F366089

General Info

Members Datasets Scaffolds Average Seq Length
255 200 510 162

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2622736605|2623501657
Length 184
Sequence ARATPSAWRRIPGEGARSRSHWIGSGAVAATPAVRVLEKARVAHTLHPYDPEHPTGQGHGEAAVAALGADPRQVFKTLVTRVDGALTVAVVPVSGSLDLKALAAAAGGRRAAMADPVDAERTTGYVRGGISPLGQRKALPTVVDESALGLPTVLVSAGRRGLQVELAPDDLVRLTRARTAPISR

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
31 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
32 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
39 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
54 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
55 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
56 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
57 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
58 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
59 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
60 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
61 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
62 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
63 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
64 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
65 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
66 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
67 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
68 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
69 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
70 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
71 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
72 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
73 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
74 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
75 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
76 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
77 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
78 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
84 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
85 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
86 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
87 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
88 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
89 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
90 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
91 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
92 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
93 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
94 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
95 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
96 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
97 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
98 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
99 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
100 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
101 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
102 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
103 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
104 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
105 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
106 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
107 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
108 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
109 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
110 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
111 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
112 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
113 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
129 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
130 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
131 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
132 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
133 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
134 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
135 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
136 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
137 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
138 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
139 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
143 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
147 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
148 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
149 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
150 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
151 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
152 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
153 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
154 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
155 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
156 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
157 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
158 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
159 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
160 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
161 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
162 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
163 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
164 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
165 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
166 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
167 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
168 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
169 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
170 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
171 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
172 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
173 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
174 2858882152 Micromonospora noduli MED15 Isolate Nodule
175 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
176 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
177 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
178 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
179 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
180 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
181 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
182 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
183 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
184 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
185 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
186 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
187 649633069 Micromonospora sp. L5 Isolate Unclassified
188 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
189 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
190 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
191 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
192 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
193 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
194 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
195 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
196 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
197 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
198 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
199 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
200 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.75
Metatranscriptomes 1.18
Isolates 16.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.1
Nodule 2.35
Rhizoplane 2.75
Rhizosphere 72.94
Stem 0
Stem Tuber 0
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10139702 3300003203 Bacteria 709
2 rootH1_10080083 3300003316 Bacteria 1315
3 rootH2_10067161 3300003320 Bacteria 1998
4 rootH1_10164389 3300003323 Bacteria 1352
5 Ga0070683_100572502 3300005329 Bacteria 1080
6 Ga0070670_101191986 3300005331 Bacteria 696
7 Ga0068868_100322185 3300005338 Bacteria 1317
8 Ga0070692_10188330 3300005345 Bacteria 1200
9 Ga0070668_100052992 3300005347 Bacteria 3128
10 Ga0070669_100362886 3300005353 Bacteria 1178
11 Ga0070667_100322717 3300005367 Bacteria 1394
12 Ga0070667_100567191 3300005367 Bacteria 1044
13 Ga0070663_100224188 3300005455 Bacteria 1477
14 Ga0070679_100199847 3300005530 Bacteria 1966
15 Ga0070684_100329258 3300005535 Bacteria 1404
16 Ga0070684_100909055 3300005535 Bacteria 825
17 Ga0070665_100359634 3300005548 Bacteria 1461
18 Ga0068856_100703424 3300005614 Bacteria 1031
19 Ga0068859_100624462 3300005617 Bacteria 1170
20 Ga0068859_100732668 3300005617 Bacteria 1078
21 Ga0068870_10541879 3300005840 Bacteria 782
22 Ga0068858_100253839 3300005842 Bacteria 1671
23 Ga0068860_100012692 3300005843 Bacteria 8288
24 Ga0068862_100546427 3300005844 Bacteria 1106
25 Ga0081455_10422212 3300005937 Bacteria 919
26 Ga0081539_10001279 3300005985 Bacteria 44286
27 Ga0081539_10001559 3300005985 Bacteria 38075
28 Ga0075431_100511964 3300006847 Bacteria 1190
29 Ga0075429_100156721 3300006880 Bacteria 1994
30 Ga0097620_100624446 3300006931 Bacteria 1170
31 Ga0097620_100732652 3300006931 Bacteria 1078
32 Ga0105245_10383989 3300009098 Bacteria 1399
33 Ga0114129_10000976 3300009147 Bacteria 37436
34 Ga0114129_10296532 3300009147 Bacteria 2156
35 Ga0105248_10518676 3300009177 Bacteria 1344
36 Ga0157371_10801853 3300013102 Bacteria 710
37 Ga0157374_11803833 3300013296 Bacteria 637
38 Ga0157378_10365419 3300013297 Bacteria 1413
39 Ga0157372_12387370 3300013307 Bacteria 607
40 Ga0157375_10506682 3300013308 Bacteria 1371
41 Ga0163163_10594742 3300014325 Bacteria 1169
42 Ga0163163_10741211 3300014325 Bacteria 1046
43 Ga0157379_10565229 3300014968 Bacteria 1059
44 Ga0157379_10586241 3300014968 Bacteria 1040
45 Ga0206354_10892602 3300020081 Bacteria 1166
46 Ga0207426_1001321 3300025302 Bacteria 21134
47 Ga0207426_1006641 3300025302 Bacteria 4979
48 Ga0207652_10308775 3300025921 Bacteria 1428
49 Ga0207650_10820098 3300025925 Bacteria 789
50 Ga0207711_10356516 3300025941 Bacteria 1355
51 Ga0207668_10343209 3300025972 Bacteria 1246
52 Ga0207668_10715640 3300025972 Bacteria 881
53 Ga0207658_10121684 3300025986 Bacteria 2082
54 Ga0207677_10810433 3300026023 Bacteria 839
55 Ga0207678_10084143 3300026067 Bacteria 2720
56 Ga0207678_10404684 3300026067 Bacteria 1182
57 Ga0207702_11307444 3300026078 Bacteria 719
58 Ga0207641_10868720 3300026088 Bacteria 895
59 Ga0207675_100447580 3300026118 Bacteria 1279
60 Ga0207683_11319350 3300026121 Bacteria 668
61 Ga0268266_10972655 3300028379 Bacteria 821
62 Ga0268265_10591827 3300028380 Bacteria 1059
63 Ga0268264_10165919 3300028381 Bacteria 1993
64 Ga0307517_10387684 3300028786 Bacteria 744
65 Ga0307515_10059599 3300028794 Bacteria 5466
66 Ga0307515_10063083 3300028794 Bacteria 5216
67 Ga0307515_10301121 3300028794 Bacteria 1288
68 Ga0307512_10004312 3300030522 Bacteria 15691
69 Ga0307512_10051451 3300030522 Bacteria 3295
70 Ga0307513_10026855 3300031456 Bacteria 6623
71 Ga0307509_10101423 3300031507 Bacteria 2913
72 Ga0307508_10005196 3300031616 Bacteria 12457
73 Ga0307508_10006849 3300031616 Bacteria 10662
74 Ga0307508_10040383 3300031616 Bacteria 4189
75 Ga0307516_10055737 3300031730 Bacteria 3857
76 Ga0307516_10070920 3300031730 Bacteria 3346
77 Ga0307516_10095335 3300031730 Bacteria 2798
78 Ga0307516_10151466 3300031730 Bacteria 2079
79 Ga0307516_10181075 3300031730 Bacteria 1841
80 Ga0307516_10235693 3300031730 Bacteria 1531
81 Ga0307516_10281946 3300031730 Bacteria 1343
82 Ga0307405_10023361 3300031731 Bacteria 3514
83 Ga0307405_10047670 3300031731 Bacteria 2639
84 Ga0307413_10558487 3300031824 Bacteria 930
85 Ga0307410_10252162 3300031852 Bacteria 1372
86 Ga0307410_11511119 3300031852 Bacteria 592
87 Ga0326468_10000930 3300031889 Bacteria 2841
88 Ga0307406_10068394 3300031901 Bacteria 2318
89 Ga0307407_10295103 3300031903 Bacteria 1128
90 Ga0307407_10519493 3300031903 Bacteria 875
91 Ga0307412_10025673 3300031911 Bacteria 3652
92 Ga0307412_10250862 3300031911 Bacteria 1374
93 Ga0307409_100004780 3300031995 Bacteria 7680
94 Ga0307409_100055066 3300031995 Bacteria 3068
95 Ga0307409_101520810 3300031995 Bacteria 697
96 Ga0307416_100035191 3300032002 Bacteria 3821
97 Ga0307416_102465951 3300032002 Bacteria 619
98 Ga0307415_100024930 3300032126 Bacteria 3745
99 Ga0307415_100034192 3300032126 Bacteria 3307
100 Ga0307415_100183494 3300032126 Bacteria 1644
101 Ga0307415_100211410 3300032126 Bacteria 1548
102 Ga0307415_100211691 3300032126 Bacteria 1547
103 Ga0307507_10040256 3300033179 Bacteria 4697
104 Ga0307510_10326092 3300033180 Bacteria 991
105 Ga0373948_0041477 3300034817 Bacteria 964
106 Ga0373940_0157012 3300035088 Bacteria 728
107 Ga0373939_0032107 3300035114 Bacteria 1523
108 Ga0373939_0212076 3300035114 Bacteria 737
109 Ga0373941_0030155 3300035115 Bacteria 1605
110 Ga0373942_0000018 3300035207 Bacteria 32659
111 Ga0373962_0012929 3300035242 Bacteria 2107
112 Ga0373935_0009688 3300035692 Bacteria 5767
113 Ga0395900_0322272 3300037418 Bacteria 1525
114 Ga0395898_0036617 3300037466 Bacteria 4872
115 Ga0395905_0377016 3300037471 Bacteria 1312
116 Ga0395901_0193747 3300038443 Bacteria 2131
117 Ga0451853_1525941 3300041512 Bacteria 1819
118 Ga0439448_0050833 3300042005 Bacteria 1357
119 Ga0439463_019454 3300042016 Bacteria 1692
120 Ga0439459_0080690 3300042438 Bacteria 767
121 Ga0439464_0024206 3300042439 Bacteria 1679
122 Ga0466967_0711967 3300045976 Bacteria 995
123 Ga0495603_0000118 3300046455 Bacteria 38501
124 Ga0495629_0003945 3300046459 Bacteria 11160
125 Ga0495629_0041454 3300046459 Bacteria 3239
126 Ga0495641_0481705 3300046461 Bacteria 565
127 Ga0495662_0250208 3300046476 Bacteria 873
128 Ga0495585_0049655 3300046492 Bacteria 2329
129 Ga0495594_0001176 3300046499 Bacteria 13693
130 Ga0495594_0030915 3300046499 Unclassified 2901
131 Ga0495594_0171576 3300046499 Bacteria 1234
132 Ga0495606_0007370 3300046507 Bacteria 9874
133 Ga0495622_0017124 3300046557 Bacteria 3374
134 Ga0495668_0001746 3300046616 Bacteria 19942
135 Ga0495625_0000956 3300046660 Bacteria 38568
136 Ga0495588_0031353 3300046674 Bacteria 2675
137 Ga0495613_0004176 3300046689 Bacteria 10813
138 Ga0495589_0275945 3300046794 Bacteria 782
139 Ga0495581_0483267 3300047315 Bacteria 720
140 Ga0495676_0006095 3300047321 Bacteria 11087
141 Ga0495676_0006752 3300047321 Bacteria 10552
142 Ga0495683_0175784 3300047323 Bacteria 981
143 Ga0495614_0006637 3300048089 Bacteria 5181
144 Ga0495626_0000148 3300048091 Bacteria 86787
145 Ga0496104_0125301 3300048907 Bacteria 2467
146 Ga0496105_0611645 3300048908 Bacteria 845
147 Ga0496106_0076835 3300048909 Bacteria 2560
148 Ga0496112_0038736 3300048915 Bacteria 4656
149 Ga0496112_0040571 3300048915 Bacteria 4551
150 Ga0496113_0792769 3300048916 Bacteria 753
151 Ga0496126_0097206 3300048929 Bacteria 2581
152 Ga0501317_006975 3300049533 Bacteria 1260
153 Ga0501325_000958 3300049541 Bacteria 1627
154 Ga0501031_0023828 3300049568 Bacteria 3990
155 Ga0501032_0002783 3300049569 Bacteria 13607
156 Ga0501032_0054525 3300049569 Bacteria 2691
157 Ga0501033_0025945 3300049570 Bacteria 4412
158 Ga0501034_0049017 3300049571 Bacteria 4262
159 Ga0501034_0466862 3300049571 Bacteria 1178
160 Ga0501034_1157916 3300049571 Bacteria 653
161 Ga0501036_0001699 3300049572 Bacteria 17087
162 Ga0501036_0006056 3300049572 Bacteria 9809
163 Ga0501037_0004902 3300049573 Bacteria 9738
164 Ga0501038_0030950 3300049574 Bacteria 4731
165 Ga0501038_0054285 3300049574 Bacteria 3446
166 Ga0501039_0035966 3300049575 Bacteria 3820
167 Ga0501039_0112151 3300049575 Bacteria 2132
168 Ga0501041_0005939 3300049577 Bacteria 7142
169 Ga0501043_0028894 3300049579 Bacteria 4351
170 Ga0501043_0716796 3300049579 Bacteria 729
171 Ga0501046_0031885 3300049580 Bacteria 4269
172 Ga0501047_0002545 3300049581 Bacteria 17375
173 Ga0501047_0299266 3300049581 Bacteria 1451
174 Ga0501047_0327856 3300049581 Bacteria 1370
175 Ga0501048_0009030 3300049582 Bacteria 7506
176 Ga0501048_0160396 3300049582 Bacteria 1591
177 Ga0501067_0002580 3300049583 Bacteria 10011
178 Ga0501068_0000577 3300049584 Bacteria 18628
179 Ga0501069_0133472 3300049585 Bacteria 1422
180 Ga0501070_0030214 3300049586 Bacteria 4540
181 Ga0501070_0650357 3300049586 Bacteria 837
182 Ga0501071_0025809 3300049587 Bacteria 4118
183 Ga0501072_0011329 3300049588 Bacteria 6813
184 Ga0501073_0005145 3300049589 Bacteria 9815
185 Ga0501073_0008611 3300049589 Bacteria 7560
186 Ga0501074_0051824 3300049590 Bacteria 2961
187 Ga0501077_0060424 3300049593 Bacteria 2405
188 Ga0501079_0344966 3300049741 Bacteria 1166
189 Ga0501080_0429117 3300049742 Bacteria 1187
190 Ga0501083_0026593 3300049744 Bacteria 3998
191 Ga0501035_0005959 3300049822 Bacteria 11473
192 Ga0501035_0026863 3300049822 Bacteria 5264
193 Ga0501044_0012432 3300049823 Bacteria 9217
194 Ga0501044_0041638 3300049823 Bacteria 4782
195 Ga0501045_0019570 3300049824 Bacteria 4828
196 Ga0501045_0425246 3300049824 Bacteria 988
197 nmdc:mga03n38_7094_c1 3300050490 Bacteria 3941
198 nmdc:mga05p37_169260_c1 3300050507 Bacteria 2665
199 nmdc:mga05p37_3767_c1 3300050507 Bacteria 17753
200 nmdc:mga09592_135833_c1 3300050508 Bacteria 2118
201 nmdc:mga06r32_504002_c1 3300050510 Bacteria 1187
202 Ga0500583_0121042 3300053092 Bacteria 1295
203 Ga0500651_0012315 3300053093 Bacteria 5185
204 Ga0500641_0113072 3300053096 Bacteria 1169
205 Ga0500650_0072412 3300053098 Bacteria 1611
206 Ga0500569_017328 3300053109 Bacteria 1840
207 Ga0500594_0086458 3300053118 Bacteria 945
208 Ga0500652_015797 3300053131 Bacteria 2734
209 Ga0500658_0106432 3300053134 Bacteria 1230
210 Ga0500579_087366 3300053143 Bacteria 1705
211 Ga0500633_0103625 3300053160 Bacteria 1049
212 Ga0501084_0031798 3300054114 Bacteria 4412
213 Ga0501082_0017080 3300060353 Bacteria 6252
214 Ga0530510_0274424 3300061734 Bacteria 1259
215 2623501657 2622736605 Bacteria 4992138
216 2515718381 2515154129 Bacteria 5584369
217 2515756858 2515154137 Bacteria 5711575
218 2516083465 2515154202 Bacteria 5471270
219 2516089393 2515154203 Bacteria 5458536
220 2554259035 2554235005 Bacteria 6457341
221 2585302054 2582581312 Bacteria 7308206
222 2753265231 2751185782 Bacteria 11227053
223 2772644977 2772190715 Bacteria 6959372
224 2793984593 2791355406 Bacteria 11364898
225 2831941029 2831935698 Bacteria 5963223
226 2855672900 2855670206 Bacteria 7120389
227 2855680218 2855676851 Bacteria 7063653
228 2858849733 2858848962 Bacteria 6963058
229 2858885638 2858882152 Bacteria 7230291
230 2858897715 2858895516 Bacteria 7378898
231 2867307083 2867302475 Bacteria 7087181
232 2867316529 2867312974 Bacteria 7058875
233 2867321723 2867319477 Bacteria 7069771
234 2869048718 2869048445 Bacteria 6875584
235 2869064444 2869061728 Bacteria 7112407
236 2869074441 2869068681 Bacteria 7205615
237 2880497037 2880495981 Bacteria 7340502
238 2887485766 2887478801 Bacteria 8972725
239 2929225633 2929219909 Bacteria 6984360
240 2929231389 2929226422 Bacteria 7248583
241 2995464595 2995463766 Bacteria 8577691
242 649810690 649633069 Bacteria 6962533
243 8001785097 8001781756 Bacteria 9586736
244 8003832633 8003830390 Bacteria 6541657
245 8003858278 8003856774 Bacteria 7675274
246 8003876971 8003870546 Bacteria 7396674
247 8047899675 8047893842 Bacteria 11723082
248 8048135505 8048127548 Bacteria 11053136
249 8048359255 8048356638 Bacteria 11044339
250 8048376624 8048369669 Bacteria 11666822
251 8048385677 8048379754 Bacteria 11877923
252 8054706621 8054704163 Bacteria 7247792
253 8054733773 8054727385 Bacteria 7558670
254 8054740667 8054734606 Bacteria 6947278
255 8055414003 8055412473 Bacteria 6257500
256 JGI25406J46586_10139702
257 rootH1_10080083
258 rootH2_10067161
259 rootH1_10164389
260 Ga0070683_100572502
261 Ga0070670_101191986
262 Ga0068868_100322185
263 Ga0070692_10188330
264 Ga0070668_100052992
265 Ga0070669_100362886
266 Ga0070667_100322717
267 Ga0070667_100567191
268 Ga0070663_100224188
269 Ga0070679_100199847
270 Ga0070684_100329258
271 Ga0070684_100909055
272 Ga0070665_100359634
273 Ga0068856_100703424
274 Ga0068859_100624462
275 Ga0068859_100732668
276 Ga0068870_10541879
277 Ga0068858_100253839
278 Ga0068860_100012692
279 Ga0068862_100546427
280 Ga0081455_10422212
281 Ga0081539_10001279
282 Ga0081539_10001559
283 Ga0075431_100511964
284 Ga0075429_100156721
285 Ga0097620_100624446
286 Ga0097620_100732652
287 Ga0105245_10383989
288 Ga0114129_10000976
289 Ga0114129_10296532
290 Ga0105248_10518676
291 Ga0157371_10801853
292 Ga0157374_11803833
293 Ga0157378_10365419
294 Ga0157372_12387370
295 Ga0157375_10506682
296 Ga0163163_10594742
297 Ga0163163_10741211
298 Ga0157379_10565229
299 Ga0157379_10586241
300 Ga0206354_10892602
301 Ga0207426_1001321
302 Ga0207426_1006641
303 Ga0207652_10308775
304 Ga0207650_10820098
305 Ga0207711_10356516
306 Ga0207668_10343209
307 Ga0207668_10715640
308 Ga0207658_10121684
309 Ga0207677_10810433
310 Ga0207678_10084143
311 Ga0207678_10404684
312 Ga0207702_11307444
313 Ga0207641_10868720
314 Ga0207675_100447580
315 Ga0207683_11319350
316 Ga0268266_10972655
317 Ga0268265_10591827
318 Ga0268264_10165919
319 Ga0307517_10387684
320 Ga0307515_10059599
321 Ga0307515_10063083
322 Ga0307515_10301121
323 Ga0307512_10004312
324 Ga0307512_10051451
325 Ga0307513_10026855
326 Ga0307509_10101423
327 Ga0307508_10005196
328 Ga0307508_10006849
329 Ga0307508_10040383
330 Ga0307516_10055737
331 Ga0307516_10070920
332 Ga0307516_10095335
333 Ga0307516_10151466
334 Ga0307516_10181075
335 Ga0307516_10235693
336 Ga0307516_10281946
337 Ga0307405_10023361
338 Ga0307405_10047670
339 Ga0307413_10558487
340 Ga0307410_10252162
341 Ga0307410_11511119
342 Ga0326468_10000930
343 Ga0307406_10068394
344 Ga0307407_10295103
345 Ga0307407_10519493
346 Ga0307412_10025673
347 Ga0307412_10250862
348 Ga0307409_100004780
349 Ga0307409_100055066
350 Ga0307409_101520810
351 Ga0307416_100035191
352 Ga0307416_102465951
353 Ga0307415_100024930
354 Ga0307415_100034192
355 Ga0307415_100183494
356 Ga0307415_100211410
357 Ga0307415_100211691
358 Ga0307507_10040256
359 Ga0307510_10326092
360 Ga0373948_0041477
361 Ga0373940_0157012
362 Ga0373939_0032107
363 Ga0373939_0212076
364 Ga0373941_0030155
365 Ga0373942_0000018
366 Ga0373962_0012929
367 Ga0373935_0009688
368 Ga0395900_0322272
369 Ga0395898_0036617
370 Ga0395905_0377016
371 Ga0395901_0193747
372 Ga0451853_1525941
373 Ga0439448_0050833
374 Ga0439463_019454
375 Ga0439459_0080690
376 Ga0439464_0024206
377 Ga0466967_0711967
378 Ga0495603_0000118
379 Ga0495629_0003945
380 Ga0495629_0041454
381 Ga0495641_0481705
382 Ga0495662_0250208
383 Ga0495585_0049655
384 Ga0495594_0001176
385 Ga0495594_0030915
386 Ga0495594_0171576
387 Ga0495606_0007370
388 Ga0495622_0017124
389 Ga0495668_0001746
390 Ga0495625_0000956
391 Ga0495588_0031353
392 Ga0495613_0004176
393 Ga0495589_0275945
394 Ga0495581_0483267
395 Ga0495676_0006095
396 Ga0495676_0006752
397 Ga0495683_0175784
398 Ga0495614_0006637
399 Ga0495626_0000148
400 Ga0496104_0125301
401 Ga0496105_0611645
402 Ga0496106_0076835
403 Ga0496112_0038736
404 Ga0496112_0040571
405 Ga0496113_0792769
406 Ga0496126_0097206
407 Ga0501317_006975
408 Ga0501325_000958
409 Ga0501031_0023828
410 Ga0501032_0002783
411 Ga0501032_0054525
412 Ga0501033_0025945
413 Ga0501034_0049017
414 Ga0501034_0466862
415 Ga0501034_1157916
416 Ga0501036_0001699
417 Ga0501036_0006056
418 Ga0501037_0004902
419 Ga0501038_0030950
420 Ga0501038_0054285
421 Ga0501039_0035966
422 Ga0501039_0112151
423 Ga0501041_0005939
424 Ga0501043_0028894
425 Ga0501043_0716796
426 Ga0501046_0031885
427 Ga0501047_0002545
428 Ga0501047_0299266
429 Ga0501047_0327856
430 Ga0501048_0009030
431 Ga0501048_0160396
432 Ga0501067_0002580
433 Ga0501068_0000577
434 Ga0501069_0133472
435 Ga0501070_0030214
436 Ga0501070_0650357
437 Ga0501071_0025809
438 Ga0501072_0011329
439 Ga0501073_0005145
440 Ga0501073_0008611
441 Ga0501074_0051824
442 Ga0501077_0060424
443 Ga0501079_0344966
444 Ga0501080_0429117
445 Ga0501083_0026593
446 Ga0501035_0005959
447 Ga0501035_0026863
448 Ga0501044_0012432
449 Ga0501044_0041638
450 Ga0501045_0019570
451 Ga0501045_0425246
452 nmdc:mga03n38_7094_c1
453 nmdc:mga05p37_169260_c1
454 nmdc:mga05p37_3767_c1
455 nmdc:mga09592_135833_c1
456 nmdc:mga06r32_504002_c1
457 Ga0500583_0121042
458 Ga0500651_0012315
459 Ga0500641_0113072
460 Ga0500650_0072412
461 Ga0500569_017328
462 Ga0500594_0086458
463 Ga0500652_015797
464 Ga0500658_0106432
465 Ga0500579_087366
466 Ga0500633_0103625
467 Ga0501084_0031798
468 Ga0501082_0017080
469 Ga0530510_0274424
470 2623501657
471 2515718381
472 2515756858
473 2516083465
474 2516089393
475 2554259035
476 2585302054
477 2753265231
478 2772644977
479 2793984593
480 2831941029
481 2855672900
482 2855680218
483 2858849733
484 2858885638
485 2858897715
486 2867307083
487 2867316529
488 2867321723
489 2869048718
490 2869064444
491 2869074441
492 2880497037
493 2887485766
494 2929225633
495 2929231389
496 2995464595
497 649810690
498 8001785097
499 8003832633
500 8003858278
501 8003876971
502 8047899675
503 8048135505
504 8048359255
505 8048376624
506 8048385677
507 8054706621
508 8054733773
509 8054740667
510 8055414003

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04073

tRNA_edit

Aminoacyl-tRNA editing domain

54

174

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dbx-assembly2.cif.gz_B crystal structure of cysteinyl-trna(pro) deacylase from h. influenzae (hi1434) 0.9456 9 161
2dxa-assembly1.cif.gz_A crystal structure of trans editing enzyme prox from e.coli 0.9449 9 161
1dbu-assembly1.cif.gz_A crystal structure of cysteinyl-trna(pro) deacylase protein from h. influenzae (hi1434) 0.9387 9 161
1dbx-assembly2.cif.gz_B crystal structure of cysteinyl-trna(pro) deacylase from h. influenzae (hi1434) 0.9336 9 161
1dbu-assembly1.cif.gz_A crystal structure of cysteinyl-trna(pro) deacylase protein from h. influenzae (hi1434) 0.9268 9 161
ID Description Score Start End Superfamily
1dbxB00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9422 9 161 3.90.960.10
1dbxB00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.93 9 161 3.90.960.10
af_Q2G0A0_1_158_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9287 1 159 3.90.960.10
af_Q2G0A0_1_158_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9175 1 159 3.90.960.10
af_Q4DLP0_103_258_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9021 37 159 3.90.960.10
ID Description Score Start End GO Terms
AF-F4FB85-F1-model_v4 deleted 0.9991 13 161
AF-A0A6G2UW32-F1-model_v4 Cys-tRNA(Pro) deacylase 0.9988 50 161 GO:0002161
GO:0006412
GO:0016829
AF-F3LDH7-F1-model_v4 YbaK/ebsC protein 0.9918 41 161 GO:0002161
GO:0006412
GO:0016829
AF-A0A063Y2B3-F1-model_v4 Cys-tRNA(Pro) deacylase YbaK 0.9907 45 161 GO:0002161
GO:0006412
GO:0016829
AF-A0PRC1-F1-model_v4 Conserved hypothetical membrane protein 0.9893 52 161 GO:0002161
GO:0006412

Map