F365995

General Info

Members Datasets Scaffolds Average Seq Length
255 192 209 277

Family's Representative Sequence

Representative Sequence 3300048913|Ga0496110_0152907|Ga0496110_0152907_930_2018
Length 336
Sequence VDSSADAGRIRLRLDLSYDGTDFSGWASQPARRTVAGTLTDALQVLLRHPVQLVVAGRTDAGVHASGQVAHVDVAPDALRALAPRHTTRAAGDRANPLDRTSDATRDTPAGQNGAAATAQDPPGEPLRVVPAVAEAEPLGDSLEGRSGLLRRLAGLLAPDLRVREITLAPTGFDARFAALRRHYRYRIGTAEWGVEPPDRLYVLARRRAMDTEAMSRAAAALIGLHDFAAFCRPREGATTTRELQSLTVTRLGHEIHIDVVADAFCHSMVRALVGSLMAVGEGRDPIDRPSQLLASGLRTSGIHVAPAHGLILRAVDYPPDDELARRAEQTRARRP

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
3 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
4 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
5 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
6 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
7 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
8 2643221576 Nocardioides sp. Root614 Isolate Unclassified
9 2643221590 Nocardioides sp. Root682 Isolate Unclassified
10 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
11 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
12 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
13 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
14 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
15 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
16 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
17 2855683550 Micromonospora sp. RP3T Isolate Unclassified
18 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
19 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
20 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
21 2858868258 Micromonospora sp. MH33 Isolate Unclassified
22 2858882152 Micromonospora noduli MED15 Isolate Nodule
23 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
24 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
25 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
26 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
27 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
28 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
29 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
30 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
31 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
32 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
33 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
34 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
35 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
36 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
37 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
38 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
39 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
40 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
41 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
42 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
48 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
95 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
96 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
101 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
102 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
103 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
114 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
115 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
116 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
117 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
124 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
125 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
126 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
127 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
128 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
129 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
130 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
131 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
132 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
133 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
134 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
140 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
143 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
158 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
159 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
160 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
161 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
162 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
163 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
164 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
165 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
166 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
172 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
173 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
174 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
175 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
176 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
177 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
178 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
179 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
180 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
181 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
182 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
183 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
184 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
185 649633069 Micromonospora sp. L5 Isolate Unclassified
186 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
187 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
188 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
189 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
190 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
191 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
192 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.96
Metatranscriptomes 0
Isolates 18.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.84
Nodule 2.35
Rhizoplane 14.51
Rhizosphere 47.84
Stem 0
Stem Tuber 0
Unclassified 27.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055540_1006390 3300003792 Bacteria 4686
2 Ga0055540_1025035 3300003792 Bacteria 1469
3 Ga0070658_10007171 3300005327 Bacteria 9004
4 Ga0070658_10086548 3300005327 Bacteria 2578
5 Ga0070666_10197126 3300005335 Bacteria 1416
6 Ga0070682_100116597 3300005337 Bacteria 1787
7 Ga0070668_100049240 3300005347 Bacteria 3242
8 Ga0070668_100066043 3300005347 Bacteria 2806
9 Ga0070674_100363569 3300005356 Bacteria 1172
10 Ga0070667_100017797 3300005367 Bacteria 5890
11 Ga0070714_100000013 3300005435 Bacteria 211756
12 Ga0070714_100215572 3300005435 Bacteria 1762
13 Ga0070713_100134446 3300005436 Bacteria 2184
14 Ga0070710_10255068 3300005437 Bacteria 1129
15 Ga0070684_100433625 3300005535 Bacteria 1214
16 Ga0070664_100052830 3300005564 Bacteria 3443
17 Ga0068856_100045093 3300005614 Bacteria 4340
18 Ga0068861_100100196 3300005719 Bacteria 2302
19 Ga0068863_100087950 3300005841 Bacteria 2944
20 Ga0068862_100033085 3300005844 Bacteria 4367
21 Ga0081539_10001279 3300005985 Bacteria 44286
22 Ga0081539_10003532 3300005985 Bacteria 19014
23 Ga0081539_10048313 3300005985 Bacteria 2421
24 Ga0070717_10109669 3300006028 Bacteria 2353
25 Ga0075365_10117250 3300006038 Bacteria 1834
26 Ga0075363_100013208 3300006048 Bacteria 3996
27 Ga0075364_10008222 3300006051 Bacteria 6229
28 Ga0075369_10058031 3300006186 Bacteria 1685
29 Ga0068871_100077172 3300006358 Bacteria 2753
30 Ga0075428_100110272 3300006844 Bacteria 2998
31 Ga0075428_100150112 3300006844 Bacteria 2532
32 Ga0105240_10066736 3300009093 Bacteria 4462
33 Ga0105240_10560102 3300009093 Bacteria 1263
34 Ga0105245_10497619 3300009098 Bacteria 1235
35 Ga0105247_10287503 3300009101 Bacteria 1136
36 Ga0105238_10420037 3300009551 Bacteria 1332
37 Ga0105239_10003769 3300010375 Bacteria 18441
38 Ga0105246_10281224 3300011119 Bacteria 1335
39 Ga0157372_10005740 3300013307 Bacteria 13218
40 Ga0157375_10244747 3300013308 Bacteria 1953
41 Ga0157375_10964258 3300013308 Bacteria 994
42 Ga0163163_10726640 3300014325 Bacteria 1056
43 Ga0157379_10038829 3300014968 Bacteria 4247
44 Ga0157376_10122899 3300014969 Bacteria 2304
45 Ga0163161_10349559 3300017792 Bacteria 1175
46 Ga0213876_10001123 3300021384 Bacteria 17054
47 Ga0213875_10021512 3300021388 Bacteria 3089
48 Ga0213875_10057142 3300021388 Bacteria 1828
49 Ga0209051_1001558 3300025303 Bacteria 18956
50 Ga0209051_1004662 3300025303 Bacteria 8349
51 Ga0207705_10010110 3300025909 Bacteria 6869
52 Ga0207705_10063756 3300025909 Bacteria 2663
53 Ga0207695_10059568 3300025913 Bacteria 3958
54 Ga0207695_10398361 3300025913 Bacteria 1261
55 Ga0207650_10125806 3300025925 Bacteria 2001
56 Ga0207687_10077296 3300025927 Bacteria 2393
57 Ga0207664_10000001 3300025929 Bacteria 724213
58 Ga0207664_10090630 3300025929 Bacteria 2506
59 Ga0207669_10448456 3300025937 Bacteria 1022
60 Ga0207665_10430005 3300025939 Bacteria 1010
61 Ga0207668_10083246 3300025972 Bacteria 2327
62 Ga0207658_10099684 3300025986 Bacteria 2273
63 Ga0207678_10096195 3300026067 Bacteria 2530
64 Ga0207702_10022623 3300026078 Bacteria 5213
65 Ga0207641_10071181 3300026088 Bacteria 2990
66 Ga0207641_10355169 3300026088 Bacteria 1398
67 Ga0207676_10234143 3300026095 Bacteria 1644
68 Ga0207675_100143329 3300026118 Bacteria 2271
69 Ga0207683_10060760 3300026121 Bacteria 3323
70 Ga0268265_10037136 3300028380 Bacteria 3573
71 Ga0307515_10052633 3300028794 Bacteria 6032
72 Ga0307515_10101839 3300028794 Bacteria 3461
73 Ga0307515_10108372 3300028794 Bacteria 3273
74 Ga0307512_10061731 3300030522 Bacteria 2883
75 Ga0265327_10001834 3300031251 Bacteria 24762
76 Ga0265327_10004321 3300031251 Bacteria 12669
77 Ga0307513_10024355 3300031456 Bacteria 7042
78 Ga0307513_10074070 3300031456 Bacteria 3543
79 Ga0307513_10211341 3300031456 Bacteria 1771
80 Ga0307509_10031033 3300031507 Bacteria 5906
81 Ga0307408_100036868 3300031548 Bacteria 3440
82 Ga0307508_10030740 3300031616 Bacteria 4853
83 Ga0307508_10194976 3300031616 Bacteria 1627
84 Ga0307514_10248891 3300031649 Bacteria 1055
85 Ga0316576_10001505 3300031727 Bacteria 12590
86 Ga0307516_10013922 3300031730 Bacteria 8535
87 Ga0307516_10046233 3300031730 Bacteria 4296
88 Ga0307516_10060752 3300031730 Bacteria 3670
89 Ga0307516_10075709 3300031730 Bacteria 3219
90 Ga0307516_10322377 3300031730 Bacteria 1216
91 Ga0307405_10131677 3300031731 Bacteria 1729
92 Ga0307413_10037748 3300031824 Bacteria 2793
93 Ga0307406_10004670 3300031901 Bacteria 7462
94 Ga0307412_10160642 3300031911 Bacteria 1669
95 Ga0307409_100008694 3300031995 Bacteria 6183
96 Ga0307416_100041034 3300032002 Bacteria 3601
97 Ga0307414_10317979 3300032004 Bacteria 1324
98 Ga0307411_10291546 3300032005 Bacteria 1304
99 Ga0307415_100015068 3300032126 Bacteria 4566
100 Ga0307415_100712534 3300032126 Bacteria 907
101 Ga0307507_10049489 3300033179 Bacteria 4071
102 Ga0307507_10255960 3300033179 Bacteria 1124
103 Ga0373940_0000542 3300035088 Bacteria 5958
104 Ga0373942_0000550 3300035207 Bacteria 10555
105 Ga0373962_0017542 3300035242 Bacteria 1856
106 Ga0316574_0000119 3300035398 Bacteria 24097
107 Ga0373935_0025143 3300035692 Bacteria 3669
108 Ga0373925_0410853 3300037068 Bacteria 1105
109 Ga0436364_1001100 3300037853 Bacteria 6115
110 Ga0436364_1112074 3300037853 Bacteria 9456
111 Ga0395901_0011246 3300038443 Bacteria 9067
112 Ga0436365_0484364 3300039437 Bacteria 53953
113 Ga0436365_0780150 3300039437 Bacteria 1504
114 Ga0436365_0784584 3300039437 Bacteria 778
115 Ga0436363_1218883 3300039450 Bacteria 1360
116 Ga0451791_0197792 3300041451 Bacteria 4238
117 Ga0451793_1287167 3300041452 Bacteria 6071
118 Ga0451797_0877449 3300041453 Bacteria 1120
119 Ga0451802_1477580 3300041460 Bacteria 1368
120 Ga0466972_0006314 3300044658 Bacteria 5954
121 Ga0466972_0052065 3300044658 Bacteria 1974
122 Ga0466965_0001455 3300044683 Bacteria 9563
123 Ga0466966_0015125 3300044684 Bacteria 5104
124 Ga0466966_0075907 3300044684 Bacteria 2099
125 Ga0466961_0003534 3300044693 Bacteria 9753
126 Ga0466961_0078088 3300044693 Bacteria 2097
127 Ga0466961_0272618 3300044693 Bacteria 1036
128 Ga0466971_0005377 3300044719 Bacteria 5554
129 Ga0466968_0000681 3300044735 Bacteria 11690
130 Ga0466968_0005888 3300044735 Bacteria 4602
131 Ga0466970_0001829 3300044765 Bacteria 10272
132 Ga0466970_0069391 3300044765 Bacteria 1894
133 Ga0466957_0002166 3300044842 Bacteria 10516
134 Ga0466959_0008129 3300045049 Bacteria 7401
135 Ga0466959_0019686 3300045049 Bacteria 4965
136 Ga0466958_0024416 3300045836 Bacteria 3557
137 Ga0466967_0045074 3300045976 Bacteria 3830
138 Ga0466967_0249512 3300045976 Bacteria 1695
139 Ga0495632_0051874 3300046519 Bacteria 2018
140 Ga0495640_0216902 3300046533 Bacteria 1208
141 Ga0495635_0349096 3300046663 Bacteria 987
142 Ga0495649_0362418 3300046694 Bacteria 731
143 Ga0495686_0015536 3300047472 Bacteria 5192
144 Ga0496101_0088150 3300048904 Bacteria 2304
145 Ga0496101_0145087 3300048904 Bacteria 1812
146 Ga0496102_0000521 3300048905 Bacteria 41977
147 Ga0496102_0004313 3300048905 Bacteria 12029
148 Ga0496102_0035611 3300048905 Bacteria 4481
149 Ga0496102_0297987 3300048905 Bacteria 1520
150 Ga0496103_0003400 3300048906 Bacteria 9730
151 Ga0496104_0002317 3300048907 Bacteria 16447
152 Ga0496104_0030736 3300048907 Bacteria 4993
153 Ga0496104_0193408 3300048907 Bacteria 1946
154 Ga0496104_0366994 3300048907 Bacteria 1352
155 Ga0496105_0002831 3300048908 Bacteria 12689
156 Ga0496105_0011539 3300048908 Bacteria 6985
157 Ga0496105_0067629 3300048908 Bacteria 2950
158 Ga0496108_0000043 3300048911 Bacteria 146005
159 Ga0496108_0010365 3300048911 Bacteria 7567
160 Ga0496108_0076364 3300048911 Bacteria 2832
161 Ga0496109_0000777 3300048912 Bacteria 26514
162 Ga0496110_0001890 3300048913 Bacteria 15469
163 Ga0496110_0015616 3300048913 Bacteria 6324
164 Ga0496110_0152907 3300048913 Bacteria 2090
165 Ga0496111_0000456 3300048914 Bacteria 20782
166 Ga0496112_0005166 3300048915 Bacteria 11219
167 Ga0496112_0337805 3300048915 Bacteria 1450
168 Ga0496113_0008265 3300048916 Bacteria 6769
169 Ga0496113_0196564 3300048916 Bacteria 1602
170 Ga0496114_0011899 3300048917 Bacteria 6963
171 Ga0496114_0018581 3300048917 Bacteria 5624
172 Ga0496114_0019015 3300048917 Bacteria 5565
173 Ga0496114_0147507 3300048917 Bacteria 2040
174 Ga0496114_0148338 3300048917 Bacteria 2034
175 Ga0496115_0221082 3300048918 Bacteria 1563
176 Ga0496115_0246870 3300048918 Bacteria 1470
177 Ga0496116_0000173 3300048919 Bacteria 129928
178 Ga0496117_0006455 3300048920 Bacteria 11857
179 Ga0496118_0000096 3300048921 Bacteria 163988
180 Ga0496119_0007477 3300048922 Bacteria 9823
181 Ga0496119_0147328 3300048922 Bacteria 1265
182 Ga0496120_0006720 3300048923 Bacteria 8749
183 Ga0496121_0038280 3300048924 Bacteria 4250
184 Ga0496122_0027082 3300048925 Bacteria 4913
185 Ga0496124_0038868 3300048927 Bacteria 4128
186 Ga0496126_0000330 3300048929 Bacteria 101064
187 Ga0496126_0001948 3300048929 Bacteria 29326
188 Ga0496126_0002802 3300048929 Bacteria 22925
189 Ga0496126_0028870 3300048929 Bacteria 5278
190 Ga0501031_0180790 3300049568 Bacteria 1378
191 Ga0501032_0038098 3300049569 Bacteria 3276
192 Ga0501038_0010893 3300049574 Bacteria 8304
193 Ga0501039_0083458 3300049575 Bacteria 2488
194 Ga0501043_0225377 3300049579 Bacteria 1449
195 Ga0501044_0103511 3300049823 Bacteria 2861
196 nmdc:mga03n38_10511_c1 3300050490 Bacteria 3410
197 nmdc:mga00v17_937_c1 3300050491 Bacteria 15681
198 nmdc:mga0yw44_98459_c1 3300050492 Bacteria 1859
199 nmdc:mga0sz30_12352_c1 3300050516 Bacteria 3321
200 Ga0495595_0152533 3300053084 Bacteria 1137
201 Ga0500644_0004568 3300053088 Bacteria 3468
202 Ga0500644_0031471 3300053088 Bacteria 1687
203 Ga0500651_0029173 3300053093 Bacteria 3468
204 Ga0500641_0061427 3300053096 Bacteria 1565
205 Ga0500569_005512 3300053109 Bacteria 2723
206 Ga0500559_0043259 3300053136 Bacteria 1968
207 Ga0500588_0047192 3300053146 Bacteria 1327
208 Ga0500600_0129959 3300053149 Bacteria 1284
209 Ga0466962_0044603 3300061719 Bacteria 2121

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041453 Ga0451797_0877449 Ga0451797_0877449_157_1041 223
2 3300046694 Ga0495649_0362418 Ga0495649_0362418_15_719 230
3 3300044684 Ga0466966_0015125 Ga0466966_0015125_1515_2219 233
4 3300044693 Ga0466961_0003534 Ga0466961_0003534_8525_9229 233
5 3300044735 Ga0466968_0005888 Ga0466968_0005888_1047_1751 233
6 3300044765 Ga0466970_0069391 Ga0466970_0069391_731_1435 233
7 3300045049 Ga0466959_0019686 Ga0466959_0019686_3075_3779 233
8 3300045836 Ga0466958_0024416 Ga0466958_0024416_2395_3099 233
9 3300006038 Ga0075365_10117250 Ga0075365_101172502 234
10 3300006048 Ga0075363_100013208 Ga0075363_1000132082 234
11 3300006051 Ga0075364_10008222 Ga0075364_100082228 234
12 3300006186 Ga0075369_10058031 Ga0075369_100580312 234
13 3300050490 nmdc:mga03n38_10511_c1 nmdc:mga03n38_10511_c1_2406_3113 234
14 3300050491 nmdc:mga00v17_937_c1 nmdc:mga00v17_937_c1_6533_7240 234
15 3300050492 nmdc:mga0yw44_98459_c1 nmdc:mga0yw44_98459_c1_883_1590 234
16 3300050516 nmdc:mga0sz30_12352_c1 nmdc:mga0sz30_12352_c1_1447_2154 234
17 3300044719 Ga0466971_0005377 Ga0466971_0005377_1091_1801 235
18 3300061719 Ga0466962_0044603 Ga0466962_0044603_793_1503 235
19 3300031730 Ga0307516_10060752 Ga0307516_100607523 242
20 3300053088 Ga0500644_0031471 Ga0500644_0031471_14_829 242
21 3300039437 Ga0436365_0780150 Ga0436365_0780150_756_1493 244
22 3300039437 Ga0436365_0784584 Ga0436365_0784584_30_767 244
23 3300044684 Ga0466966_0075907 Ga0466966_0075907_165_914 248
24 3300053084 Ga0495595_0152533 Ga0495595_0152533_308_1126 248
25 3300044658 Ga0466972_0052065 Ga0466972_0052065_852_1679 252
26 iso_pu_bacteria 2675903059 2676480153 262
27 iso_pu_bacteria 2751185782 2753265188 262
28 3300045976 Ga0466967_0045074 Ga0466967_0045074_1507_2313 264
29 3300005335 Ga0070666_10197126 Ga0070666_101971262 265
30 3300005347 Ga0070668_100049240 Ga0070668_1000492403 265
31 3300005367 Ga0070667_100017797 Ga0070667_1000177974 265
32 3300005435 Ga0070714_100215572 Ga0070714_1002155722 265
33 3300005844 Ga0068862_100033085 Ga0068862_1000330852 265
34 3300006028 Ga0070717_10109669 Ga0070717_101096692 265
35 3300006358 Ga0068871_100077172 Ga0068871_1000771723 265
36 3300025925 Ga0207650_10125806 Ga0207650_101258063 265
37 3300025929 Ga0207664_10090630 Ga0207664_100906303 265
38 3300025986 Ga0207658_10099684 Ga0207658_100996843 265
39 3300026088 Ga0207641_10355169 Ga0207641_103551692 265
40 3300028380 Ga0268265_10037136 Ga0268265_100371363 265
41 iso_pu_bacteria 2643221576 2643890207 265
42 iso_pu_bacteria 2643221590 2643959263 265
43 3300005535 Ga0070684_100433625 Ga0070684_1004336251 266
44 3300013308 Ga0157375_10964258 Ga0157375_109642582 266
45 3300031507 Ga0307509_10031033 Ga0307509_100310334 266
46 3300031731 Ga0307405_10131677 Ga0307405_101316771 266
47 3300033179 Ga0307507_10049489 Ga0307507_100494896 266
48 3300035692 Ga0373935_0025143 Ga0373935_0025143_1241_2053 266
49 3300041460 Ga0451802_1477580 Ga0451802_1477580_241_1053 266
50 3300046519 Ga0495632_0051874 Ga0495632_0051874_186_998 266
51 3300005327 Ga0070658_10086548 Ga0070658_100865482 267
52 3300005347 Ga0070668_100066043 Ga0070668_1000660433 267
53 3300005719 Ga0068861_100100196 Ga0068861_1001001963 267
54 3300005985 Ga0081539_10048313 Ga0081539_100483132 267
55 3300013307 Ga0157372_10005740 Ga0157372_100057403 267
56 3300014325 Ga0163163_10726640 Ga0163163_107266402 267
57 3300025972 Ga0207668_10083246 Ga0207668_100832462 267
58 3300026118 Ga0207675_100143329 Ga0207675_1001433293 267
59 3300028794 Ga0307515_10052633 Ga0307515_100526333 267
60 3300028794 Ga0307515_10101839 Ga0307515_101018392 267
61 3300028794 Ga0307515_10108372 Ga0307515_101083722 267
62 3300030522 Ga0307512_10061731 Ga0307512_100617312 267
63 3300031456 Ga0307513_10074070 Ga0307513_100740703 267
64 3300031456 Ga0307513_10211341 Ga0307513_102113412 267
65 3300031616 Ga0307508_10030740 Ga0307508_100307403 267
66 3300031616 Ga0307508_10194976 Ga0307508_101949762 267
67 3300031649 Ga0307514_10248891 Ga0307514_102488912 267
68 3300031730 Ga0307516_10046233 Ga0307516_100462334 267
69 3300031730 Ga0307516_10075709 Ga0307516_100757093 267
70 3300031730 Ga0307516_10322377 Ga0307516_103223772 267
71 3300032126 Ga0307415_100712534 Ga0307415_1007125341 267
72 3300033179 Ga0307507_10255960 Ga0307507_102559602 267
73 3300035088 Ga0373940_0000542 Ga0373940_0000542_2396_3211 267
74 3300035207 Ga0373942_0000550 Ga0373942_0000550_3774_4589 267
75 3300035242 Ga0373962_0017542 Ga0373962_0017542_904_1719 267
76 3300048905 Ga0496102_0297987 Ga0496102_0297987_155_973 267
77 3300048907 Ga0496104_0030736 Ga0496104_0030736_1973_2791 267
78 3300048911 Ga0496108_0000043 Ga0496108_0000043_104004_104819 267
79 3300048913 Ga0496110_0015616 Ga0496110_0015616_1017_1835 267
80 3300048916 Ga0496113_0196564 Ga0496113_0196564_327_1145 267
81 3300053088 Ga0500644_0004568 Ga0500644_0004568_1039_1854 267
82 3300053093 Ga0500651_0029173 Ga0500651_0029173_2256_3071 267
83 3300053096 Ga0500641_0061427 Ga0500641_0061427_643_1458 267
84 3300053109 Ga0500569_005512 Ga0500569_005512_1203_2018 267
85 3300053136 Ga0500559_0043259 Ga0500559_0043259_705_1520 267
86 3300053146 Ga0500588_0047192 Ga0500588_0047192_469_1284 267
87 3300053149 Ga0500600_0129959 Ga0500600_0129959_184_999 267
88 iso_pu_bacteria 2515154088 2515496669 267
89 iso_pu_bacteria 2515154129 2515718329 267
90 iso_pu_bacteria 2515154137 2515756908 267
91 iso_pu_bacteria 2515154202 2516083511 267
92 iso_pu_bacteria 2515154203 2516089446 267
93 iso_pu_bacteria 2772190715 2772644911 267
94 iso_pu_bacteria 2832004796 2832006186 267
95 iso_pu_bacteria 2855670206 2855673772 267
96 iso_pu_bacteria 2855676851 2855681698 267
97 iso_pu_bacteria 2857288857 2857290697 267
98 iso_pu_bacteria 2858848962 2858850663 267
99 iso_pu_bacteria 2858882152 2858886259 267
100 iso_pu_bacteria 2858888857 2858890970 267
101 iso_pu_bacteria 2858895516 2858897651 267
102 iso_pu_bacteria 2866065130 2866068623 267
103 iso_pu_bacteria 2867302475 2867307143 267
104 iso_pu_bacteria 2867312974 2867319367 267
105 iso_pu_bacteria 2867319477 2867325494 267
106 iso_pu_bacteria 2867507094 2867510900 267
107 iso_pu_bacteria 2869048445 2869050039 267
108 iso_pu_bacteria 2869061728 2869063893 267
109 iso_pu_bacteria 2869068681 2869071847 267
110 iso_pu_bacteria 2880489317 2880495247 267
111 iso_pu_bacteria 2880495981 2880497098 267
112 iso_pu_bacteria 2929219909 2929225697 267
113 iso_pu_bacteria 2929226422 2929231328 267
114 iso_pu_bacteria 8003830390 8003835095 267
115 iso_pu_bacteria 8003856774 8003862035 267
116 iso_pu_bacteria 8003870546 8003872945 267
117 iso_pu_bacteria 8054704163 8054706687 267
118 iso_pu_bacteria 8054727385 8054733707 267
119 iso_pu_bacteria 8054734606 8054740734 267
120 iso_pu_bacteria 8055412473 8055415860 267
121 3300005985 Ga0081539_10001279 Ga0081539_100012794 268
122 3300025939 Ga0207665_10430005 Ga0207665_104300051 268
123 3300031730 Ga0307516_10013922 Ga0307516_100139227 268
124 3300044693 Ga0466961_0272618 Ga0466961_0272618_153_962 268
125 iso_pu_bacteria 2501939600 2501943359 268
126 iso_pu_bacteria 2622736626 2623585016 268
127 iso_pu_bacteria 2855683550 2855684540 268
128 iso_pu_bacteria 2856858025 2856858844 268
129 iso_pu_bacteria 2996221748 2996223730 268
130 iso_pu_bacteria 649633069 649810752 268
131 3300005436 Ga0070713_100134446 Ga0070713_1001344462 270
132 3300006844 Ga0075428_100150112 Ga0075428_1001501122 270
133 3300037068 Ga0373925_0410853 Ga0373925_0410853_227_1054 270
134 3300048907 Ga0496104_0193408 Ga0496104_0193408_621_1445 270
135 3300048908 Ga0496105_0011539 Ga0496105_0011539_1634_2458 270
136 3300048922 Ga0496119_0007477 Ga0496119_0007477_4147_4971 270
137 3300048923 Ga0496120_0006720 Ga0496120_0006720_3119_3943 270
138 3300048927 Ga0496124_0038868 Ga0496124_0038868_2823_3647 270
139 3300005841 Ga0068863_100087950 Ga0068863_1000879502 271
140 3300009101 Ga0105247_10287503 Ga0105247_102875031 271
141 3300014968 Ga0157379_10038829 Ga0157379_100388293 271
142 3300026088 Ga0207641_10071181 Ga0207641_100711812 271
143 3300044693 Ga0466961_0078088 Ga0466961_0078088_1027_1854 271
144 3300048904 Ga0496101_0088150 Ga0496101_0088150_1008_1835 271
145 3300048905 Ga0496102_0000521 Ga0496102_0000521_6971_7798 271
146 3300048906 Ga0496103_0003400 Ga0496103_0003400_4068_4895 271
147 3300048911 Ga0496108_0076364 Ga0496108_0076364_1916_2743 271
148 3300048919 Ga0496116_0000173 Ga0496116_0000173_4809_5636 271
149 3300048920 Ga0496117_0006455 Ga0496117_0006455_4150_4977 271
150 3300048921 Ga0496118_0000096 Ga0496118_0000096_67718_68545 271
151 3300048924 Ga0496121_0038280 Ga0496121_0038280_2079_2906 271
152 3300048929 Ga0496126_0000330 Ga0496126_0000330_95438_96265 271
153 3300048929 Ga0496126_0028870 Ga0496126_0028870_3583_4413 271
154 3300031548 Ga0307408_100036868 Ga0307408_1000368683 272
155 3300031824 Ga0307413_10037748 Ga0307413_100377482 272
156 3300031901 Ga0307406_10004670 Ga0307406_100046704 272
157 3300031911 Ga0307412_10160642 Ga0307412_101606422 272
158 3300031995 Ga0307409_100008694 Ga0307409_1000086944 272
159 3300032002 Ga0307416_100041034 Ga0307416_1000410343 272
160 3300032005 Ga0307411_10291546 Ga0307411_102915462 272
161 3300032126 Ga0307415_100015068 Ga0307415_1000150684 272
162 3300005985 Ga0081539_10003532 Ga0081539_1000353213 273
163 3300006844 Ga0075428_100110272 Ga0075428_1001102723 273
164 3300031456 Ga0307513_10024355 Ga0307513_100243551 273
165 3300038443 Ga0395901_0011246 Ga0395901_0011246_5698_6612 273
166 3300045976 Ga0466967_0249512 Ga0466967_0249512_398_1246 273
167 iso_pu_bacteria 2858868258 2858875128 273
168 3300031727 Ga0316576_10001505 Ga0316576_100015054 274
169 3300035398 Ga0316574_0000119 Ga0316574_0000119_19632_20489 274
170 3300048908 Ga0496105_0067629 Ga0496105_0067629_2050_2913 274
171 3300048917 Ga0496114_0011899 Ga0496114_0011899_1055_1918 274
172 3300049568 Ga0501031_0180790 Ga0501031_0180790_463_1302 275
173 3300049569 Ga0501032_0038098 Ga0501032_0038098_637_1476 275
174 3300049574 Ga0501038_0010893 Ga0501038_0010893_3223_4062 275
175 3300049575 Ga0501039_0083458 Ga0501039_0083458_61_900 275
176 3300049579 Ga0501043_0225377 Ga0501043_0225377_568_1407 275
177 3300049823 Ga0501044_0103511 Ga0501044_0103511_569_1408 275
178 3300005356 Ga0070674_100363569 Ga0070674_1003635691 276
179 3300014969 Ga0157376_10122899 Ga0157376_101228992 276
180 3300025927 Ga0207687_10077296 Ga0207687_100772962 276
181 3300048917 Ga0496114_0019015 Ga0496114_0019015_766_1629 276
182 3300005564 Ga0070664_100052830 Ga0070664_1000528302 277
183 3300009093 Ga0105240_10066736 Ga0105240_100667365 277
184 3300025913 Ga0207695_10059568 Ga0207695_100595683 277
185 3300048915 Ga0496112_0337805 Ga0496112_0337805_510_1364 277
186 3300048916 Ga0496113_0008265 Ga0496113_0008265_5133_5987 277
187 3300009098 Ga0105245_10497619 Ga0105245_104976191 278
188 3300013308 Ga0157375_10244747 Ga0157375_102447472 278
189 3300032004 Ga0307414_10317979 Ga0307414_103179791 278
190 3300048907 Ga0496104_0366994 Ga0496104_0366994_69_938 278
191 3300048918 Ga0496115_0221082 Ga0496115_0221082_673_1542 278
192 3300025937 Ga0207669_10448456 Ga0207669_104484561 279
193 3300048905 Ga0496102_0004313 Ga0496102_0004313_337_1188 279
194 3300005327 Ga0070658_10007171 Ga0070658_100071719 280
195 3300005435 Ga0070714_100000013 Ga0070714_10000001348 280
196 3300025909 Ga0207705_10010110 Ga0207705_100101103 280
197 3300025909 Ga0207705_10063756 Ga0207705_100637563 280
198 3300025929 Ga0207664_10000001 Ga0207664_10000001555 280
199 3300005614 Ga0068856_100045093 Ga0068856_1000450934 281
200 3300009093 Ga0105240_10560102 Ga0105240_105601021 281
201 3300010375 Ga0105239_10003769 Ga0105239_1000376916 281
202 3300025913 Ga0207695_10398361 Ga0207695_103983611 281
203 3300026078 Ga0207702_10022623 Ga0207702_100226233 281
204 3300048905 Ga0496102_0035611 Ga0496102_0035611_1344_2222 281
205 3300048907 Ga0496104_0002317 Ga0496104_0002317_11848_12726 281
206 3300048908 Ga0496105_0002831 Ga0496105_0002831_8794_9672 281
207 3300048911 Ga0496108_0010365 Ga0496108_0010365_6017_6895 281
208 3300048912 Ga0496109_0000777 Ga0496109_0000777_24772_25650 281
209 3300048913 Ga0496110_0001890 Ga0496110_0001890_9573_10451 281
210 3300048913 Ga0496110_0152907 Ga0496110_0152907_930_2018 281
211 3300048914 Ga0496111_0000456 Ga0496111_0000456_17661_18539 281
212 3300048917 Ga0496114_0147507 Ga0496114_0147507_725_1603 281
213 3300048922 Ga0496119_0147328 Ga0496119_0147328_32_928 283
214 3300021384 Ga0213876_10001123 Ga0213876_100011237 284
215 3300021388 Ga0213875_10021512 Ga0213875_100215123 284
216 3300037853 Ga0436364_1001100 Ga0436364_1001100_793_1650 284
217 3300039437 Ga0436365_0484364 Ga0436365_0484364_34182_35039 284
218 3300048929 Ga0496126_0002802 Ga0496126_0002802_21444_22304 284
219 3300046663 Ga0495635_0349096 Ga0495635_0349096_44_973 285
220 3300021388 Ga0213875_10057142 Ga0213875_100571423 286
221 3300048917 Ga0496114_0148338 Ga0496114_0148338_568_1500 286
222 3300005437 Ga0070710_10255068 Ga0070710_102550682 288
223 3300037853 Ga0436364_1112074 Ga0436364_1112074_2655_3527 288
224 3300039450 Ga0436363_1218883 Ga0436363_1218883_132_1004 288
225 3300005337 Ga0070682_100116597 Ga0070682_1001165972 289
226 3300011119 Ga0105246_10281224 Ga0105246_102812241 289
227 3300017792 Ga0163161_10349559 Ga0163161_103495591 289
228 3300026067 Ga0207678_10096195 Ga0207678_100961952 289
229 3300026095 Ga0207676_10234143 Ga0207676_102341432 289
230 3300026121 Ga0207683_10060760 Ga0207683_100607603 289
231 3300031251 Ga0265327_10004321 Ga0265327_100043211 289
232 3300041451 Ga0451791_0197792 Ga0451791_0197792_220_1179 289
233 3300041452 Ga0451793_1287167 Ga0451793_1287167_714_1673 289
234 3300044658 Ga0466972_0006314 Ga0466972_0006314_1045_1938 289
235 3300044683 Ga0466965_0001455 Ga0466965_0001455_7010_7903 289
236 3300044735 Ga0466968_0000681 Ga0466968_0000681_2589_3482 289
237 3300044765 Ga0466970_0001829 Ga0466970_0001829_1533_2426 289
238 3300044842 Ga0466957_0002166 Ga0466957_0002166_4595_5488 289
239 3300045049 Ga0466959_0008129 Ga0466959_0008129_5645_6538 289
240 3300009551 Ga0105238_10420037 Ga0105238_104200371 290
241 3300031251 Ga0265327_10001834 Ga0265327_1000183421 290
242 3300046533 Ga0495640_0216902 Ga0495640_0216902_174_1130 290
243 3300048917 Ga0496114_0018581 Ga0496114_0018581_4694_5611 290
244 iso_pu_bacteria 2643221687 2644490031 291
245 iso_pu_bacteria 2902837492 2902841663 291
246 3300003792 Ga0055540_1025035 Ga0055540_10250352 292
247 3300025303 Ga0209051_1001558 Ga0209051_10015585 292
248 3300047472 Ga0495686_0015536 Ga0495686_0015536_4235_5182 293
249 3300003792 Ga0055540_1006390 Ga0055540_10063902 295
250 3300025303 Ga0209051_1004662 Ga0209051_10046625 295
251 3300048904 Ga0496101_0145087 Ga0496101_0145087_53_1060 295
252 3300048915 Ga0496112_0005166 Ga0496112_0005166_4344_5381 295
253 3300048918 Ga0496115_0246870 Ga0496115_0246870_75_1112 295
254 3300048925 Ga0496122_0027082 Ga0496122_0027082_1842_2849 295
255 3300048929 Ga0496126_0001948 Ga0496126_0001948_127_1164 295

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01416

PseudoU_synth_1

tRNA pseudouridine synthase

218

319

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nre-assembly1.cif.gz_A-2 crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.9038 10 269
8q70-assembly1.cif.gz_A-2 trna pseudouridine synthase a homodimer 0.8893 14 268
1vs3-assembly1.cif.gz_B crystal structure of the trna pseudouridine synthase trua from thermus thermophilus hb8 0.888 13 269
1vs3-assembly1.cif.gz_B crystal structure of the trna pseudouridine synthase trua from thermus thermophilus hb8 0.8745 13 269
2nr0-assembly1.cif.gz_B crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.8704 10 287
ID Description Score Start End Superfamily
af_P9WHP9_20_139_3.30.70.580 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9977 11 129 3.30.70.580
af_P9WHP9_140_277_3.30.70.660 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, C-terminal subdomain 0.9854 130 267 3.30.70.660
af_P9WHP9_20_139_3.30.70.580 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9812 11 129 3.30.70.580
af_P9WHP9_140_277_3.30.70.660 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, C-terminal subdomain 0.9783 130 267 3.30.70.660
af_C7J2E5_59_129_3.30.70.580 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9455 14 75 3.30.70.580
ID Description Score Start End GO Terms
AF-A0A2S8L0L8-F1-model_v4 deleted 0.9752 3 286
AF-A0A318XGB4-F1-model_v4 deleted 0.9727 20 282
AF-X8FIJ7-F1-model_v4 deleted 0.9705 76 286
AF-A0A0H3MRM6-F1-model_v4 tRNA pseudouridine synthase (EC 5.4.99.12) 0.9668 43 283 GO:0003723
GO:0031119
GO:0160147
AF-A0A372J8M2-F1-model_v4 tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA pseudouridine(38-40) synthase) (tRNA pseudouridylate synthase I) (tRNA-uridine isomerase I) 0.9652 1 286 GO:0003723
GO:0031119
GO:0160147

Feature Viewer

pLDDT pTM Quality
91.16 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map