10041598
387 Ga0207686_10193402
388 Ga0207709_10038377
389 Ga0207709_10041829
390 Ga0207670_10058300
391 Ga0207670_10691843
392 Ga0207665_10232013
393 Ga0207711_10158539
394 Ga0207689_10014990
395 Ga0207689_11048002
396 Ga0207661_10018072
397 Ga0207679_10004175
398 Ga0207651_10100728
399 Ga0207712_10743572
400 Ga0207712_11429424
401 Ga0207668_10057071
402 Ga0207668_10455767
403 Ga0207658_11531736
404 Ga0207677_10011261
405 Ga0207703_10190303
406 Ga0207703_10220466
407 Ga0207678_10037197
408 Ga0207708_10014520
409 Ga0207683_10016208
410 Ga0207698_10207512
411 Ga0207698_11760824
412 Ga0207428_10016667
413 Ga0268264_10195686
414 Ga0265319_1011168
415 Ga0265334_10286854
416 Ga0265318_10031509
417 Ga0265338_10124739
418 Ga0265324_10086041
419 Ga0265320_10008285
420 Ga0265320_10100501
421 Ga0265325_10015102
422 Ga0265325_10114104
423 Ga0265316_10102385
424 Ga0265316_10128008
425 Ga0265313_10011601
426 Ga0307405_10755563
427 Ga0307406_10255777
428 Ga0307407_10680057
429 Ga0307407_10925806
430 Ga0307409_100052647
431 Ga0307409_100566765
432 Ga0307415_100084396
433 Ga0307415_100202208
434 Ga0307415_101311397
435 Ga0316588_1000633
436 Ga0395899_0415902
437 Ga0395898_0612191
438 Ga0436365_0453863
439 Ga0436362_0804259
440 Ga0451793_0621619
441 Ga0451807_0085772
442 Ga0439454_030988
443 Ga0439456_007529
444 Ga0451577_0000001
445 Ga0466966_0845770
446 Ga0466961_0337768
447 Ga0466963_0056173
448 Ga0466963_0150240
449 Ga0466963_0594788
450 Ga0453684_0088581
451 Ga0451576_0000067
452 Ga0451576_0149610
453 Ga0451576_0301562
454 Ga0466958_0042925
455 Ga0466958_0101856
456 Ga0466967_0244589
457 Ga0466967_0801824
458 Ga0495667_0465973
459 Ga0495656_0386603
460 Ga0495581_0814490
461 Ga0496101_0913098
462 Ga0496104_0330981
463 Ga0496108_0048957
464 Ga0496108_0088097
465 Ga0496109_0089265
466 Ga0496109_0523477
467 Ga0496110_0334381
468 Ga0496110_0344041
469 Ga0496111_0299316
470 Ga0501318_025239
471 Ga0501036_1497541
472 Ga0501040_0548054
473 Ga0501048_1290565
474 Ga0501249_000156
475 Ga0501083_0000044
476 nmdc:mga0yw44_426805_c1
477 nmdc:mga05p37_1507_c1
478 nmdc:mga05p37_60338_c3
479 nmdc:mga09592_1107895_c1
480 nmdc:mga09592_274614_c1
481 nmdc:mga06r32_220681_c1
482 nmdc:mga06r32_381526_c1
483 nmdc:mga06r32_440257_c1
484 nmdc:mga08y16_1143137_c1
485 nmdc:mga08y16_37108_c1
486 Ga0500643_160004
487 Ga0500594_0000002
488 Ga0587070_063767
489 Ga0587077_132668
490 Ga0587080_088296
491 Ga0587101_030810
492 Ga0587062_135405
493 Ga0466962_0069648
494 2501945155
495 2515496714
496 2515718285
497 2515756953
498 2516083555
499 2516089491
500 2676480105
501 2855684494
502 2856858891
503 2858870681
504 2858902912
505 2867307190
506 2887486679
507 2902584298
508 649810799
509 8001785191
510 8003861991
511 8003874673
512 8055412867

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00298

Ribosomal_L11

Ribosomal protein L11, RNA binding domain

74

142

0.99

PF03946

Ribosomal_L11_N

Ribosomal protein L11, N-terminal domain

12

69

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mms-assembly2.cif.gz_B crystal structure of the ribosomal protein l11-rna complex 0.9873 71 140
3cjt-assembly4.cif.gz_H ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 0.9845 3 72
1y39-assembly2.cif.gz_B co-evolution of protein and rna structures within a highly conserved ribosomal domain 0.9816 71 141
3egv-assembly1.cif.gz_B ribosomal protein l11 methyltransferase (prma) in complex with trimethylated ribosomal protein l11 0.9807 3 78
5gae-assembly1.cif.gz_J rnc in complex with a translocating secyeg 0.9748 71 140
ID Description Score Start End Superfamily
af_A0A0R4J4M9_4_71_3.30.1550.10 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.986 3 67 3.30.1550.10
af_I1J9L7_135_215_1.10.10.250 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.9852 72 139 1.10.10.250
3egvB00 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.9807 3 78 3.30.1550.10
1hc8A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.96 67 140 1.10.10.250
1vq4I00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.9595 72 140 1.10.10.250
ID Description Score Start End GO Terms
AF-A0A2D7JF69-F1-model_v4 50S ribosomal protein L11 1.003 1 71 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A7J4E0X6-F1-model_v4 deleted 1.002 1 69
AF-A0A2N2LDD6-F1-model_v4 50S ribosomal protein L11 1 1 72 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A6J7VYD9-F1-model_v4 Unannotated protein 0.9955 79 141 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A7W0ZIT1-F1-model_v4 50S ribosomal protein L11 0.995 78 140 GO:0003735
GO:0006412
GO:0022625
GO:0070180

Map