F365995
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 255 | 192 | 209 | 277 |
Family's Representative Sequence
| Representative Sequence | 3300048913|Ga0496110_0152907|Ga0496110_0152907_930_2018 |
| Length | 336 |
| Sequence | VDSSADAGRIRLRLDLSYDGTDFSGWASQPARRTVAGTLTDALQVLLRHPVQLVVAGRTDAGVHASGQVAHVDVAPDALRALAPRHTTRAAGDRANPLDRTSDATRDTPAGQNGAAATAQDPPGEPLRVVPAVAEAEPLGDSLEGRSGLLRRLAGLLAPDLRVREITLAPTGFDARFAALRRHYRYRIGTAEWGVEPPDRLYVLARRRAMDTEAMSRAAAALIGLHDFAAFCRPREGATTTRELQSLTVTRLGHEIHIDVVADAFCHSMVRALVGSLMAVGEGRDPIDRPSQLLASGLRTSGIHVAPAHGLILRAVDYPPDDELARRAEQTRARRP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 2 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 3 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 4 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 5 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 6 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 7 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 8 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 9 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 10 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 11 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 12 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 13 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 14 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 15 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 16 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 17 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 18 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 19 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 20 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 21 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 22 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 23 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 24 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 25 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 26 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 27 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 28 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 29 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 30 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 31 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 32 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 33 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 34 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 35 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 36 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 37 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 38 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 39 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 40 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 56 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 58 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 59 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 60 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 76 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 77 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 95 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 96 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 97 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 98 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 99 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 100 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 101 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 102 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 103 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 104 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 105 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 106 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 107 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 108 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 109 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 110 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 111 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 112 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 113 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 114 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 115 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 116 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 117 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 118 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 119 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 120 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 121 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 122 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 123 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 124 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 125 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 126 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 127 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 128 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 129 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 130 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 131 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 132 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 133 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 134 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 135 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 136 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 137 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 138 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 139 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 145 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 146 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 147 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 148 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 149 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 150 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 152 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 153 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 154 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 155 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 156 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 157 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 158 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 159 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 160 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 161 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 162 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 163 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 164 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 165 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 166 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 173 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 174 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 175 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 176 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 178 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 179 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 180 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 181 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 182 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 183 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 184 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 185 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 186 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 187 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 188 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 189 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 190 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 191 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 192 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.96 |
| Metatranscriptomes | 0 |
| Isolates | 18.04 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.84 |
| Nodule | 2.35 |
| Rhizoplane | 14.51 |
| Rhizosphere | 47.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 27.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055540_1006390 | 3300003792 | Bacteria | 4686 |
| 2 | Ga0055540_1025035 | 3300003792 | Bacteria | 1469 |
| 3 | Ga0070658_10007171 | 3300005327 | Bacteria | 9004 |
| 4 | Ga0070658_10086548 | 3300005327 | Bacteria | 2578 |
| 5 | Ga0070666_10197126 | 3300005335 | Bacteria | 1416 |
| 6 | Ga0070682_100116597 | 3300005337 | Bacteria | 1787 |
| 7 | Ga0070668_100049240 | 3300005347 | Bacteria | 3242 |
| 8 | Ga0070668_100066043 | 3300005347 | Bacteria | 2806 |
| 9 | Ga0070674_100363569 | 3300005356 | Bacteria | 1172 |
| 10 | Ga0070667_100017797 | 3300005367 | Bacteria | 5890 |
| 11 | Ga0070714_100000013 | 3300005435 | Bacteria | 211756 |
| 12 | Ga0070714_100215572 | 3300005435 | Bacteria | 1762 |
| 13 | Ga0070713_100134446 | 3300005436 | Bacteria | 2184 |
| 14 | Ga0070710_10255068 | 3300005437 | Bacteria | 1129 |
| 15 | Ga0070684_100433625 | 3300005535 | Bacteria | 1214 |
| 16 | Ga0070664_100052830 | 3300005564 | Bacteria | 3443 |
| 17 | Ga0068856_100045093 | 3300005614 | Bacteria | 4340 |
| 18 | Ga0068861_100100196 | 3300005719 | Bacteria | 2302 |
| 19 | Ga0068863_100087950 | 3300005841 | Bacteria | 2944 |
| 20 | Ga0068862_100033085 | 3300005844 | Bacteria | 4367 |
| 21 | Ga0081539_10001279 | 3300005985 | Bacteria | 44286 |
| 22 | Ga0081539_10003532 | 3300005985 | Bacteria | 19014 |
| 23 | Ga0081539_10048313 | 3300005985 | Bacteria | 2421 |
| 24 | Ga0070717_10109669 | 3300006028 | Bacteria | 2353 |
| 25 | Ga0075365_10117250 | 3300006038 | Bacteria | 1834 |
| 26 | Ga0075363_100013208 | 3300006048 | Bacteria | 3996 |
| 27 | Ga0075364_10008222 | 3300006051 | Bacteria | 6229 |
| 28 | Ga0075369_10058031 | 3300006186 | Bacteria | 1685 |
| 29 | Ga0068871_100077172 | 3300006358 | Bacteria | 2753 |
| 30 | Ga0075428_100110272 | 3300006844 | Bacteria | 2998 |
| 31 | Ga0075428_100150112 | 3300006844 | Bacteria | 2532 |
| 32 | Ga0105240_10066736 | 3300009093 | Bacteria | 4462 |
| 33 | Ga0105240_10560102 | 3300009093 | Bacteria | 1263 |
| 34 | Ga0105245_10497619 | 3300009098 | Bacteria | 1235 |
| 35 | Ga0105247_10287503 | 3300009101 | Bacteria | 1136 |
| 36 | Ga0105238_10420037 | 3300009551 | Bacteria | 1332 |
| 37 | Ga0105239_10003769 | 3300010375 | Bacteria | 18441 |
| 38 | Ga0105246_10281224 | 3300011119 | Bacteria | 1335 |
| 39 | Ga0157372_10005740 | 3300013307 | Bacteria | 13218 |
| 40 | Ga0157375_10244747 | 3300013308 | Bacteria | 1953 |
| 41 | Ga0157375_10964258 | 3300013308 | Bacteria | 994 |
| 42 | Ga0163163_10726640 | 3300014325 | Bacteria | 1056 |
| 43 | Ga0157379_10038829 | 3300014968 | Bacteria | 4247 |
| 44 | Ga0157376_10122899 | 3300014969 | Bacteria | 2304 |
| 45 | Ga0163161_10349559 | 3300017792 | Bacteria | 1175 |
| 46 | Ga0213876_10001123 | 3300021384 | Bacteria | 17054 |
| 47 | Ga0213875_10021512 | 3300021388 | Bacteria | 3089 |
| 48 | Ga0213875_10057142 | 3300021388 | Bacteria | 1828 |
| 49 | Ga0209051_1001558 | 3300025303 | Bacteria | 18956 |
| 50 | Ga0209051_1004662 | 3300025303 | Bacteria | 8349 |
| 51 | Ga0207705_10010110 | 3300025909 | Bacteria | 6869 |
| 52 | Ga0207705_10063756 | 3300025909 | Bacteria | 2663 |
| 53 | Ga0207695_10059568 | 3300025913 | Bacteria | 3958 |
| 54 | Ga0207695_10398361 | 3300025913 | Bacteria | 1261 |
| 55 | Ga0207650_10125806 | 3300025925 | Bacteria | 2001 |
| 56 | Ga0207687_10077296 | 3300025927 | Bacteria | 2393 |
| 57 | Ga0207664_10000001 | 3300025929 | Bacteria | 724213 |
| 58 | Ga0207664_10090630 | 3300025929 | Bacteria | 2506 |
| 59 | Ga0207669_10448456 | 3300025937 | Bacteria | 1022 |
| 60 | Ga0207665_10430005 | 3300025939 | Bacteria | 1010 |
| 61 | Ga0207668_10083246 | 3300025972 | Bacteria | 2327 |
| 62 | Ga0207658_10099684 | 3300025986 | Bacteria | 2273 |
| 63 | Ga0207678_10096195 | 3300026067 | Bacteria | 2530 |
| 64 | Ga0207702_10022623 | 3300026078 | Bacteria | 5213 |
| 65 | Ga0207641_10071181 | 3300026088 | Bacteria | 2990 |
| 66 | Ga0207641_10355169 | 3300026088 | Bacteria | 1398 |
| 67 | Ga0207676_10234143 | 3300026095 | Bacteria | 1644 |
| 68 | Ga0207675_100143329 | 3300026118 | Bacteria | 2271 |
| 69 | Ga0207683_10060760 | 3300026121 | Bacteria | 3323 |
| 70 | Ga0268265_10037136 | 3300028380 | Bacteria | 3573 |
| 71 | Ga0307515_10052633 | 3300028794 | Bacteria | 6032 |
| 72 | Ga0307515_10101839 | 3300028794 | Bacteria | 3461 |
| 73 | Ga0307515_10108372 | 3300028794 | Bacteria | 3273 |
| 74 | Ga0307512_10061731 | 3300030522 | Bacteria | 2883 |
| 75 | Ga0265327_10001834 | 3300031251 | Bacteria | 24762 |
| 76 | Ga0265327_10004321 | 3300031251 | Bacteria | 12669 |
| 77 | Ga0307513_10024355 | 3300031456 | Bacteria | 7042 |
| 78 | Ga0307513_10074070 | 3300031456 | Bacteria | 3543 |
| 79 | Ga0307513_10211341 | 3300031456 | Bacteria | 1771 |
| 80 | Ga0307509_10031033 | 3300031507 | Bacteria | 5906 |
| 81 | Ga0307408_100036868 | 3300031548 | Bacteria | 3440 |
| 82 | Ga0307508_10030740 | 3300031616 | Bacteria | 4853 |
| 83 | Ga0307508_10194976 | 3300031616 | Bacteria | 1627 |
| 84 | Ga0307514_10248891 | 3300031649 | Bacteria | 1055 |
| 85 | Ga0316576_10001505 | 3300031727 | Bacteria | 12590 |
| 86 | Ga0307516_10013922 | 3300031730 | Bacteria | 8535 |
| 87 | Ga0307516_10046233 | 3300031730 | Bacteria | 4296 |
| 88 | Ga0307516_10060752 | 3300031730 | Bacteria | 3670 |
| 89 | Ga0307516_10075709 | 3300031730 | Bacteria | 3219 |
| 90 | Ga0307516_10322377 | 3300031730 | Bacteria | 1216 |
| 91 | Ga0307405_10131677 | 3300031731 | Bacteria | 1729 |
| 92 | Ga0307413_10037748 | 3300031824 | Bacteria | 2793 |
| 93 | Ga0307406_10004670 | 3300031901 | Bacteria | 7462 |
| 94 | Ga0307412_10160642 | 3300031911 | Bacteria | 1669 |
| 95 | Ga0307409_100008694 | 3300031995 | Bacteria | 6183 |
| 96 | Ga0307416_100041034 | 3300032002 | Bacteria | 3601 |
| 97 | Ga0307414_10317979 | 3300032004 | Bacteria | 1324 |
| 98 | Ga0307411_10291546 | 3300032005 | Bacteria | 1304 |
| 99 | Ga0307415_100015068 | 3300032126 | Bacteria | 4566 |
| 100 | Ga0307415_100712534 | 3300032126 | Bacteria | 907 |
| 101 | Ga0307507_10049489 | 3300033179 | Bacteria | 4071 |
| 102 | Ga0307507_10255960 | 3300033179 | Bacteria | 1124 |
| 103 | Ga0373940_0000542 | 3300035088 | Bacteria | 5958 |
| 104 | Ga0373942_0000550 | 3300035207 | Bacteria | 10555 |
| 105 | Ga0373962_0017542 | 3300035242 | Bacteria | 1856 |
| 106 | Ga0316574_0000119 | 3300035398 | Bacteria | 24097 |
| 107 | Ga0373935_0025143 | 3300035692 | Bacteria | 3669 |
| 108 | Ga0373925_0410853 | 3300037068 | Bacteria | 1105 |
| 109 | Ga0436364_1001100 | 3300037853 | Bacteria | 6115 |
| 110 | Ga0436364_1112074 | 3300037853 | Bacteria | 9456 |
| 111 | Ga0395901_0011246 | 3300038443 | Bacteria | 9067 |
| 112 | Ga0436365_0484364 | 3300039437 | Bacteria | 53953 |
| 113 | Ga0436365_0780150 | 3300039437 | Bacteria | 1504 |
| 114 | Ga0436365_0784584 | 3300039437 | Bacteria | 778 |
| 115 | Ga0436363_1218883 | 3300039450 | Bacteria | 1360 |
| 116 | Ga0451791_0197792 | 3300041451 | Bacteria | 4238 |
| 117 | Ga0451793_1287167 | 3300041452 | Bacteria | 6071 |
| 118 | Ga0451797_0877449 | 3300041453 | Bacteria | 1120 |
| 119 | Ga0451802_1477580 | 3300041460 | Bacteria | 1368 |
| 120 | Ga0466972_0006314 | 3300044658 | Bacteria | 5954 |
| 121 | Ga0466972_0052065 | 3300044658 | Bacteria | 1974 |
| 122 | Ga0466965_0001455 | 3300044683 | Bacteria | 9563 |
| 123 | Ga0466966_0015125 | 3300044684 | Bacteria | 5104 |
| 124 | Ga0466966_0075907 | 3300044684 | Bacteria | 2099 |
| 125 | Ga0466961_0003534 | 3300044693 | Bacteria | 9753 |
| 126 | Ga0466961_0078088 | 3300044693 | Bacteria | 2097 |
| 127 | Ga0466961_0272618 | 3300044693 | Bacteria | 1036 |
| 128 | Ga0466971_0005377 | 3300044719 | Bacteria | 5554 |
| 129 | Ga0466968_0000681 | 3300044735 | Bacteria | 11690 |
| 130 | Ga0466968_0005888 | 3300044735 | Bacteria | 4602 |
| 131 | Ga0466970_0001829 | 3300044765 | Bacteria | 10272 |
| 132 | Ga0466970_0069391 | 3300044765 | Bacteria | 1894 |
| 133 | Ga0466957_0002166 | 3300044842 | Bacteria | 10516 |
| 134 | Ga0466959_0008129 | 3300045049 | Bacteria | 7401 |
| 135 | Ga0466959_0019686 | 3300045049 | Bacteria | 4965 |
| 136 | Ga0466958_0024416 | 3300045836 | Bacteria | 3557 |
| 137 | Ga0466967_0045074 | 3300045976 | Bacteria | 3830 |
| 138 | Ga0466967_0249512 | 3300045976 | Bacteria | 1695 |
| 139 | Ga0495632_0051874 | 3300046519 | Bacteria | 2018 |
| 140 | Ga0495640_0216902 | 3300046533 | Bacteria | 1208 |
| 141 | Ga0495635_0349096 | 3300046663 | Bacteria | 987 |
| 142 | Ga0495649_0362418 | 3300046694 | Bacteria | 731 |
| 143 | Ga0495686_0015536 | 3300047472 | Bacteria | 5192 |
| 144 | Ga0496101_0088150 | 3300048904 | Bacteria | 2304 |
| 145 | Ga0496101_0145087 | 3300048904 | Bacteria | 1812 |
| 146 | Ga0496102_0000521 | 3300048905 | Bacteria | 41977 |
| 147 | Ga0496102_0004313 | 3300048905 | Bacteria | 12029 |
| 148 | Ga0496102_0035611 | 3300048905 | Bacteria | 4481 |
| 149 | Ga0496102_0297987 | 3300048905 | Bacteria | 1520 |
| 150 | Ga0496103_0003400 | 3300048906 | Bacteria | 9730 |
| 151 | Ga0496104_0002317 | 3300048907 | Bacteria | 16447 |
| 152 | Ga0496104_0030736 | 3300048907 | Bacteria | 4993 |
| 153 | Ga0496104_0193408 | 3300048907 | Bacteria | 1946 |
| 154 | Ga0496104_0366994 | 3300048907 | Bacteria | 1352 |
| 155 | Ga0496105_0002831 | 3300048908 | Bacteria | 12689 |
| 156 | Ga0496105_0011539 | 3300048908 | Bacteria | 6985 |
| 157 | Ga0496105_0067629 | 3300048908 | Bacteria | 2950 |
| 158 | Ga0496108_0000043 | 3300048911 | Bacteria | 146005 |
| 159 | Ga0496108_0010365 | 3300048911 | Bacteria | 7567 |
| 160 | Ga0496108_0076364 | 3300048911 | Bacteria | 2832 |
| 161 | Ga0496109_0000777 | 3300048912 | Bacteria | 26514 |
| 162 | Ga0496110_0001890 | 3300048913 | Bacteria | 15469 |
| 163 | Ga0496110_0015616 | 3300048913 | Bacteria | 6324 |
| 164 | Ga0496110_0152907 | 3300048913 | Bacteria | 2090 |
| 165 | Ga0496111_0000456 | 3300048914 | Bacteria | 20782 |
| 166 | Ga0496112_0005166 | 3300048915 | Bacteria | 11219 |
| 167 | Ga0496112_0337805 | 3300048915 | Bacteria | 1450 |
| 168 | Ga0496113_0008265 | 3300048916 | Bacteria | 6769 |
| 169 | Ga0496113_0196564 | 3300048916 | Bacteria | 1602 |
| 170 | Ga0496114_0011899 | 3300048917 | Bacteria | 6963 |
| 171 | Ga0496114_0018581 | 3300048917 | Bacteria | 5624 |
| 172 | Ga0496114_0019015 | 3300048917 | Bacteria | 5565 |
| 173 | Ga0496114_0147507 | 3300048917 | Bacteria | 2040 |
| 174 | Ga0496114_0148338 | 3300048917 | Bacteria | 2034 |
| 175 | Ga0496115_0221082 | 3300048918 | Bacteria | 1563 |
| 176 | Ga0496115_0246870 | 3300048918 | Bacteria | 1470 |
| 177 | Ga0496116_0000173 | 3300048919 | Bacteria | 129928 |
| 178 | Ga0496117_0006455 | 3300048920 | Bacteria | 11857 |
| 179 | Ga0496118_0000096 | 3300048921 | Bacteria | 163988 |
| 180 | Ga0496119_0007477 | 3300048922 | Bacteria | 9823 |
| 181 | Ga0496119_0147328 | 3300048922 | Bacteria | 1265 |
| 182 | Ga0496120_0006720 | 3300048923 | Bacteria | 8749 |
| 183 | Ga0496121_0038280 | 3300048924 | Bacteria | 4250 |
| 184 | Ga0496122_0027082 | 3300048925 | Bacteria | 4913 |
| 185 | Ga0496124_0038868 | 3300048927 | Bacteria | 4128 |
| 186 | Ga0496126_0000330 | 3300048929 | Bacteria | 101064 |
| 187 | Ga0496126_0001948 | 3300048929 | Bacteria | 29326 |
| 188 | Ga0496126_0002802 | 3300048929 | Bacteria | 22925 |
| 189 | Ga0496126_0028870 | 3300048929 | Bacteria | 5278 |
| 190 | Ga0501031_0180790 | 3300049568 | Bacteria | 1378 |
| 191 | Ga0501032_0038098 | 3300049569 | Bacteria | 3276 |
| 192 | Ga0501038_0010893 | 3300049574 | Bacteria | 8304 |
| 193 | Ga0501039_0083458 | 3300049575 | Bacteria | 2488 |
| 194 | Ga0501043_0225377 | 3300049579 | Bacteria | 1449 |
| 195 | Ga0501044_0103511 | 3300049823 | Bacteria | 2861 |
| 196 | nmdc:mga03n38_10511_c1 | 3300050490 | Bacteria | 3410 |
| 197 | nmdc:mga00v17_937_c1 | 3300050491 | Bacteria | 15681 |
| 198 | nmdc:mga0yw44_98459_c1 | 3300050492 | Bacteria | 1859 |
| 199 | nmdc:mga0sz30_12352_c1 | 3300050516 | Bacteria | 3321 |
| 200 | Ga0495595_0152533 | 3300053084 | Bacteria | 1137 |
| 201 | Ga0500644_0004568 | 3300053088 | Bacteria | 3468 |
| 202 | Ga0500644_0031471 | 3300053088 | Bacteria | 1687 |
| 203 | Ga0500651_0029173 | 3300053093 | Bacteria | 3468 |
| 204 | Ga0500641_0061427 | 3300053096 | Bacteria | 1565 |
| 205 | Ga0500569_005512 | 3300053109 | Bacteria | 2723 |
| 206 | Ga0500559_0043259 | 3300053136 | Bacteria | 1968 |
| 207 | Ga0500588_0047192 | 3300053146 | Bacteria | 1327 |
| 208 | Ga0500600_0129959 | 3300053149 | Bacteria | 1284 |
| 209 | Ga0466962_0044603 | 3300061719 | Bacteria | 2121 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041453 | Ga0451797_0877449 | Ga0451797_0877449_157_1041 | 223 |
| 2 | 3300046694 | Ga0495649_0362418 | Ga0495649_0362418_15_719 | 230 |
| 3 | 3300044684 | Ga0466966_0015125 | Ga0466966_0015125_1515_2219 | 233 |
| 4 | 3300044693 | Ga0466961_0003534 | Ga0466961_0003534_8525_9229 | 233 |
| 5 | 3300044735 | Ga0466968_0005888 | Ga0466968_0005888_1047_1751 | 233 |
| 6 | 3300044765 | Ga0466970_0069391 | Ga0466970_0069391_731_1435 | 233 |
| 7 | 3300045049 | Ga0466959_0019686 | Ga0466959_0019686_3075_3779 | 233 |
| 8 | 3300045836 | Ga0466958_0024416 | Ga0466958_0024416_2395_3099 | 233 |
| 9 | 3300006038 | Ga0075365_10117250 | Ga0075365_101172502 | 234 |
| 10 | 3300006048 | Ga0075363_100013208 | Ga0075363_1000132082 | 234 |
| 11 | 3300006051 | Ga0075364_10008222 | Ga0075364_100082228 | 234 |
| 12 | 3300006186 | Ga0075369_10058031 | Ga0075369_100580312 | 234 |
| 13 | 3300050490 | nmdc:mga03n38_10511_c1 | nmdc:mga03n38_10511_c1_2406_3113 | 234 |
| 14 | 3300050491 | nmdc:mga00v17_937_c1 | nmdc:mga00v17_937_c1_6533_7240 | 234 |
| 15 | 3300050492 | nmdc:mga0yw44_98459_c1 | nmdc:mga0yw44_98459_c1_883_1590 | 234 |
| 16 | 3300050516 | nmdc:mga0sz30_12352_c1 | nmdc:mga0sz30_12352_c1_1447_2154 | 234 |
| 17 | 3300044719 | Ga0466971_0005377 | Ga0466971_0005377_1091_1801 | 235 |
| 18 | 3300061719 | Ga0466962_0044603 | Ga0466962_0044603_793_1503 | 235 |
| 19 | 3300031730 | Ga0307516_10060752 | Ga0307516_100607523 | 242 |
| 20 | 3300053088 | Ga0500644_0031471 | Ga0500644_0031471_14_829 | 242 |
| 21 | 3300039437 | Ga0436365_0780150 | Ga0436365_0780150_756_1493 | 244 |
| 22 | 3300039437 | Ga0436365_0784584 | Ga0436365_0784584_30_767 | 244 |
| 23 | 3300044684 | Ga0466966_0075907 | Ga0466966_0075907_165_914 | 248 |
| 24 | 3300053084 | Ga0495595_0152533 | Ga0495595_0152533_308_1126 | 248 |
| 25 | 3300044658 | Ga0466972_0052065 | Ga0466972_0052065_852_1679 | 252 |
| 26 | iso_pu_bacteria | 2675903059 | 2676480153 | 262 |
| 27 | iso_pu_bacteria | 2751185782 | 2753265188 | 262 |
| 28 | 3300045976 | Ga0466967_0045074 | Ga0466967_0045074_1507_2313 | 264 |
| 29 | 3300005335 | Ga0070666_10197126 | Ga0070666_101971262 | 265 |
| 30 | 3300005347 | Ga0070668_100049240 | Ga0070668_1000492403 | 265 |
| 31 | 3300005367 | Ga0070667_100017797 | Ga0070667_1000177974 | 265 |
| 32 | 3300005435 | Ga0070714_100215572 | Ga0070714_1002155722 | 265 |
| 33 | 3300005844 | Ga0068862_100033085 | Ga0068862_1000330852 | 265 |
| 34 | 3300006028 | Ga0070717_10109669 | Ga0070717_101096692 | 265 |
| 35 | 3300006358 | Ga0068871_100077172 | Ga0068871_1000771723 | 265 |
| 36 | 3300025925 | Ga0207650_10125806 | Ga0207650_101258063 | 265 |
| 37 | 3300025929 | Ga0207664_10090630 | Ga0207664_100906303 | 265 |
| 38 | 3300025986 | Ga0207658_10099684 | Ga0207658_100996843 | 265 |
| 39 | 3300026088 | Ga0207641_10355169 | Ga0207641_103551692 | 265 |
| 40 | 3300028380 | Ga0268265_10037136 | Ga0268265_100371363 | 265 |
| 41 | iso_pu_bacteria | 2643221576 | 2643890207 | 265 |
| 42 | iso_pu_bacteria | 2643221590 | 2643959263 | 265 |
| 43 | 3300005535 | Ga0070684_100433625 | Ga0070684_1004336251 | 266 |
| 44 | 3300013308 | Ga0157375_10964258 | Ga0157375_109642582 | 266 |
| 45 | 3300031507 | Ga0307509_10031033 | Ga0307509_100310334 | 266 |
| 46 | 3300031731 | Ga0307405_10131677 | Ga0307405_101316771 | 266 |
| 47 | 3300033179 | Ga0307507_10049489 | Ga0307507_100494896 | 266 |
| 48 | 3300035692 | Ga0373935_0025143 | Ga0373935_0025143_1241_2053 | 266 |
| 49 | 3300041460 | Ga0451802_1477580 | Ga0451802_1477580_241_1053 | 266 |
| 50 | 3300046519 | Ga0495632_0051874 | Ga0495632_0051874_186_998 | 266 |
| 51 | 3300005327 | Ga0070658_10086548 | Ga0070658_100865482 | 267 |
| 52 | 3300005347 | Ga0070668_100066043 | Ga0070668_1000660433 | 267 |
| 53 | 3300005719 | Ga0068861_100100196 | Ga0068861_1001001963 | 267 |
| 54 | 3300005985 | Ga0081539_10048313 | Ga0081539_100483132 | 267 |
| 55 | 3300013307 | Ga0157372_10005740 | Ga0157372_100057403 | 267 |
| 56 | 3300014325 | Ga0163163_10726640 | Ga0163163_107266402 | 267 |
| 57 | 3300025972 | Ga0207668_10083246 | Ga0207668_100832462 | 267 |
| 58 | 3300026118 | Ga0207675_100143329 | Ga0207675_1001433293 | 267 |
| 59 | 3300028794 | Ga0307515_10052633 | Ga0307515_100526333 | 267 |
| 60 | 3300028794 | Ga0307515_10101839 | Ga0307515_101018392 | 267 |
| 61 | 3300028794 | Ga0307515_10108372 | Ga0307515_101083722 | 267 |
| 62 | 3300030522 | Ga0307512_10061731 | Ga0307512_100617312 | 267 |
| 63 | 3300031456 | Ga0307513_10074070 | Ga0307513_100740703 | 267 |
| 64 | 3300031456 | Ga0307513_10211341 | Ga0307513_102113412 | 267 |
| 65 | 3300031616 | Ga0307508_10030740 | Ga0307508_100307403 | 267 |
| 66 | 3300031616 | Ga0307508_10194976 | Ga0307508_101949762 | 267 |
| 67 | 3300031649 | Ga0307514_10248891 | Ga0307514_102488912 | 267 |
| 68 | 3300031730 | Ga0307516_10046233 | Ga0307516_100462334 | 267 |
| 69 | 3300031730 | Ga0307516_10075709 | Ga0307516_100757093 | 267 |
| 70 | 3300031730 | Ga0307516_10322377 | Ga0307516_103223772 | 267 |
| 71 | 3300032126 | Ga0307415_100712534 | Ga0307415_1007125341 | 267 |
| 72 | 3300033179 | Ga0307507_10255960 | Ga0307507_102559602 | 267 |
| 73 | 3300035088 | Ga0373940_0000542 | Ga0373940_0000542_2396_3211 | 267 |
| 74 | 3300035207 | Ga0373942_0000550 | Ga0373942_0000550_3774_4589 | 267 |
| 75 | 3300035242 | Ga0373962_0017542 | Ga0373962_0017542_904_1719 | 267 |
| 76 | 3300048905 | Ga0496102_0297987 | Ga0496102_0297987_155_973 | 267 |
| 77 | 3300048907 | Ga0496104_0030736 | Ga0496104_0030736_1973_2791 | 267 |
| 78 | 3300048911 | Ga0496108_0000043 | Ga0496108_0000043_104004_104819 | 267 |
| 79 | 3300048913 | Ga0496110_0015616 | Ga0496110_0015616_1017_1835 | 267 |
| 80 | 3300048916 | Ga0496113_0196564 | Ga0496113_0196564_327_1145 | 267 |
| 81 | 3300053088 | Ga0500644_0004568 | Ga0500644_0004568_1039_1854 | 267 |
| 82 | 3300053093 | Ga0500651_0029173 | Ga0500651_0029173_2256_3071 | 267 |
| 83 | 3300053096 | Ga0500641_0061427 | Ga0500641_0061427_643_1458 | 267 |
| 84 | 3300053109 | Ga0500569_005512 | Ga0500569_005512_1203_2018 | 267 |
| 85 | 3300053136 | Ga0500559_0043259 | Ga0500559_0043259_705_1520 | 267 |
| 86 | 3300053146 | Ga0500588_0047192 | Ga0500588_0047192_469_1284 | 267 |
| 87 | 3300053149 | Ga0500600_0129959 | Ga0500600_0129959_184_999 | 267 |
| 88 | iso_pu_bacteria | 2515154088 | 2515496669 | 267 |
| 89 | iso_pu_bacteria | 2515154129 | 2515718329 | 267 |
| 90 | iso_pu_bacteria | 2515154137 | 2515756908 | 267 |
| 91 | iso_pu_bacteria | 2515154202 | 2516083511 | 267 |
| 92 | iso_pu_bacteria | 2515154203 | 2516089446 | 267 |
| 93 | iso_pu_bacteria | 2772190715 | 2772644911 | 267 |
| 94 | iso_pu_bacteria | 2832004796 | 2832006186 | 267 |
| 95 | iso_pu_bacteria | 2855670206 | 2855673772 | 267 |
| 96 | iso_pu_bacteria | 2855676851 | 2855681698 | 267 |
| 97 | iso_pu_bacteria | 2857288857 | 2857290697 | 267 |
| 98 | iso_pu_bacteria | 2858848962 | 2858850663 | 267 |
| 99 | iso_pu_bacteria | 2858882152 | 2858886259 | 267 |
| 100 | iso_pu_bacteria | 2858888857 | 2858890970 | 267 |
| 101 | iso_pu_bacteria | 2858895516 | 2858897651 | 267 |
| 102 | iso_pu_bacteria | 2866065130 | 2866068623 | 267 |
| 103 | iso_pu_bacteria | 2867302475 | 2867307143 | 267 |
| 104 | iso_pu_bacteria | 2867312974 | 2867319367 | 267 |
| 105 | iso_pu_bacteria | 2867319477 | 2867325494 | 267 |
| 106 | iso_pu_bacteria | 2867507094 | 2867510900 | 267 |
| 107 | iso_pu_bacteria | 2869048445 | 2869050039 | 267 |
| 108 | iso_pu_bacteria | 2869061728 | 2869063893 | 267 |
| 109 | iso_pu_bacteria | 2869068681 | 2869071847 | 267 |
| 110 | iso_pu_bacteria | 2880489317 | 2880495247 | 267 |
| 111 | iso_pu_bacteria | 2880495981 | 2880497098 | 267 |
| 112 | iso_pu_bacteria | 2929219909 | 2929225697 | 267 |
| 113 | iso_pu_bacteria | 2929226422 | 2929231328 | 267 |
| 114 | iso_pu_bacteria | 8003830390 | 8003835095 | 267 |
| 115 | iso_pu_bacteria | 8003856774 | 8003862035 | 267 |
| 116 | iso_pu_bacteria | 8003870546 | 8003872945 | 267 |
| 117 | iso_pu_bacteria | 8054704163 | 8054706687 | 267 |
| 118 | iso_pu_bacteria | 8054727385 | 8054733707 | 267 |
| 119 | iso_pu_bacteria | 8054734606 | 8054740734 | 267 |
| 120 | iso_pu_bacteria | 8055412473 | 8055415860 | 267 |
| 121 | 3300005985 | Ga0081539_10001279 | Ga0081539_100012794 | 268 |
| 122 | 3300025939 | Ga0207665_10430005 | Ga0207665_104300051 | 268 |
| 123 | 3300031730 | Ga0307516_10013922 | Ga0307516_100139227 | 268 |
| 124 | 3300044693 | Ga0466961_0272618 | Ga0466961_0272618_153_962 | 268 |
| 125 | iso_pu_bacteria | 2501939600 | 2501943359 | 268 |
| 126 | iso_pu_bacteria | 2622736626 | 2623585016 | 268 |
| 127 | iso_pu_bacteria | 2855683550 | 2855684540 | 268 |
| 128 | iso_pu_bacteria | 2856858025 | 2856858844 | 268 |
| 129 | iso_pu_bacteria | 2996221748 | 2996223730 | 268 |
| 130 | iso_pu_bacteria | 649633069 | 649810752 | 268 |
| 131 | 3300005436 | Ga0070713_100134446 | Ga0070713_1001344462 | 270 |
| 132 | 3300006844 | Ga0075428_100150112 | Ga0075428_1001501122 | 270 |
| 133 | 3300037068 | Ga0373925_0410853 | Ga0373925_0410853_227_1054 | 270 |
| 134 | 3300048907 | Ga0496104_0193408 | Ga0496104_0193408_621_1445 | 270 |
| 135 | 3300048908 | Ga0496105_0011539 | Ga0496105_0011539_1634_2458 | 270 |
| 136 | 3300048922 | Ga0496119_0007477 | Ga0496119_0007477_4147_4971 | 270 |
| 137 | 3300048923 | Ga0496120_0006720 | Ga0496120_0006720_3119_3943 | 270 |
| 138 | 3300048927 | Ga0496124_0038868 | Ga0496124_0038868_2823_3647 | 270 |
| 139 | 3300005841 | Ga0068863_100087950 | Ga0068863_1000879502 | 271 |
| 140 | 3300009101 | Ga0105247_10287503 | Ga0105247_102875031 | 271 |
| 141 | 3300014968 | Ga0157379_10038829 | Ga0157379_100388293 | 271 |
| 142 | 3300026088 | Ga0207641_10071181 | Ga0207641_100711812 | 271 |
| 143 | 3300044693 | Ga0466961_0078088 | Ga0466961_0078088_1027_1854 | 271 |
| 144 | 3300048904 | Ga0496101_0088150 | Ga0496101_0088150_1008_1835 | 271 |
| 145 | 3300048905 | Ga0496102_0000521 | Ga0496102_0000521_6971_7798 | 271 |
| 146 | 3300048906 | Ga0496103_0003400 | Ga0496103_0003400_4068_4895 | 271 |
| 147 | 3300048911 | Ga0496108_0076364 | Ga0496108_0076364_1916_2743 | 271 |
| 148 | 3300048919 | Ga0496116_0000173 | Ga0496116_0000173_4809_5636 | 271 |
| 149 | 3300048920 | Ga0496117_0006455 | Ga0496117_0006455_4150_4977 | 271 |
| 150 | 3300048921 | Ga0496118_0000096 | Ga0496118_0000096_67718_68545 | 271 |
| 151 | 3300048924 | Ga0496121_0038280 | Ga0496121_0038280_2079_2906 | 271 |
| 152 | 3300048929 | Ga0496126_0000330 | Ga0496126_0000330_95438_96265 | 271 |
| 153 | 3300048929 | Ga0496126_0028870 | Ga0496126_0028870_3583_4413 | 271 |
| 154 | 3300031548 | Ga0307408_100036868 | Ga0307408_1000368683 | 272 |
| 155 | 3300031824 | Ga0307413_10037748 | Ga0307413_100377482 | 272 |
| 156 | 3300031901 | Ga0307406_10004670 | Ga0307406_100046704 | 272 |
| 157 | 3300031911 | Ga0307412_10160642 | Ga0307412_101606422 | 272 |
| 158 | 3300031995 | Ga0307409_100008694 | Ga0307409_1000086944 | 272 |
| 159 | 3300032002 | Ga0307416_100041034 | Ga0307416_1000410343 | 272 |
| 160 | 3300032005 | Ga0307411_10291546 | Ga0307411_102915462 | 272 |
| 161 | 3300032126 | Ga0307415_100015068 | Ga0307415_1000150684 | 272 |
| 162 | 3300005985 | Ga0081539_10003532 | Ga0081539_1000353213 | 273 |
| 163 | 3300006844 | Ga0075428_100110272 | Ga0075428_1001102723 | 273 |
| 164 | 3300031456 | Ga0307513_10024355 | Ga0307513_100243551 | 273 |
| 165 | 3300038443 | Ga0395901_0011246 | Ga0395901_0011246_5698_6612 | 273 |
| 166 | 3300045976 | Ga0466967_0249512 | Ga0466967_0249512_398_1246 | 273 |
| 167 | iso_pu_bacteria | 2858868258 | 2858875128 | 273 |
| 168 | 3300031727 | Ga0316576_10001505 | Ga0316576_100015054 | 274 |
| 169 | 3300035398 | Ga0316574_0000119 | Ga0316574_0000119_19632_20489 | 274 |
| 170 | 3300048908 | Ga0496105_0067629 | Ga0496105_0067629_2050_2913 | 274 |
| 171 | 3300048917 | Ga0496114_0011899 | Ga0496114_0011899_1055_1918 | 274 |
| 172 | 3300049568 | Ga0501031_0180790 | Ga0501031_0180790_463_1302 | 275 |
| 173 | 3300049569 | Ga0501032_0038098 | Ga0501032_0038098_637_1476 | 275 |
| 174 | 3300049574 | Ga0501038_0010893 | Ga0501038_0010893_3223_4062 | 275 |
| 175 | 3300049575 | Ga0501039_0083458 | Ga0501039_0083458_61_900 | 275 |
| 176 | 3300049579 | Ga0501043_0225377 | Ga0501043_0225377_568_1407 | 275 |
| 177 | 3300049823 | Ga0501044_0103511 | Ga0501044_0103511_569_1408 | 275 |
| 178 | 3300005356 | Ga0070674_100363569 | Ga0070674_1003635691 | 276 |
| 179 | 3300014969 | Ga0157376_10122899 | Ga0157376_101228992 | 276 |
| 180 | 3300025927 | Ga0207687_10077296 | Ga0207687_100772962 | 276 |
| 181 | 3300048917 | Ga0496114_0019015 | Ga0496114_0019015_766_1629 | 276 |
| 182 | 3300005564 | Ga0070664_100052830 | Ga0070664_1000528302 | 277 |
| 183 | 3300009093 | Ga0105240_10066736 | Ga0105240_100667365 | 277 |
| 184 | 3300025913 | Ga0207695_10059568 | Ga0207695_100595683 | 277 |
| 185 | 3300048915 | Ga0496112_0337805 | Ga0496112_0337805_510_1364 | 277 |
| 186 | 3300048916 | Ga0496113_0008265 | Ga0496113_0008265_5133_5987 | 277 |
| 187 | 3300009098 | Ga0105245_10497619 | Ga0105245_104976191 | 278 |
| 188 | 3300013308 | Ga0157375_10244747 | Ga0157375_102447472 | 278 |
| 189 | 3300032004 | Ga0307414_10317979 | Ga0307414_103179791 | 278 |
| 190 | 3300048907 | Ga0496104_0366994 | Ga0496104_0366994_69_938 | 278 |
| 191 | 3300048918 | Ga0496115_0221082 | Ga0496115_0221082_673_1542 | 278 |
| 192 | 3300025937 | Ga0207669_10448456 | Ga0207669_104484561 | 279 |
| 193 | 3300048905 | Ga0496102_0004313 | Ga0496102_0004313_337_1188 | 279 |
| 194 | 3300005327 | Ga0070658_10007171 | Ga0070658_100071719 | 280 |
| 195 | 3300005435 | Ga0070714_100000013 | Ga0070714_10000001348 | 280 |
| 196 | 3300025909 | Ga0207705_10010110 | Ga0207705_100101103 | 280 |
| 197 | 3300025909 | Ga0207705_10063756 | Ga0207705_100637563 | 280 |
| 198 | 3300025929 | Ga0207664_10000001 | Ga0207664_10000001555 | 280 |
| 199 | 3300005614 | Ga0068856_100045093 | Ga0068856_1000450934 | 281 |
| 200 | 3300009093 | Ga0105240_10560102 | Ga0105240_105601021 | 281 |
| 201 | 3300010375 | Ga0105239_10003769 | Ga0105239_1000376916 | 281 |
| 202 | 3300025913 | Ga0207695_10398361 | Ga0207695_103983611 | 281 |
| 203 | 3300026078 | Ga0207702_10022623 | Ga0207702_100226233 | 281 |
| 204 | 3300048905 | Ga0496102_0035611 | Ga0496102_0035611_1344_2222 | 281 |
| 205 | 3300048907 | Ga0496104_0002317 | Ga0496104_0002317_11848_12726 | 281 |
| 206 | 3300048908 | Ga0496105_0002831 | Ga0496105_0002831_8794_9672 | 281 |
| 207 | 3300048911 | Ga0496108_0010365 | Ga0496108_0010365_6017_6895 | 281 |
| 208 | 3300048912 | Ga0496109_0000777 | Ga0496109_0000777_24772_25650 | 281 |
| 209 | 3300048913 | Ga0496110_0001890 | Ga0496110_0001890_9573_10451 | 281 |
| 210 | 3300048913 | Ga0496110_0152907 | Ga0496110_0152907_930_2018 | 281 |
| 211 | 3300048914 | Ga0496111_0000456 | Ga0496111_0000456_17661_18539 | 281 |
| 212 | 3300048917 | Ga0496114_0147507 | Ga0496114_0147507_725_1603 | 281 |
| 213 | 3300048922 | Ga0496119_0147328 | Ga0496119_0147328_32_928 | 283 |
| 214 | 3300021384 | Ga0213876_10001123 | Ga0213876_100011237 | 284 |
| 215 | 3300021388 | Ga0213875_10021512 | Ga0213875_100215123 | 284 |
| 216 | 3300037853 | Ga0436364_1001100 | Ga0436364_1001100_793_1650 | 284 |
| 217 | 3300039437 | Ga0436365_0484364 | Ga0436365_0484364_34182_35039 | 284 |
| 218 | 3300048929 | Ga0496126_0002802 | Ga0496126_0002802_21444_22304 | 284 |
| 219 | 3300046663 | Ga0495635_0349096 | Ga0495635_0349096_44_973 | 285 |
| 220 | 3300021388 | Ga0213875_10057142 | Ga0213875_100571423 | 286 |
| 221 | 3300048917 | Ga0496114_0148338 | Ga0496114_0148338_568_1500 | 286 |
| 222 | 3300005437 | Ga0070710_10255068 | Ga0070710_102550682 | 288 |
| 223 | 3300037853 | Ga0436364_1112074 | Ga0436364_1112074_2655_3527 | 288 |
| 224 | 3300039450 | Ga0436363_1218883 | Ga0436363_1218883_132_1004 | 288 |
| 225 | 3300005337 | Ga0070682_100116597 | Ga0070682_1001165972 | 289 |
| 226 | 3300011119 | Ga0105246_10281224 | Ga0105246_102812241 | 289 |
| 227 | 3300017792 | Ga0163161_10349559 | Ga0163161_103495591 | 289 |
| 228 | 3300026067 | Ga0207678_10096195 | Ga0207678_100961952 | 289 |
| 229 | 3300026095 | Ga0207676_10234143 | Ga0207676_102341432 | 289 |
| 230 | 3300026121 | Ga0207683_10060760 | Ga0207683_100607603 | 289 |
| 231 | 3300031251 | Ga0265327_10004321 | Ga0265327_100043211 | 289 |
| 232 | 3300041451 | Ga0451791_0197792 | Ga0451791_0197792_220_1179 | 289 |
| 233 | 3300041452 | Ga0451793_1287167 | Ga0451793_1287167_714_1673 | 289 |
| 234 | 3300044658 | Ga0466972_0006314 | Ga0466972_0006314_1045_1938 | 289 |
| 235 | 3300044683 | Ga0466965_0001455 | Ga0466965_0001455_7010_7903 | 289 |
| 236 | 3300044735 | Ga0466968_0000681 | Ga0466968_0000681_2589_3482 | 289 |
| 237 | 3300044765 | Ga0466970_0001829 | Ga0466970_0001829_1533_2426 | 289 |
| 238 | 3300044842 | Ga0466957_0002166 | Ga0466957_0002166_4595_5488 | 289 |
| 239 | 3300045049 | Ga0466959_0008129 | Ga0466959_0008129_5645_6538 | 289 |
| 240 | 3300009551 | Ga0105238_10420037 | Ga0105238_104200371 | 290 |
| 241 | 3300031251 | Ga0265327_10001834 | Ga0265327_1000183421 | 290 |
| 242 | 3300046533 | Ga0495640_0216902 | Ga0495640_0216902_174_1130 | 290 |
| 243 | 3300048917 | Ga0496114_0018581 | Ga0496114_0018581_4694_5611 | 290 |
| 244 | iso_pu_bacteria | 2643221687 | 2644490031 | 291 |
| 245 | iso_pu_bacteria | 2902837492 | 2902841663 | 291 |
| 246 | 3300003792 | Ga0055540_1025035 | Ga0055540_10250352 | 292 |
| 247 | 3300025303 | Ga0209051_1001558 | Ga0209051_10015585 | 292 |
| 248 | 3300047472 | Ga0495686_0015536 | Ga0495686_0015536_4235_5182 | 293 |
| 249 | 3300003792 | Ga0055540_1006390 | Ga0055540_10063902 | 295 |
| 250 | 3300025303 | Ga0209051_1004662 | Ga0209051_10046625 | 295 |
| 251 | 3300048904 | Ga0496101_0145087 | Ga0496101_0145087_53_1060 | 295 |
| 252 | 3300048915 | Ga0496112_0005166 | Ga0496112_0005166_4344_5381 | 295 |
| 253 | 3300048918 | Ga0496115_0246870 | Ga0496115_0246870_75_1112 | 295 |
| 254 | 3300048925 | Ga0496122_0027082 | Ga0496122_0027082_1842_2849 | 295 |
| 255 | 3300048929 | Ga0496126_0001948 | Ga0496126_0001948_127_1164 | 295 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2nre-assembly1.cif.gz_A-2 | crystal structure of pseudoudirinde synthase trua in complex with leucyl trna | 0.9038 | 10 | 269 |
| 8q70-assembly1.cif.gz_A-2 | trna pseudouridine synthase a homodimer | 0.8893 | 14 | 268 |
| 1vs3-assembly1.cif.gz_B | crystal structure of the trna pseudouridine synthase trua from thermus thermophilus hb8 | 0.888 | 13 | 269 |
| 1vs3-assembly1.cif.gz_B | crystal structure of the trna pseudouridine synthase trua from thermus thermophilus hb8 | 0.8745 | 13 | 269 |
| 2nr0-assembly1.cif.gz_B | crystal structure of pseudoudirinde synthase trua in complex with leucyl trna | 0.8704 | 10 | 287 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHP9_20_139_3.30.70.580 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain | 0.9977 | 11 | 129 | 3.30.70.580 |
| af_P9WHP9_140_277_3.30.70.660 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, C-terminal subdomain | 0.9854 | 130 | 267 | 3.30.70.660 |
| af_P9WHP9_20_139_3.30.70.580 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain | 0.9812 | 11 | 129 | 3.30.70.580 |
| af_P9WHP9_140_277_3.30.70.660 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, C-terminal subdomain | 0.9783 | 130 | 267 | 3.30.70.660 |
| af_C7J2E5_59_129_3.30.70.580 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain | 0.9455 | 14 | 75 | 3.30.70.580 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S8L0L8-F1-model_v4 | deleted | 0.9752 | 3 | 286 |
|
| AF-A0A318XGB4-F1-model_v4 | deleted | 0.9727 | 20 | 282 |
|
| AF-X8FIJ7-F1-model_v4 | deleted | 0.9705 | 76 | 286 |
|
| AF-A0A0H3MRM6-F1-model_v4 | tRNA pseudouridine synthase (EC 5.4.99.12) | 0.9668 | 43 | 283 |
GO:0003723
GO:0031119 GO:0160147 |
| AF-A0A372J8M2-F1-model_v4 | tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA pseudouridine(38-40) synthase) (tRNA pseudouridylate synthase I) (tRNA-uridine isomerase I) | 0.9652 | 1 | 286 |
GO:0003723
GO:0031119 GO:0160147 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar