F366073

General Info

Members Datasets Scaffolds Average Seq Length
255 175 252 239

Family's Representative Sequence

Representative Sequence 3300053136|Ga0500559_0011791|Ga0500559_0011791_1579_2397
Length 272
Sequence MIIPLFYPIMSDIKPIRCLIVDDEPPAREVIRRYVQDVPTLLLAGECSHAVQALTFLQQQAVDLIFLDIRMPQLDGTTFLKTLKNPPKVIFTTAYAEYALEGYELDVVDYLLKPVRFDRFLKAVNKAFPVAAGSGSSALDNMPAGIVVPGMTATGFPTGSTPSFATADKSHESFVYFRADRKMQKVMLCDILYIESMKDYVKVVTRHGLIITKQSITSVEAMLSDKLFVRTHRSYIVAVDKIRSYTNELIEIDKTEIPIGKLYRNGVLKAIS

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2818991444 Filimonas endophytica 3197 Isolate Unclassified
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
59 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
90 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
91 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
92 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
93 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
96 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
102 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
103 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
104 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
105 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
106 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
107 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
108 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
109 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
110 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
111 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
112 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
115 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
120 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
121 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
122 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
123 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
124 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
125 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
126 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
127 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
128 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
129 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
130 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
131 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
132 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
133 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
134 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
135 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
136 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
137 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
138 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
139 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
140 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
141 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
142 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
143 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
144 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
145 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
146 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
147 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
148 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
149 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
150 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
151 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
152 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
153 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
154 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
155 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
159 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
160 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
161 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
162 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
163 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
164 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
165 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
166 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
167 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
168 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
169 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
170 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
171 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
172 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
173 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
174 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
175 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.82
Metatranscriptomes 0
Isolates 1.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.73
Nodule 0
Rhizoplane 0
Rhizosphere 74.12
Stem 0
Stem Tuber 0
Unclassified 12.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10051489 3300003316 Bacteria 7476
2 rootH1_10198239 3300003316 Unclassified 2501
3 rootH2_10000843 3300003320 Unclassified 4316
4 rootL2_10006836 3300003322 Bacteria 11307
5 rootL2_10057628 3300003322 Bacteria 4224
6 rootL2_10067402 3300003322 Bacteria 12689
7 rootL2_10099295 3300003322 Bacteria 2829
8 rootL2_10111482 3300003322 Bacteria 3073
9 rootL2_10169085 3300003322 Bacteria 2038
10 rootL2_10205507 3300003322 Bacteria 2622
11 rootL2_10238583 3300003322 Bacteria 5093
12 rootH1_10008937 3300003323 Bacteria 4294
13 rootH1_10014869 3300003323 Bacteria 26056
14 rootH1_10092971 3300003323 Bacteria 2312
15 rootH1_10210406 3300003323 Bacteria 1314
16 Ga0055531_10003068 3300003794 Bacteria 10803
17 Ga0065165_1002010 3300005262 Bacteria 19010
18 Ga0065712_10001748 3300005290 Bacteria 5831
19 Ga0065712_10243117 3300005290 Unclassified 979
20 Ga0070658_10221781 3300005327 Bacteria 1599
21 Ga0070676_10077648 3300005328 Bacteria 2007
22 Ga0070683_100262091 3300005329 Unclassified 1644
23 Ga0070670_100051949 3300005331 Bacteria 3519
24 Ga0070670_100205019 3300005331 Bacteria 1714
25 Ga0070677_10059945 3300005333 Bacteria 1566
26 Ga0068869_100043975 3300005334 Bacteria 3210
27 Ga0070666_10042072 3300005335 Bacteria 3055
28 Ga0070680_100364704 3300005336 Bacteria 1229
29 Ga0070660_100613995 3300005339 Unclassified 910
30 Ga0070668_100037939 3300005347 Bacteria 3681
31 Ga0070668_100602684 3300005347 Bacteria 961
32 Ga0070675_100025631 3300005354 Bacteria 4728
33 Ga0070675_100058115 3300005354 Bacteria 3190
34 Ga0070675_100064614 3300005354 Bacteria 3025
35 Ga0070674_100038312 3300005356 Bacteria 3230
36 Ga0070674_100045589 3300005356 Bacteria 2996
37 Ga0070674_100113959 3300005356 Bacteria 1990
38 Ga0070673_100081677 3300005364 Bacteria 2621
39 Ga0070688_100032661 3300005365 Bacteria 3140
40 Ga0070667_100021148 3300005367 Bacteria 5405
41 Ga0070667_100147519 3300005367 Bacteria 2064
42 Ga0070678_100032433 3300005456 Bacteria 3616
43 Ga0070662_100337681 3300005457 Bacteria 1232
44 Ga0068853_100344517 3300005539 Bacteria 1385
45 Ga0070672_100004307 3300005543 Bacteria 9309
46 Ga0070665_100007817 3300005548 Bacteria 10856
47 Ga0070665_100770586 3300005548 Bacteria 975
48 Ga0068855_100018646 3300005563 Bacteria 8345
49 Ga0068857_100018863 3300005577 Bacteria 6052
50 Ga0068857_100123998 3300005577 Bacteria 2327
51 Ga0068854_100038184 3300005578 Bacteria 3376
52 Ga0068856_100497088 3300005614 Bacteria 1240
53 Ga0068852_100650736 3300005616 Bacteria 1061
54 Ga0068859_100014715 3300005617 Bacteria 7862
55 Ga0068864_100573068 3300005618 Bacteria 1093
56 Ga0068860_100000053 3300005843 Bacteria 207331
57 Ga0068860_100064695 3300005843 Bacteria 3473
58 Ga0068860_100192549 3300005843 Bacteria 1974
59 Ga0075366_10047684 3300006195 Bacteria 2539
60 Ga0075366_10061859 3300006195 Bacteria 2226
61 Ga0097621_100011367 3300006237 Bacteria 6551
62 Ga0068871_100002780 3300006358 Bacteria 11953
63 Ga0097620_100014716 3300006931 Bacteria 7862
64 Ga0105240_10126044 3300009093 Bacteria 3077
65 Ga0105240_10158327 3300009093 Bacteria 2692
66 Ga0111539_10012555 3300009094 Bacteria 10616
67 Ga0114129_10000267 3300009147 Bacteria 59005
68 Ga0105241_10043279 3300009174 Bacteria 3410
69 Ga0105241_10072061 3300009174 Bacteria 2684
70 Ga0105242_10086520 3300009176 Bacteria 2630
71 Ga0105242_10831153 3300009176 Unclassified 917
72 Ga0105237_10002712 3300009545 Bacteria 21610
73 Ga0105237_10011989 3300009545 Bacteria 9158
74 Ga0105237_10073531 3300009545 Bacteria 3410
75 Ga0105239_10004144 3300010375 Bacteria 17403
76 Ga0105239_10009700 3300010375 Bacteria 10826
77 Ga0105239_10076803 3300010375 Bacteria 3674
78 Ga0105239_11288783 3300010375 Unclassified 843
79 Ga0157373_10008518 3300013100 Bacteria 7618
80 Ga0157371_10038199 3300013102 Bacteria 3435
81 Ga0157370_10075701 3300013104 Bacteria 3172
82 Ga0157374_10101737 3300013296 Bacteria 2755
83 Ga0157372_10302655 3300013307 Bacteria 1860
84 Ga0163163_10629575 3300014325 Bacteria 1136
85 Ga0157380_10000068 3300014326 Bacteria 58289
86 Ga0157380_10004329 3300014326 Bacteria 9846
87 Ga0157380_10286241 3300014326 Bacteria 1511
88 Ga0182008_10026181 3300014497 Bacteria 2958
89 Ga0157376_10214568 3300014969 Bacteria 1779
90 Ga0182007_10022156 3300015262 Bacteria 2247
91 Ga0209455_1000854 3300025272 Bacteria 16294
92 Ga0209050_1005349 3300025298 Bacteria 8128
93 Ga0209257_1000006 3300025304 Bacteria 1570111
94 Ga0207645_10000050 3300025907 Bacteria 84659
95 Ga0207643_10031824 3300025908 Bacteria 2942
96 Ga0207654_10066765 3300025911 Unclassified 2123
97 Ga0207695_10044337 3300025913 Bacteria 4731
98 Ga0207695_10752825 3300025913 Bacteria 854
99 Ga0207671_10000969 3300025914 Bacteria 35541
100 Ga0207671_10203418 3300025914 Bacteria 1547
101 Ga0207660_10267641 3300025917 Bacteria 1353
102 Ga0207681_10040112 3300025923 Bacteria 3113
103 Ga0207650_10168433 3300025925 Bacteria 1740
104 Ga0207650_10185862 3300025925 Bacteria 1658
105 Ga0207650_10485528 3300025925 Bacteria 1031
106 Ga0207659_10040818 3300025926 Bacteria 3248
107 Ga0207659_10111095 3300025926 Bacteria 2084
108 Ga0207659_10324664 3300025926 Bacteria 1271
109 Ga0207706_10095676 3300025933 Bacteria 2612
110 Ga0207686_10062774 3300025934 Bacteria 2360
111 Ga0207670_10060458 3300025936 Bacteria 2581
112 Ga0207689_10002235 3300025942 Bacteria 18142
113 Ga0207667_10016289 3300025949 Bacteria 8400
114 Ga0207668_10249173 3300025972 Bacteria 1441
115 Ga0207640_10053382 3300025981 Bacteria 2638
116 Ga0207677_10128522 3300026023 Bacteria 1919
117 Ga0207639_10299451 3300026041 Bacteria 1421
118 Ga0207702_10217880 3300026078 Bacteria 1778
119 Ga0207648_10000464 3300026089 Bacteria 45165
120 Ga0207676_10522870 3300026095 Bacteria 1130
121 Ga0207674_10173326 3300026116 Bacteria 2110
122 Ga0207674_10278797 3300026116 Bacteria 1620
123 Ga0207683_10000736 3300026121 Bacteria 29807
124 Ga0209974_10056467 3300027876 Bacteria 1325
125 Ga0268266_10145486 3300028379 Bacteria 2130
126 Ga0268265_10083155 3300028380 Bacteria 2534
127 Ga0268264_10000098 3300028381 Bacteria 229055
128 Ga0268264_10193806 3300028381 Bacteria 1854
129 Ga0268264_10922980 3300028381 Bacteria 877
130 Ga0265318_10124359 3300028577 Bacteria 948
131 Ga0307517_10000685 3300028786 Bacteria 58217
132 Ga0307511_10000137 3300030521 Bacteria 67766
133 Ga0307513_10143613 3300031456 Bacteria 2309
134 Ga0307513_10146807 3300031456 Bacteria 2275
135 Ga0307509_10020049 3300031507 Bacteria 7601
136 Ga0307509_10032681 3300031507 Bacteria 5733
137 Ga0307509_10241200 3300031507 Unclassified 1600
138 Ga0307509_10243212 3300031507 Bacteria 1590
139 Ga0307408_100024488 3300031548 Bacteria 4123
140 Ga0307508_10072529 3300031616 Bacteria 3018
141 Ga0307516_10000310 3300031730 Bacteria 63335
142 Ga0307516_10268334 3300031730 Unclassified 1394
143 Ga0307407_10413051 3300031903 Bacteria 971
144 Ga0307412_10137812 3300031911 Unclassified 1783
145 Ga0307414_10876186 3300032004 Bacteria 822
146 Ga0307415_100678673 3300032126 Bacteria 927
147 Ga0307507_10177641 3300033179 Bacteria 1529
148 Ga0439436_0000881 3300041404 Bacteria 8213
149 Ga0439439_0007829 3300041406 Bacteria 2509
150 Ga0439465_0032837 3300041413 Unclassified 1658
151 Ga0439449_0076347 3300042007 Bacteria 1235
152 Ga0439462_0001471 3300042015 Bacteria 5252
153 Ga0450918_047928 3300042531 Bacteria 775
154 Ga0451577_0062815 3300042876 Bacteria 3312
155 Ga0451577_0268261 3300042876 Bacteria 1546
156 Ga0466969_0000580 3300044656 Bacteria 19895
157 Ga0466972_0000009 3300044658 Bacteria 256374
158 Ga0466972_0000014 3300044658 Bacteria 216776
159 Ga0453683_0099370 3300044673 Bacteria 1827
160 Ga0466966_0000144 3300044684 Bacteria 45151
161 Ga0453684_0006102 3300044712 Bacteria 23238
162 Ga0453684_0077637 3300044712 Bacteria 4160
163 Ga0453684_0195825 3300044712 Bacteria 2360
164 Ga0466968_0066778 3300044735 Bacteria 1558
165 Ga0466968_0158245 3300044735 Unclassified 1044
166 Ga0466970_0003873 3300044765 Bacteria 7326
167 Ga0466957_0067493 3300044842 Bacteria 2206
168 Ga0466959_0000097 3300045049 Bacteria 55620
169 Ga0451576_0986822 3300045051 Unclassified 883
170 Ga0495638_0000005 3300046460 Bacteria 680627
171 Ga0495638_0104733 3300046460 Unclassified 1687
172 Ga0495668_0000624 3300046616 Bacteria 42812
173 Ga0495668_0002554 3300046616 Bacteria 14799
174 Ga0495611_0000180 3300046648 Bacteria 45126
175 Ga0495661_0000996 3300046665 Bacteria 25550
176 Ga0495661_0081833 3300046665 Bacteria 1860
177 Ga0495687_000006 3300047443 Bacteria 571936
178 Ga0496124_0060846 3300048927 Bacteria 3167
179 Ga0501290_007707 3300049513 Bacteria 1352
180 Ga0501291_025837 3300049514 Bacteria 964
181 Ga0501292_002725 3300049515 Unclassified 2302
182 Ga0501298_002773 3300049521 Bacteria 2679
183 Ga0501299_035192 3300049522 Bacteria 983
184 Ga0501300_001421 3300049523 Bacteria 3585
185 Ga0501198_003049 3300049649 Unclassified 2279
186 Ga0501201_000494 3300049651 Bacteria 3649
187 Ga0501202_008159 3300049652 Unclassified 1905
188 Ga0501202_018348 3300049652 Bacteria 1374
189 Ga0501206_000258 3300049653 Bacteria 6252
190 Ga0501207_002152 3300049654 Bacteria 2522
191 Ga0501217_006977 3300049661 Bacteria 2414
192 Ga0501217_020258 3300049661 Bacteria 1560
193 Ga0501217_043227 3300049661 Bacteria 1153
194 Ga0501223_001483 3300049663 Bacteria 5426
195 Ga0501228_008212 3300049666 Bacteria 994
196 Ga0501230_050704 3300049667 Bacteria 824
197 Ga0501235_002660 3300049669 Unclassified 3844
198 Ga0501235_013270 3300049669 Bacteria 1813
199 Ga0501235_031199 3300049669 Unclassified 1203
200 Ga0501236_000114 3300049670 Bacteria 7682
201 Ga0501242_002552 3300049674 Unclassified 1921
202 Ga0501242_006708 3300049674 Bacteria 1318
203 Ga0501243_057766 3300049675 Bacteria 713
204 Ga0501247_003978 3300049677 Bacteria 1602
205 Ga0501252_001998 3300049682 Unclassified 1975
206 Ga0501257_002015 3300049686 Bacteria 4231
207 Ga0501257_002836 3300049686 Bacteria 3673
208 Ga0501257_039520 3300049686 Bacteria 1155
209 Ga0501261_000500 3300049690 Bacteria 5023
210 Ga0501261_009033 3300049690 Unclassified 1296
211 Ga0501221_000135 3300049704 Bacteria 9529
212 Ga0501225_0001203 3300049705 Bacteria 8069
213 Ga0501225_0007123 3300049705 Bacteria 3249
214 Ga0501245_000926 3300049708 Unclassified 3734
215 Ga0501245_002472 3300049708 Unclassified 2470
216 Ga0501241_035892 3300049758 Bacteria 949
217 Ga0501264_000216 3300049761 Bacteria 9346
218 Ga0501264_006433 3300049761 Unclassified 1082
219 Ga0501271_000529 3300049768 Bacteria 3312
220 Ga0501212_001628 3300049851 Bacteria 2562
221 Ga0501212_017161 3300049851 Unclassified 1093
222 nmdc:mga0k408_42052_c1 3300050493 Bacteria 2632
223 nmdc:mga05p37_13392_c1 3300050507 Bacteria 9830
224 nmdc:mga08y16_28606_c1 3300050511 Bacteria 5875
225 nmdc:mga08y16_325198_c1 3300050511 Unclassified 1582
226 Ga0500578_0000026 3300053086 Bacteria 145328
227 Ga0500644_0067452 3300053088 Bacteria 1279
228 Ga0500646_0006606 3300053090 Bacteria 2952
229 Ga0500646_0066428 3300053090 Unclassified 1073
230 Ga0500583_0000001 3300053092 Bacteria 241642
231 Ga0500583_0000049 3300053092 Bacteria 77456
232 Ga0500583_0030620 3300053092 Bacteria 2358
233 Ga0500650_0046675 3300053098 Bacteria 2007
234 Ga0500555_044333 3300053103 Unclassified 1231
235 Ga0500555_049207 3300053103 Bacteria 1156
236 Ga0500572_121710 3300053111 Bacteria 845
237 Ga0500655_070196 3300053133 Bacteria 713
238 Ga0500658_0024675 3300053134 Bacteria 2305
239 Ga0500559_0011791 3300053136 Bacteria 3727
240 Ga0500559_0287465 3300053136 Unclassified 773
241 Ga0500568_0000088 3300053139 Bacteria 89215
242 Ga0500588_0065155 3300053146 Bacteria 1179
243 Ga0500589_154325 3300053147 Unclassified 931
244 Ga0500616_0000003 3300053153 Bacteria 1220687
245 Ga0500616_0035752 3300053153 Bacteria 2700
246 Ga0500616_0066326 3300053153 Bacteria 1854
247 Ga0500619_080498 3300053154 Unclassified 1093
248 Ga0500622_0012582 3300053156 Bacteria 4581
249 Ga0500622_0029611 3300053156 Bacteria 2878
250 Ga0500622_0064488 3300053156 Bacteria 1863
251 Ga0500636_0023780 3300053177 Bacteria 3622
252 Ga0500645_020974 3300053730 Bacteria 2019

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053133 Ga0500655_070196 Ga0500655_070196_73_672 191
2 3300049521 Ga0501298_002773 Ga0501298_002773_39_635 197
3 3300053146 Ga0500588_0065155 Ga0500588_0065155_566_1159 197
4 3300049675 Ga0501243_057766 Ga0501243_057766_32_664 208
5 3300053136 Ga0500559_0287465 Ga0500559_0287465_28_660 209
6 3300005290 Ga0065712_10243117 Ga0065712_102431172 214
7 3300005331 Ga0070670_100205019 Ga0070670_1002050192 214
8 3300005354 Ga0070675_100025631 Ga0070675_1000256316 214
9 3300025925 Ga0207650_10185862 Ga0207650_101858622 214
10 3300025926 Ga0207659_10111095 Ga0207659_101110952 214
11 3300031730 Ga0307516_10268334 Ga0307516_102683342 216
12 3300044842 Ga0466957_0067493 Ga0466957_0067493_1108_1830 216
13 3300025936 Ga0207670_10060458 Ga0207670_100604581 217
14 3300046460 Ga0495638_0000005 Ga0495638_0000005_338207_338938 217
15 3300044658 Ga0466972_0000014 Ga0466972_0000014_192980_193681 220
16 3300044735 Ga0466968_0158245 Ga0466968_0158245_64_765 220
17 3300044765 Ga0466970_0003873 Ga0466970_0003873_3760_4461 220
18 3300005618 Ga0068864_100573068 Ga0068864_1005730682 222
19 3300026095 Ga0207676_10522870 Ga0207676_105228702 222
20 3300003322 rootL2_10067402 rootL2_100674023 224
21 3300049513 Ga0501290_007707 Ga0501290_007707_250_927 224
22 3300053730 Ga0500645_020974 Ga0500645_020974_574_1308 224
23 3300010375 Ga0105239_11288783 Ga0105239_112887831 225
24 3300046616 Ga0495668_0002554 Ga0495668_0002554_9755_10456 226
25 3300053153 Ga0500616_0066326 Ga0500616_0066326_425_1129 226
26 3300003316 rootH1_10198239 rootH1_101982393 227
27 3300003320 rootH2_10000843 rootH2_100008433 227
28 3300003322 rootL2_10006836 rootL2_100068367 227
29 3300044712 Ga0453684_0006102 Ga0453684_0006102_19988_20695 227
30 3300049851 Ga0501212_001628 Ga0501212_001628_1612_2298 227
31 iso_pu_bacteria 2818991444 2819590314 227
32 3300042876 Ga0451577_0268261 Ga0451577_0268261_808_1509 228
33 3300049514 Ga0501291_025837 Ga0501291_025837_157_846 228
34 3300049666 Ga0501228_008212 Ga0501228_008212_283_972 228
35 3300049674 Ga0501242_006708 Ga0501242_006708_122_811 228
36 iso_pu_bacteria 2818991444 2819588504 228
37 3300003794 Ga0055531_10003068 Ga0055531_100030687 230
38 3300005347 Ga0070668_100602684 Ga0070668_1006026842 230
39 3300005843 Ga0068860_100000053 Ga0068860_100000053137 230
40 3300009545 Ga0105237_10002712 Ga0105237_1000271217 230
41 3300014497 Ga0182008_10026181 Ga0182008_100261812 230
42 3300015262 Ga0182007_10022156 Ga0182007_100221562 230
43 3300025304 Ga0209257_1000006 Ga0209257_10000061017 230
44 3300025914 Ga0207671_10000969 Ga0207671_100009692 230
45 3300028381 Ga0268264_10000098 Ga0268264_10000098135 230
46 3300028577 Ga0265318_10124359 Ga0265318_101243591 230
47 3300031548 Ga0307408_100024488 Ga0307408_1000244881 230
48 3300046665 Ga0495661_0000996 Ga0495661_0000996_16494_17213 230
49 3300049670 Ga0501236_000114 Ga0501236_000114_2881_3600 230
50 3300049686 Ga0501257_002015 Ga0501257_002015_2984_3703 230
51 3300050511 nmdc:mga08y16_325198_c1 nmdc:mga08y16_325198_c1_855_1559 230
52 3300053092 Ga0500583_0030620 Ga0500583_0030620_1219_1920 230
53 3300053156 Ga0500622_0012582 Ga0500622_0012582_2055_2756 230
54 3300003322 rootL2_10057628 rootL2_100576282 231
55 3300003322 rootL2_10205507 rootL2_102055072 231
56 3300005356 Ga0070674_100045589 Ga0070674_1000455892 231
57 3300009093 Ga0105240_10126044 Ga0105240_101260443 231
58 3300009094 Ga0111539_10012555 Ga0111539_100125553 231
59 3300009174 Ga0105241_10043279 Ga0105241_100432793 231
60 3300009176 Ga0105242_10831153 Ga0105242_108311531 231
61 3300009545 Ga0105237_10073531 Ga0105237_100735314 231
62 3300010375 Ga0105239_10004144 Ga0105239_1000414417 231
63 3300025272 Ga0209455_1000854 Ga0209455_100085412 231
64 3300025298 Ga0209050_1005349 Ga0209050_10053492 231
65 3300025913 Ga0207695_10044337 Ga0207695_100443372 231
66 3300025913 Ga0207695_10752825 Ga0207695_107528251 231
67 3300025914 Ga0207671_10203418 Ga0207671_102034182 231
68 3300031456 Ga0307513_10143613 Ga0307513_101436133 231
69 3300031507 Ga0307509_10243212 Ga0307509_102432121 231
70 3300042876 Ga0451577_0062815 Ga0451577_0062815_2195_2926 231
71 3300044673 Ga0453683_0099370 Ga0453683_0099370_253_984 231
72 3300045051 Ga0451576_0986822 Ga0451576_0986822_71_793 231
73 3300046648 Ga0495611_0000180 Ga0495611_0000180_2090_2818 231
74 3300047443 Ga0495687_000006 Ga0495687_000006_375551_376267 231
75 3300048927 Ga0496124_0060846 Ga0496124_0060846_810_1514 231
76 3300049523 Ga0501300_001421 Ga0501300_001421_1317_2051 231
77 3300049661 Ga0501217_006977 Ga0501217_006977_1485_2219 231
78 3300049677 Ga0501247_003978 Ga0501247_003978_289_1023 231
79 3300049761 Ga0501264_000216 Ga0501264_000216_926_1651 231
80 3300049768 Ga0501271_000529 Ga0501271_000529_2097_2831 231
81 3300050511 nmdc:mga08y16_28606_c1 nmdc:mga08y16_28606_c1_2116_2844 231
82 3300053090 Ga0500646_0066428 Ga0500646_0066428_231_938 231
83 3300053092 Ga0500583_0000049 Ga0500583_0000049_42140_42844 231
84 3300053103 Ga0500555_044333 Ga0500555_044333_142_849 231
85 3300053147 Ga0500589_154325 Ga0500589_154325_172_879 231
86 3300053153 Ga0500616_0000003 Ga0500616_0000003_886193_886924 231
87 3300005577 Ga0068857_100123998 Ga0068857_1001239983 232
88 3300014325 Ga0163163_10629575 Ga0163163_106295751 232
89 3300014326 Ga0157380_10286241 Ga0157380_102862412 232
90 3300025926 Ga0207659_10324664 Ga0207659_103246641 232
91 3300046665 Ga0495661_0081833 Ga0495661_0081833_1043_1771 232
92 3300049652 Ga0501202_008159 Ga0501202_008159_1107_1832 232
93 3300049669 Ga0501235_002660 Ga0501235_002660_2068_2793 232
94 3300049669 Ga0501235_031199 Ga0501235_031199_401_1126 232
95 3300049674 Ga0501242_002552 Ga0501242_002552_654_1379 232
96 3300049690 Ga0501261_009033 Ga0501261_009033_518_1243 232
97 3300049708 Ga0501245_000926 Ga0501245_000926_2215_2940 232
98 3300049761 Ga0501264_006433 Ga0501264_006433_232_957 232
99 3300049851 Ga0501212_017161 Ga0501212_017161_316_1041 232
100 3300003322 rootL2_10238583 rootL2_102385832 233
101 3300005327 Ga0070658_10221781 Ga0070658_102217812 233
102 3300005329 Ga0070683_100262091 Ga0070683_1002620912 233
103 3300005339 Ga0070660_100613995 Ga0070660_1006139951 233
104 3300005356 Ga0070674_100038312 Ga0070674_1000383123 233
105 3300013102 Ga0157371_10038199 Ga0157371_100381993 233
106 3300013104 Ga0157370_10075701 Ga0157370_100757012 233
107 3300003322 rootL2_10111482 rootL2_101114822 234
108 3300003323 rootH1_10008937 rootH1_100089372 234
109 3300003323 rootH1_10092971 rootH1_100929712 234
110 3300005262 Ga0065165_1002010 Ga0065165_10020103 234
111 3300005336 Ga0070680_100364704 Ga0070680_1003647042 234
112 3300013100 Ga0157373_10008518 Ga0157373_100085188 234
113 3300025917 Ga0207660_10267641 Ga0207660_102676411 234
114 3300027876 Ga0209974_10056467 Ga0209974_100564672 234
115 3300005456 Ga0070678_100032433 Ga0070678_1000324333 235
116 3300044712 Ga0453684_0077637 Ga0453684_0077637_673_1398 235
117 3300053153 Ga0500616_0035752 Ga0500616_0035752_1480_2211 235
118 3300053156 Ga0500622_0029611 Ga0500622_0029611_1796_2527 235
119 3300014326 Ga0157380_10000068 Ga0157380_1000006823 236
120 3300032004 Ga0307414_10876186 Ga0307414_108761861 236
121 3300049661 Ga0501217_043227 Ga0501217_043227_340_1056 236
122 3300049686 Ga0501257_039520 Ga0501257_039520_72_788 236
123 3300003322 rootL2_10099295 rootL2_100992952 237
124 3300005548 Ga0070665_100770586 Ga0070665_1007705861 237
125 3300030521 Ga0307511_10000137 Ga0307511_1000013750 237
126 3300041413 Ga0439465_0032837 Ga0439465_0032837_537_1250 237
127 3300042531 Ga0450918_047928 Ga0450918_047928_28_753 237
128 3300046460 Ga0495638_0104733 Ga0495638_0104733_737_1462 237
129 3300005290 Ga0065712_10001748 Ga0065712_100017482 238
130 3300005328 Ga0070676_10077648 Ga0070676_100776482 238
131 3300005331 Ga0070670_100051949 Ga0070670_1000519493 238
132 3300005333 Ga0070677_10059945 Ga0070677_100599451 238
133 3300005334 Ga0068869_100043975 Ga0068869_1000439751 238
134 3300005335 Ga0070666_10042072 Ga0070666_100420722 238
135 3300005347 Ga0070668_100037939 Ga0070668_1000379392 238
136 3300005354 Ga0070675_100058115 Ga0070675_1000581152 238
137 3300005354 Ga0070675_100064614 Ga0070675_1000646142 238
138 3300005356 Ga0070674_100113959 Ga0070674_1001139592 238
139 3300005364 Ga0070673_100081677 Ga0070673_1000816772 238
140 3300005365 Ga0070688_100032661 Ga0070688_1000326613 238
141 3300005367 Ga0070667_100021148 Ga0070667_1000211482 238
142 3300005367 Ga0070667_100147519 Ga0070667_1001475192 238
143 3300005457 Ga0070662_100337681 Ga0070662_1003376812 238
144 3300005543 Ga0070672_100004307 Ga0070672_10000430713 238
145 3300005548 Ga0070665_100007817 Ga0070665_1000078179 238
146 3300005578 Ga0068854_100038184 Ga0068854_1000381842 238
147 3300005616 Ga0068852_100650736 Ga0068852_1006507362 238
148 3300005617 Ga0068859_100014715 Ga0068859_1000147158 238
149 3300005843 Ga0068860_100064695 Ga0068860_1000646951 238
150 3300006237 Ga0097621_100011367 Ga0097621_1000113677 238
151 3300006358 Ga0068871_100002780 Ga0068871_1000027804 238
152 3300006931 Ga0097620_100014716 Ga0097620_1000147162 238
153 3300009176 Ga0105242_10086520 Ga0105242_100865203 238
154 3300009545 Ga0105237_10011989 Ga0105237_100119897 238
155 3300010375 Ga0105239_10076803 Ga0105239_100768032 238
156 3300013307 Ga0157372_10302655 Ga0157372_103026552 238
157 3300014326 Ga0157380_10004329 Ga0157380_100043293 238
158 3300014969 Ga0157376_10214568 Ga0157376_102145682 238
159 3300025907 Ga0207645_10000050 Ga0207645_1000005032 238
160 3300025908 Ga0207643_10031824 Ga0207643_100318242 238
161 3300025923 Ga0207681_10040112 Ga0207681_100401122 238
162 3300025925 Ga0207650_10168433 Ga0207650_101684331 238
163 3300025925 Ga0207650_10485528 Ga0207650_104855282 238
164 3300025926 Ga0207659_10040818 Ga0207659_100408183 238
165 3300025933 Ga0207706_10095676 Ga0207706_100956763 238
166 3300025934 Ga0207686_10062774 Ga0207686_100627742 238
167 3300025942 Ga0207689_10002235 Ga0207689_1000223512 238
168 3300025972 Ga0207668_10249173 Ga0207668_102491732 238
169 3300025981 Ga0207640_10053382 Ga0207640_100533822 238
170 3300026023 Ga0207677_10128522 Ga0207677_101285222 238
171 3300026041 Ga0207639_10299451 Ga0207639_102994512 238
172 3300026089 Ga0207648_10000464 Ga0207648_1000046421 238
173 3300026116 Ga0207674_10173326 Ga0207674_101733262 238
174 3300026121 Ga0207683_10000736 Ga0207683_1000073618 238
175 3300028379 Ga0268266_10145486 Ga0268266_101454862 238
176 3300028380 Ga0268265_10083155 Ga0268265_100831552 238
177 3300028381 Ga0268264_10193806 Ga0268264_101938062 238
178 3300031507 Ga0307509_10032681 Ga0307509_100326813 238
179 3300031507 Ga0307509_10241200 Ga0307509_102412002 238
180 3300031616 Ga0307508_10072529 Ga0307508_100725292 238
181 3300031730 Ga0307516_10000310 Ga0307516_1000031051 238
182 3300031903 Ga0307407_10413051 Ga0307407_104130512 238
183 3300031911 Ga0307412_10137812 Ga0307412_101378122 238
184 3300032126 Ga0307415_100678673 Ga0307415_1006786731 238
185 3300033179 Ga0307507_10177641 Ga0307507_101776412 238
186 3300049515 Ga0501292_002725 Ga0501292_002725_1422_2141 238
187 3300049522 Ga0501299_035192 Ga0501299_035192_233_952 238
188 3300049649 Ga0501198_003049 Ga0501198_003049_530_1249 238
189 3300049651 Ga0501201_000494 Ga0501201_000494_2367_3086 238
190 3300049652 Ga0501202_018348 Ga0501202_018348_505_1224 238
191 3300049653 Ga0501206_000258 Ga0501206_000258_3729_4448 238
192 3300049654 Ga0501207_002152 Ga0501207_002152_1135_1854 238
193 3300049661 Ga0501217_020258 Ga0501217_020258_72_791 238
194 3300049663 Ga0501223_001483 Ga0501223_001483_643_1362 238
195 3300049667 Ga0501230_050704 Ga0501230_050704_64_783 238
196 3300049669 Ga0501235_013270 Ga0501235_013270_417_1136 238
197 3300049682 Ga0501252_001998 Ga0501252_001998_138_857 238
198 3300049686 Ga0501257_002836 Ga0501257_002836_138_857 238
199 3300049690 Ga0501261_000500 Ga0501261_000500_612_1331 238
200 3300049704 Ga0501221_000135 Ga0501221_000135_5407_6126 238
201 3300049705 Ga0501225_0007123 Ga0501225_0007123_120_839 238
202 3300049708 Ga0501245_002472 Ga0501245_002472_1031_1750 238
203 3300049758 Ga0501241_035892 Ga0501241_035892_220_939 238
204 3300053139 Ga0500568_0000088 Ga0500568_0000088_38472_39191 238
205 3300044712 Ga0453684_0195825 Ga0453684_0195825_1602_2342 239
206 iso_pu_bacteria 2738541278 2738725261 239
207 3300046616 Ga0495668_0000624 Ga0495668_0000624_29133_29906 240
208 3300003322 rootL2_10169085 rootL2_101690852 241
209 3300003323 rootH1_10014869 rootH1_100148697 241
210 3300005539 Ga0068853_100344517 Ga0068853_1003445172 242
211 3300005563 Ga0068855_100018646 Ga0068855_1000186461 242
212 3300005577 Ga0068857_100018863 Ga0068857_1000188632 242
213 3300005614 Ga0068856_100497088 Ga0068856_1004970882 242
214 3300006195 Ga0075366_10047684 Ga0075366_100476842 242
215 3300009093 Ga0105240_10158327 Ga0105240_101583273 242
216 3300009147 Ga0114129_10000267 Ga0114129_1000026741 242
217 3300009174 Ga0105241_10072061 Ga0105241_100720612 242
218 3300010375 Ga0105239_10009700 Ga0105239_100097002 242
219 3300025911 Ga0207654_10066765 Ga0207654_100667652 242
220 3300025949 Ga0207667_10016289 Ga0207667_1001628910 242
221 3300026078 Ga0207702_10217880 Ga0207702_102178802 242
222 3300026116 Ga0207674_10278797 Ga0207674_102787972 242
223 3300028786 Ga0307517_10000685 Ga0307517_1000068530 242
224 3300044656 Ga0466969_0000580 Ga0466969_0000580_3667_4395 242
225 3300044684 Ga0466966_0000144 Ga0466966_0000144_10728_11456 242
226 3300044735 Ga0466968_0066778 Ga0466968_0066778_20_748 242
227 3300045049 Ga0466959_0000097 Ga0466959_0000097_6748_7476 242
228 3300050507 nmdc:mga05p37_13392_c1 nmdc:mga05p37_13392_c1_119_847 242
229 3300053136 Ga0500559_0011791 Ga0500559_0011791_1579_2397 242
230 3300003316 rootH1_10051489 rootH1_100514897 243
231 3300003323 rootH1_10210406 rootH1_102104062 243
232 3300005843 Ga0068860_100192549 Ga0068860_1001925492 243
233 3300006195 Ga0075366_10061859 Ga0075366_100618591 243
234 3300013296 Ga0157374_10101737 Ga0157374_101017374 243
235 3300028381 Ga0268264_10922980 Ga0268264_109229801 243
236 3300031456 Ga0307513_10146807 Ga0307513_101468072 243
237 3300031507 Ga0307509_10020049 Ga0307509_100200492 243
238 3300041404 Ga0439436_0000881 Ga0439436_0000881_7281_8015 243
239 3300041406 Ga0439439_0007829 Ga0439439_0007829_15_749 243
240 3300042007 Ga0439449_0076347 Ga0439449_0076347_51_785 243
241 3300042015 Ga0439462_0001471 Ga0439462_0001471_681_1415 243
242 3300044658 Ga0466972_0000009 Ga0466972_0000009_30131_30862 243
243 3300049705 Ga0501225_0001203 Ga0501225_0001203_178_912 243
244 3300050493 nmdc:mga0k408_42052_c1 nmdc:mga0k408_42052_c1_404_1138 243
245 3300053086 Ga0500578_0000026 Ga0500578_0000026_22166_22897 243
246 3300053088 Ga0500644_0067452 Ga0500644_0067452_467_1198 243
247 3300053090 Ga0500646_0006606 Ga0500646_0006606_1279_2010 243
248 3300053092 Ga0500583_0000001 Ga0500583_0000001_234493_235224 243
249 3300053098 Ga0500650_0046675 Ga0500650_0046675_672_1403 243
250 3300053103 Ga0500555_049207 Ga0500555_049207_204_935 243
251 3300053111 Ga0500572_121710 Ga0500572_121710_37_768 243
252 3300053134 Ga0500658_0024675 Ga0500658_0024675_40_771 243
253 3300053154 Ga0500619_080498 Ga0500619_080498_105_839 243
254 3300053156 Ga0500622_0064488 Ga0500622_0064488_599_1330 243
255 3300053177 Ga0500636_0023780 Ga0500636_0023780_2026_2757 243

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

18

125

0.94

PF04397

LytTR

LytTr DNA-binding domain

181

272

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m8o-assembly1.cif.gz_A crystal structure of the receiver domain of lytr from staphylococcus aureus 0.8981 7 119
5vxn-assembly2.cif.gz_C structure of two rcsb dimers bound to two parallel dnas. 0.8969 6 115
6zj2-assembly3.cif.gz_M structure of rcsb from salmonella enterica serovar typhimurium bound to promoter rpra in the presence of phosphomimetic bef3- 0.8961 6 115
5w43-assembly1.cif.gz_B structure of the two-component response regulator rcsb-dna complex 0.8954 6 115
5uxv-assembly2.cif.gz_B crystal structure of anti-anti-sigma factor phyr i40v/s51c mutant from bartonella quintana 0.8913 6 118
ID Description Score Start End Superfamily
af_P60611_135_244_2.40.50.1020 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);LytTr DNA-binding domain 0.9471 142 241 2.40.50.1020
af_P0AFT5_1_126_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9286 6 118 3.40.50.2300
af_P0AGA6_2_194_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9062 7 116 3.40.50.2300
af_P0AE39_136_205_2.40.50.40 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.9058 144 211 2.40.50.40
6m8oA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8981 7 119 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A350CUC1-F1-model_v4 DNA-binding response regulator 0.985 6 72 GO:0000160
GO:0003677
AF-A0A1J5SZP7-F1-model_v4 LytTr DNA-binding domain protein 0.9733 144 242 GO:0000156
GO:0003677
AF-A0A4Q3FDX0-F1-model_v4 Response regulator 0.9649 6 84 GO:0000160
AF-A0A4Q5YEC4-F1-model_v4 Response regulator 0.9551 7 121 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A4Q3FDX0-F1-model_v4 Response regulator 0.9532 6 84 GO:0000160

Feature Viewer

pLDDT pTM Quality
85.33 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map