F365899

General Info

Members Datasets Scaffolds Average Seq Length
255 179 229 110

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0027159|Ga0466969_0027159_1789_2118
Length 109
Sequence MSKRKGAVSHHDREVAELRADRELAVEYLKAAMEGLDDPDERGGALLALRAIAEAYGGGLGTVAAHAGISRETLYRTLSPKGNPTLKTLIAVLKTVGMRLSVEPDHATT

Samples

Sample ID Description Type Environment
1 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
2 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
3 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
4 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
5 2643221621 Achromobacter sp. Root83 Isolate Unclassified
6 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
7 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
8 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
9 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
10 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
11 2818991452 Burkholderia cepacia 561 Isolate Unclassified
12 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
13 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
14 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
15 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
16 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
17 2928163908 Burkholderia sp. 567 Isolate Unclassified
18 2928170801 Burkholderia sp. 572 Isolate Unclassified
19 2928536128 Burkholderia sola 565 Isolate Unclassified
20 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
21 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
22 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
23 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
24 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
25 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
26 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
27 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
28 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
29 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
30 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
31 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
32 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
33 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
34 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
35 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
36 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
37 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
70 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
73 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
102 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
103 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
104 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
114 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
115 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
116 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
117 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
118 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
119 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
120 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
121 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
124 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
125 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
126 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
127 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
133 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
144 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
145 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
146 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
160 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
161 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
162 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
163 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
164 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
168 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
169 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
170 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
172 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
173 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
174 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
175 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
176 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
177 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
178 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
179 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.8
Metatranscriptomes 0
Isolates 10.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.59
Nodule 0.39
Rhizoplane 3.92
Rhizosphere 78.04
Stem 0
Stem Tuber 0
Unclassified 7.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10045433 3300001979 Bacteria 1296
2 JGI24739J22299_10024286 3300001989 Bacteria 2138
3 JGI24739J22299_10031323 3300001989 Bacteria 1838
4 JGI24735J21928_10077791 3300002067 Bacteria 950
5 rootH1_10147858 3300003316 Bacteria 1264
6 rootH2_10158057 3300003320 Bacteria 2499
7 rootL2_10212312 3300003322 Bacteria 3032
8 rootL2_10321621 3300003322 Bacteria 1097
9 Ga0055538_1000002 3300003751 Bacteria 999437
10 Ga0055539_1000002 3300003752 Bacteria 999437
11 Ga0055533_1000004 3300003756 Bacteria 999437
12 Ga0055532_1000566 3300003758 Bacteria 15510
13 Ga0055532_1000574 3300003758 Bacteria 15171
14 Ga0055525_1000002 3300003759 Bacteria 999437
15 Ga0055527_1000201 3300003760 Bacteria 39354
16 Ga0055535_1000217 3300003761 Bacteria 60534
17 Ga0055542_1000253 3300003762 Bacteria 60534
18 Ga0055529_1000183 3300003763 Bacteria 86414
19 Ga0055541_1000002 3300003841 Bacteria 896405
20 Ga0058692_1011896 3300003856 Bacteria 2084
21 Ga0070658_10022789 3300005327 Bacteria 5025
22 Ga0068869_100664994 3300005334 Bacteria 885
23 Ga0070660_100000788 3300005339 Bacteria 21081
24 Ga0070661_100100348 3300005344 Bacteria 2152
25 Ga0070659_100000033 3300005366 Bacteria 117255
26 Ga0070659_100081085 3300005366 Bacteria 2591
27 Ga0070714_100191553 3300005435 Bacteria 1866
28 Ga0070663_100000202 3300005455 Bacteria 29607
29 Ga0070684_100156704 3300005535 Bacteria 2065
30 Ga0068853_101625909 3300005539 Bacteria 626
31 Ga0068855_100000065 3300005563 Bacteria 129307
32 Ga0068855_100035772 3300005563 Bacteria 5915
33 Ga0068855_100590324 3300005563 Bacteria 1199
34 Ga0070664_100617410 3300005564 Bacteria 1006
35 Ga0068857_100078249 3300005577 Bacteria 2952
36 Ga0068857_101703187 3300005577 Bacteria 616
37 Ga0068856_100191286 3300005614 Bacteria 2060
38 Ga0068852_100001887 3300005616 Bacteria 14281
39 Ga0075366_10219809 3300006195 Bacteria 1157
40 Ga0075428_100389289 3300006844 Unclassified 1494
41 Ga0075429_100116728 3300006880 Bacteria 2333
42 Ga0105250_10003828 3300009092 Bacteria 7058
43 Ga0105240_10004798 3300009093 Bacteria 20381
44 Ga0105240_10017557 3300009093 Bacteria 9640
45 Ga0111539_10111844 3300009094 Bacteria 3204
46 Ga0105243_10000106 3300009148 Bacteria 95432
47 Ga0105241_11343386 3300009174 Bacteria 682
48 Ga0105242_10692740 3300009176 Unclassified 996
49 Ga0105242_12805797 3300009176 Unclassified 537
50 Ga0105237_10003270 3300009545 Bacteria 19355
51 Ga0105237_10209251 3300009545 Bacteria 1950
52 Ga0105238_10208761 3300009551 Bacteria 1929
53 Ga0105238_10333941 3300009551 Unclassified 1503
54 Ga0105239_10063568 3300010375 Bacteria 4053
55 Ga0157373_10672853 3300013100 Unclassified 757
56 Ga0157370_10036783 3300013104 Bacteria 4749
57 Ga0157370_10159946 3300013104 Bacteria 2096
58 Ga0157378_11265546 3300013297 Bacteria 778
59 Ga0157372_10024783 3300013307 Bacteria 6519
60 Ga0157375_10629995 3300013308 Bacteria 1230
61 Ga0182006_1030809 3300015261 Bacteria 2166
62 Ga0182007_10020293 3300015262 Bacteria 2378
63 Ga0163161_10448539 3300017792 Bacteria 1042
64 Ga0213872_10145198 3300021361 Bacteria 1039
65 Ga0209784_100002 3300025224 Bacteria 1753105
66 Ga0209566_100003 3300025225 Bacteria 1753105
67 Ga0209566_100788 3300025225 Bacteria 16743
68 Ga0209674_100004 3300025226 Bacteria 1753105
69 Ga0209674_103608 3300025226 Bacteria 2783
70 Ga0209672_100030 3300025228 Bacteria 337051
71 Ga0209147_100036 3300025229 Bacteria 337052
72 Ga0209147_100074 3300025229 Bacteria 208743
73 Ga0209563_100006 3300025230 Bacteria 1753105
74 Ga0209258_100056 3300025242 Bacteria 337051
75 Ga0209677_100003 3300025253 Bacteria 1753105
76 Ga0209148_1000178 3300025254 Bacteria 126383
77 Ga0209455_1000061 3300025272 Bacteria 337052
78 Ga0207647_10002886 3300025904 Bacteria 12953
79 Ga0207705_10261730 3300025909 Bacteria 1321
80 Ga0207695_10000171 3300025913 Bacteria 191448
81 Ga0207695_10015290 3300025913 Bacteria 9044
82 Ga0207657_10000002 3300025919 Bacteria 444378
83 Ga0207649_10133513 3300025920 Bacteria 1689
84 Ga0207694_10299044 3300025924 Bacteria 1325
85 Ga0207664_10143642 3300025929 Bacteria 2022
86 Ga0207690_10000011 3300025932 Bacteria 295252
87 Ga0207690_10278961 3300025932 Bacteria 1301
88 Ga0207709_10000077 3300025935 Bacteria 169923
89 Ga0207679_10775090 3300025945 Bacteria 873
90 Ga0207667_10000025 3300025949 Bacteria 350159
91 Ga0207667_10030761 3300025949 Bacteria 5802
92 Ga0207639_12137121 3300026041 Bacteria 521
93 Ga0207678_10000742 3300026067 Bacteria 29873
94 Ga0207702_10108159 3300026078 Bacteria 2467
95 Ga0207698_10009000 3300026142 Bacteria 6340
96 Ga0209371_1000213 3300027312 Bacteria 79996
97 Ga0265336_10001427 3300028666 Bacteria 10938
98 Ga0265336_10236182 3300028666 Bacteria 543
99 Ga0265338_10045137 3300028800 Bacteria 4057
100 Ga0265324_10006664 3300029957 Bacteria 4776
101 Ga0265324_10221012 3300029957 Bacteria 643
102 Ga0268256_1000170 3300030500 Bacteria 79996
103 Ga0265331_10021549 3300031250 Unclassified 3296
104 Ga0265327_10000608 3300031251 Bacteria 59434
105 Ga0265327_10001938 3300031251 Bacteria 23803
106 Ga0265327_10108338 3300031251 Bacteria 1331
107 Ga0265327_10132539 3300031251 Bacteria 1171
108 Ga0265316_10656646 3300031344 Bacteria 741
109 Ga0265314_10374898 3300031711 Bacteria 776
110 Ga0307510_10004601 3300033180 Bacteria 16260
111 Ga0373937_0186240 3300036401 Unclassified 1950
112 Ga0373937_0644263 3300036401 Bacteria 1005
113 Ga0395899_0000023 3300037312 Bacteria 367159
114 Ga0395899_0010582 3300037312 Bacteria 7070
115 Ga0395899_0223941 3300037312 Bacteria 1302
116 Ga0395900_0000019 3300037418 Bacteria 357240
117 Ga0395900_0014358 3300037418 Bacteria 8085
118 Ga0395900_0027612 3300037418 Bacteria 5814
119 Ga0395898_0000016 3300037466 Bacteria 435585
120 Ga0395898_0001476 3300037466 Bacteria 32826
121 Ga0395898_0067248 3300037466 Bacteria 3470
122 Ga0395901_0000040 3300038443 Bacteria 204677
123 Ga0395901_0007307 3300038443 Bacteria 11150
124 Ga0395901_0145455 3300038443 Bacteria 2491
125 Ga0436361_0440515 3300039447 Bacteria 4940
126 Ga0436361_0648621 3300039447 Bacteria 1198
127 Ga0436361_0651885 3300039447 Bacteria 757
128 Ga0436361_1131613 3300039447 Bacteria 1256
129 Ga0439436_0042636 3300041404 Bacteria 1296
130 Ga0451853_3191556 3300041512 Unclassified 674
131 Ga0451577_0106336 3300042876 Bacteria 2508
132 Ga0466969_0027159 3300044656 Bacteria 2931
133 Ga0466969_0121343 3300044656 Unclassified 1216
134 Ga0466972_0231570 3300044658 Bacteria 864
135 Ga0466972_0471417 3300044658 Unclassified 590
136 Ga0466965_0002766 3300044683 Bacteria 7536
137 Ga0466965_0305179 3300044683 Bacteria 864
138 Ga0466966_0000172 3300044684 Bacteria 42586
139 Ga0466966_0003506 3300044684 Bacteria 10346
140 Ga0466966_0036424 3300044684 Bacteria 3176
141 Ga0466966_0052905 3300044684 Bacteria 2577
142 Ga0466961_0000169 3300044693 Bacteria 44408
143 Ga0466961_0000848 3300044693 Bacteria 19115
144 Ga0466961_0114580 3300044693 Bacteria 1694
145 Ga0466961_0233142 3300044693 Bacteria 1132
146 Ga0466963_0013367 3300044694 Bacteria 5040
147 Ga0466964_0013429 3300044706 Bacteria 3108
148 Ga0453684_0000296 3300044712 Bacteria 211075
149 Ga0453684_0330845 3300044712 Bacteria 1723
150 Ga0453684_1067185 3300044712 Unclassified 855
151 Ga0466971_0021966 3300044719 Bacteria 2840
152 Ga0466971_0261445 3300044719 Unclassified 826
153 Ga0466968_0019659 3300044735 Bacteria 2720
154 Ga0466970_0105826 3300044765 Bacteria 1534
155 Ga0466970_0126533 3300044765 Unclassified 1401
156 Ga0466957_0012197 3300044842 Bacteria 4973
157 Ga0466957_0058653 3300044842 Bacteria 2358
158 Ga0466957_0323463 3300044842 Unclassified 1041
159 Ga0466959_0006460 3300045049 Bacteria 8120
160 Ga0466959_0054860 3300045049 Bacteria 2910
161 Ga0466959_0421076 3300045049 Bacteria 906
162 Ga0451576_0014927 3300045051 Bacteria 8628
163 Ga0451576_0151805 3300045051 Bacteria 2416
164 Ga0451576_0158482 3300045051 Bacteria 2361
165 Ga0466958_0118289 3300045836 Bacteria 1657
166 Ga0466958_0150962 3300045836 Bacteria 1465
167 Ga0495618_0423892 3300046514 Bacteria 811
168 Ga0495642_0055061 3300046528 Bacteria 1641
169 Ga0495667_0746125 3300046559 Bacteria 605
170 Ga0495604_0638616 3300047317 Bacteria 680
171 Ga0495604_0692578 3300047317 Bacteria 647
172 Ga0495604_0731546 3300047317 Unclassified 627
173 Ga0495602_0687247 3300048088 Bacteria 696
174 Ga0496108_0159075 3300048911 Bacteria 1951
175 Ga0496109_0176016 3300048912 Bacteria 2008
176 Ga0496110_0187266 3300048913 Bacteria 1879
177 Ga0496111_0181268 3300048914 Bacteria 1565
178 Ga0496113_0665092 3300048916 Unclassified 832
179 Ga0496114_0001961 3300048917 Bacteria 15647
180 Ga0496117_0094924 3300048920 Bacteria 1907
181 Ga0496118_0027802 3300048921 Bacteria 4777
182 Ga0496126_0068637 3300048929 Bacteria 3164
183 Ga0501031_0037450 3300049568 Bacteria 3164
184 Ga0501032_0188946 3300049569 Bacteria 1346
185 Ga0501032_0251651 3300049569 Bacteria 1147
186 Ga0501032_0352185 3300049569 Bacteria 948
187 Ga0501032_0377106 3300049569 Bacteria 912
188 Ga0501033_0012327 3300049570 Bacteria 6525
189 Ga0501034_0042623 3300049571 Bacteria 4594
190 Ga0501036_0022388 3300049572 Bacteria 5314
191 Ga0501036_0127128 3300049572 Bacteria 2152
192 Ga0501037_0150597 3300049573 Bacteria 1663
193 Ga0501037_0188501 3300049573 Unclassified 1461
194 Ga0501037_0500267 3300049573 Bacteria 824
195 Ga0501038_0015909 3300049574 Bacteria 6835
196 Ga0501038_0052861 3300049574 Bacteria 3500
197 Ga0501038_1397457 3300049574 Bacteria 503
198 Ga0501039_0015414 3300049575 Bacteria 5850
199 Ga0501039_0271883 3300049575 Unclassified 1332
200 Ga0501039_0417403 3300049575 Bacteria 1054
201 Ga0501039_0429013 3300049575 Bacteria 1038
202 Ga0501040_0007210 3300049576 Bacteria 7199
203 Ga0501040_0218093 3300049576 Unclassified 1357
204 Ga0501043_0055893 3300049579 Bacteria 3100
205 Ga0501043_0105417 3300049579 Bacteria 2215
206 Ga0501046_0763995 3300049580 Bacteria 678
207 Ga0501047_0075200 3300049581 Bacteria 3250
208 Ga0501048_0638328 3300049582 Bacteria 764
209 Ga0501072_0166578 3300049588 Bacteria 1758
210 Ga0501074_1045277 3300049590 Unclassified 574
211 Ga0501077_0300316 3300049593 Bacteria 1023
212 Ga0501079_0287072 3300049741 Bacteria 1287
213 Ga0501081_0124417 3300049743 Bacteria 1839
214 Ga0501083_0297331 3300049744 Bacteria 1050
215 Ga0501035_0004274 3300049822 Bacteria 13560
216 Ga0501035_0024471 3300049822 Bacteria 5535
217 Ga0501035_1167154 3300049822 Bacteria 599
218 Ga0501044_0000540 3300049823 Bacteria 45953
219 Ga0501044_0060512 3300049823 Bacteria 3877
220 Ga0501044_0102132 3300049823 Bacteria 2884
221 Ga0501044_1420174 3300049823 Bacteria 559
222 Ga0501045_0034266 3300049824 Bacteria 3685
223 Ga0495619_0259901 3300053085 Bacteria 1203
224 Ga0500634_0384636 3300053161 Bacteria 523
225 Ga0500636_0441996 3300053177 Unclassified 591
226 Ga0501082_0192677 3300060353 Bacteria 1773
227 Ga0466962_0013692 3300061719 Bacteria 3904
228 Ga0466962_0101667 3300061719 Unclassified 1380
229 Ga0530510_0369715 3300061734 Bacteria 1078

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003316 rootH1_10147858 rootH1_101478582 95
2 3300013100 Ga0157373_10672853 Ga0157373_106728531 102
3 3300044842 Ga0466957_0058653 Ga0466957_0058653_1550_1864 104
4 iso_pu_bacteria 2515154123 2515690089 104
5 3300049575 Ga0501039_0271883 Ga0501039_0271883_163_480 105
6 iso_pu_bacteria 2599185239 2599735760 105
7 iso_pu_bacteria 2599185240 2599743654 105
8 iso_pu_bacteria 2599185355 2600209202 105
9 iso_pu_bacteria 2675903129 2676742560 105
10 iso_pu_bacteria 2808606386 2808983337 105
11 iso_pu_bacteria 2808606415 2809128555 105
12 iso_pu_bacteria 2808606419 2809148176 105
13 iso_pu_bacteria 2818991452 2819630200 105
14 iso_pu_bacteria 2852618963 2852620406 105
15 iso_pu_bacteria 2863421361 2863423479 105
16 iso_pu_bacteria 2870068957 2870074638 105
17 iso_pu_bacteria 2928157003 2928157918 105
18 iso_pu_bacteria 2928163908 2928165682 105
19 iso_pu_bacteria 2928170801 2928173834 105
20 iso_pu_bacteria 2928536128 2928536941 105
21 iso_pu_bacteria 2981990288 2981990924 105
22 iso_pu_bacteria 641736154 642416837 105
23 iso_pu_bacteria 8018845410 8018853038 105
24 iso_pu_bacteria 8020938398 8020940655 105
25 iso_pu_bacteria 8020945358 8020953006 105
26 iso_pu_bacteria 8020953355 8020954236 105
27 iso_pu_bacteria 8021120328 8021121253 105
28 3300039447 Ga0436361_0440515 Ga0436361_0440515_4426_4746 106
29 iso_pu_bacteria 2643221621 2644122893 107
30 iso_pu_bacteria 2857537821 2857539757 107
31 3300033180 Ga0307510_10004601 Ga0307510_1000460112 108
32 3300044656 Ga0466969_0027159 Ga0466969_0027159_1789_2118 108
33 3300044684 Ga0466966_0052905 Ga0466966_0052905_498_827 108
34 3300044693 Ga0466961_0233142 Ga0466961_0233142_256_585 108
35 3300044765 Ga0466970_0105826 Ga0466970_0105826_698_1027 108
36 3300045049 Ga0466959_0006460 Ga0466959_0006460_2023_2352 108
37 3300001979 JGI24740J21852_10045433 JGI24740J21852_100454333 109
38 3300001989 JGI24739J22299_10024286 JGI24739J22299_100242862 109
39 3300001989 JGI24739J22299_10031323 JGI24739J22299_100313233 109
40 3300002067 JGI24735J21928_10077791 JGI24735J21928_100777912 109
41 3300003320 rootH2_10158057 rootH2_101580572 109
42 3300003322 rootL2_10212312 rootL2_102123123 109
43 3300003322 rootL2_10321621 rootL2_103216212 109
44 3300003751 Ga0055538_1000002 Ga0055538_1000002247 109
45 3300003752 Ga0055539_1000002 Ga0055539_1000002247 109
46 3300003756 Ga0055533_1000004 Ga0055533_1000004247 109
47 3300003758 Ga0055532_1000566 Ga0055532_10005667 109
48 3300003758 Ga0055532_1000574 Ga0055532_10005748 109
49 3300003759 Ga0055525_1000002 Ga0055525_1000002247 109
50 3300003760 Ga0055527_1000201 Ga0055527_10002012 109
51 3300003761 Ga0055535_1000217 Ga0055535_100021715 109
52 3300003762 Ga0055542_1000253 Ga0055542_100025315 109
53 3300003763 Ga0055529_1000183 Ga0055529_100018341 109
54 3300003841 Ga0055541_1000002 Ga0055541_1000002595 109
55 3300003856 Ga0058692_1011896 Ga0058692_10118962 109
56 3300005327 Ga0070658_10022789 Ga0070658_100227892 109
57 3300005334 Ga0068869_100664994 Ga0068869_1006649941 109
58 3300005339 Ga0070660_100000788 Ga0070660_10000078819 109
59 3300005344 Ga0070661_100100348 Ga0070661_1001003482 109
60 3300005366 Ga0070659_100000033 Ga0070659_10000003345 109
61 3300005366 Ga0070659_100081085 Ga0070659_1000810853 109
62 3300005435 Ga0070714_100191553 Ga0070714_1001915532 109
63 3300005455 Ga0070663_100000202 Ga0070663_10000020210 109
64 3300005535 Ga0070684_100156704 Ga0070684_1001567042 109
65 3300005539 Ga0068853_101625909 Ga0068853_1016259092 109
66 3300005563 Ga0068855_100000065 Ga0068855_1000000659 109
67 3300005563 Ga0068855_100035772 Ga0068855_1000357725 109
68 3300005563 Ga0068855_100590324 Ga0068855_1005903243 109
69 3300005564 Ga0070664_100617410 Ga0070664_1006174102 109
70 3300005577 Ga0068857_100078249 Ga0068857_1000782492 109
71 3300005577 Ga0068857_101703187 Ga0068857_1017031872 109
72 3300005614 Ga0068856_100191286 Ga0068856_1001912862 109
73 3300005616 Ga0068852_100001887 Ga0068852_1000018876 109
74 3300006195 Ga0075366_10219809 Ga0075366_102198093 109
75 3300006844 Ga0075428_100389289 Ga0075428_1003892892 109
76 3300006880 Ga0075429_100116728 Ga0075429_1001167283 109
77 3300009092 Ga0105250_10003828 Ga0105250_1000382810 109
78 3300009093 Ga0105240_10004798 Ga0105240_100047989 109
79 3300009093 Ga0105240_10017557 Ga0105240_100175574 109
80 3300009094 Ga0111539_10111844 Ga0111539_101118441 109
81 3300009148 Ga0105243_10000106 Ga0105243_1000010671 109
82 3300009174 Ga0105241_11343386 Ga0105241_113433862 109
83 3300009176 Ga0105242_10692740 Ga0105242_106927402 109
84 3300009176 Ga0105242_12805797 Ga0105242_128057971 109
85 3300009545 Ga0105237_10003270 Ga0105237_100032704 109
86 3300009545 Ga0105237_10209251 Ga0105237_102092513 109
87 3300009551 Ga0105238_10208761 Ga0105238_102087612 109
88 3300009551 Ga0105238_10333941 Ga0105238_103339412 109
89 3300010375 Ga0105239_10063568 Ga0105239_100635684 109
90 3300013104 Ga0157370_10036783 Ga0157370_100367834 109
91 3300013104 Ga0157370_10159946 Ga0157370_101599466 109
92 3300013297 Ga0157378_11265546 Ga0157378_112655462 109
93 3300013307 Ga0157372_10024783 Ga0157372_100247832 109
94 3300013308 Ga0157375_10629995 Ga0157375_106299952 109
95 3300015261 Ga0182006_1030809 Ga0182006_10308094 109
96 3300015262 Ga0182007_10020293 Ga0182007_100202932 109
97 3300017792 Ga0163161_10448539 Ga0163161_104485392 109
98 3300021361 Ga0213872_10145198 Ga0213872_101451982 109
99 3300025224 Ga0209784_100002 Ga0209784_100002480 109
100 3300025225 Ga0209566_100003 Ga0209566_100003480 109
101 3300025225 Ga0209566_100788 Ga0209566_10078817 109
102 3300025226 Ga0209674_100004 Ga0209674_100004480 109
103 3300025226 Ga0209674_103608 Ga0209674_1036083 109
104 3300025228 Ga0209672_100030 Ga0209672_100030293 109
105 3300025229 Ga0209147_100036 Ga0209147_10003646 109
106 3300025229 Ga0209147_100074 Ga0209147_100074140 109
107 3300025230 Ga0209563_100006 Ga0209563_100006480 109
108 3300025242 Ga0209258_100056 Ga0209258_100056293 109
109 3300025253 Ga0209677_100003 Ga0209677_100003480 109
110 3300025254 Ga0209148_1000178 Ga0209148_100017875 109
111 3300025272 Ga0209455_1000061 Ga0209455_100006146 109
112 3300025904 Ga0207647_10002886 Ga0207647_100028867 109
113 3300025909 Ga0207705_10261730 Ga0207705_102617302 109
114 3300025913 Ga0207695_10000171 Ga0207695_10000171112 109
115 3300025913 Ga0207695_10015290 Ga0207695_100152904 109
116 3300025919 Ga0207657_10000002 Ga0207657_10000002157 109
117 3300025920 Ga0207649_10133513 Ga0207649_101335132 109
118 3300025924 Ga0207694_10299044 Ga0207694_102990441 109
119 3300025929 Ga0207664_10143642 Ga0207664_101436421 109
120 3300025932 Ga0207690_10000011 Ga0207690_1000001168 109
121 3300025932 Ga0207690_10278961 Ga0207690_102789613 109
122 3300025935 Ga0207709_10000077 Ga0207709_1000007796 109
123 3300025945 Ga0207679_10775090 Ga0207679_107750902 109
124 3300025949 Ga0207667_10000025 Ga0207667_1000002550 109
125 3300025949 Ga0207667_10030761 Ga0207667_100307615 109
126 3300026041 Ga0207639_12137121 Ga0207639_121371212 109
127 3300026067 Ga0207678_10000742 Ga0207678_1000074214 109
128 3300026078 Ga0207702_10108159 Ga0207702_101081593 109
129 3300026142 Ga0207698_10009000 Ga0207698_100090004 109
130 3300027312 Ga0209371_1000213 Ga0209371_100021360 109
131 3300028666 Ga0265336_10001427 Ga0265336_100014279 109
132 3300028666 Ga0265336_10236182 Ga0265336_102361821 109
133 3300028800 Ga0265338_10045137 Ga0265338_100451372 109
134 3300029957 Ga0265324_10006664 Ga0265324_100066645 109
135 3300029957 Ga0265324_10221012 Ga0265324_102210122 109
136 3300030500 Ga0268256_1000170 Ga0268256_100017060 109
137 3300031250 Ga0265331_10021549 Ga0265331_100215492 109
138 3300031251 Ga0265327_10000608 Ga0265327_1000060847 109
139 3300031251 Ga0265327_10001938 Ga0265327_1000193814 109
140 3300031251 Ga0265327_10108338 Ga0265327_101083381 109
141 3300031251 Ga0265327_10132539 Ga0265327_101325393 109
142 3300031344 Ga0265316_10656646 Ga0265316_106566461 109
143 3300031711 Ga0265314_10374898 Ga0265314_103748982 109
144 3300036401 Ga0373937_0186240 Ga0373937_0186240_775_1122 109
145 3300036401 Ga0373937_0644263 Ga0373937_0644263_243_572 109
146 3300037312 Ga0395899_0000023 Ga0395899_0000023_147510_147857 109
147 3300037312 Ga0395899_0010582 Ga0395899_0010582_3032_3361 109
148 3300037312 Ga0395899_0223941 Ga0395899_0223941_830_1162 109
149 3300037418 Ga0395900_0000019 Ga0395900_0000019_219303_219650 109
150 3300037418 Ga0395900_0014358 Ga0395900_0014358_3708_4037 109
151 3300037418 Ga0395900_0027612 Ga0395900_0027612_3088_3420 109
152 3300037466 Ga0395898_0000016 Ga0395898_0000016_214452_214799 109
153 3300037466 Ga0395898_0001476 Ga0395898_0001476_8004_8336 109
154 3300037466 Ga0395898_0067248 Ga0395898_0067248_1133_1480 109
155 3300038443 Ga0395901_0000040 Ga0395901_0000040_96553_96900 109
156 3300038443 Ga0395901_0007307 Ga0395901_0007307_8677_9006 109
157 3300038443 Ga0395901_0145455 Ga0395901_0145455_1449_1781 109
158 3300039447 Ga0436361_0648621 Ga0436361_0648621_421_768 109
159 3300039447 Ga0436361_0651885 Ga0436361_0651885_127_474 109
160 3300039447 Ga0436361_1131613 Ga0436361_1131613_264_602 109
161 3300041404 Ga0439436_0042636 Ga0439436_0042636_21_356 109
162 3300041512 Ga0451853_3191556 Ga0451853_3191556_235_582 109
163 3300042876 Ga0451577_0106336 Ga0451577_0106336_1849_2181 109
164 3300044656 Ga0466969_0121343 Ga0466969_0121343_574_921 109
165 3300044658 Ga0466972_0231570 Ga0466972_0231570_215_562 109
166 3300044658 Ga0466972_0471417 Ga0466972_0471417_106_453 109
167 3300044683 Ga0466965_0002766 Ga0466965_0002766_505_852 109
168 3300044683 Ga0466965_0305179 Ga0466965_0305179_494_823 109
169 3300044684 Ga0466966_0000172 Ga0466966_0000172_29467_29814 109
170 3300044684 Ga0466966_0003506 Ga0466966_0003506_5027_5374 109
171 3300044684 Ga0466966_0036424 Ga0466966_0036424_2316_2663 109
172 3300044693 Ga0466961_0000169 Ga0466961_0000169_4050_4397 109
173 3300044693 Ga0466961_0000848 Ga0466961_0000848_10965_11312 109
174 3300044693 Ga0466961_0114580 Ga0466961_0114580_316_645 109
175 3300044694 Ga0466963_0013367 Ga0466963_0013367_568_915 109
176 3300044706 Ga0466964_0013429 Ga0466964_0013429_2157_2486 109
177 3300044712 Ga0453684_0000296 Ga0453684_0000296_208844_209173 109
178 3300044712 Ga0453684_0330845 Ga0453684_0330845_1156_1488 109
179 3300044712 Ga0453684_1067185 Ga0453684_1067185_459_791 109
180 3300044719 Ga0466971_0021966 Ga0466971_0021966_1747_2094 109
181 3300044719 Ga0466971_0261445 Ga0466971_0261445_265_594 109
182 3300044735 Ga0466968_0019659 Ga0466968_0019659_1915_2262 109
183 3300044765 Ga0466970_0126533 Ga0466970_0126533_552_899 109
184 3300044842 Ga0466957_0012197 Ga0466957_0012197_156_503 109
185 3300044842 Ga0466957_0323463 Ga0466957_0323463_425_772 109
186 3300045049 Ga0466959_0054860 Ga0466959_0054860_271_618 109
187 3300045049 Ga0466959_0421076 Ga0466959_0421076_102_449 109
188 3300045051 Ga0451576_0014927 Ga0451576_0014927_6869_7216 109
189 3300045051 Ga0451576_0151805 Ga0451576_0151805_599_928 109
190 3300045051 Ga0451576_0158482 Ga0451576_0158482_971_1303 109
191 3300045836 Ga0466958_0118289 Ga0466958_0118289_607_954 109
192 3300045836 Ga0466958_0150962 Ga0466958_0150962_976_1323 109
193 3300046514 Ga0495618_0423892 Ga0495618_0423892_436_765 109
194 3300046528 Ga0495642_0055061 Ga0495642_0055061_695_1042 109
195 3300046559 Ga0495667_0746125 Ga0495667_0746125_83_412 109
196 3300047317 Ga0495604_0638616 Ga0495604_0638616_130_459 109
197 3300047317 Ga0495604_0692578 Ga0495604_0692578_308_637 109
198 3300047317 Ga0495604_0731546 Ga0495604_0731546_245_592 109
199 3300048088 Ga0495602_0687247 Ga0495602_0687247_188_517 109
200 3300048911 Ga0496108_0159075 Ga0496108_0159075_319_666 109
201 3300048912 Ga0496109_0176016 Ga0496109_0176016_1513_1860 109
202 3300048913 Ga0496110_0187266 Ga0496110_0187266_313_660 109
203 3300048914 Ga0496111_0181268 Ga0496111_0181268_65_412 109
204 3300048916 Ga0496113_0665092 Ga0496113_0665092_452_799 109
205 3300048917 Ga0496114_0001961 Ga0496114_0001961_13986_14333 109
206 3300048920 Ga0496117_0094924 Ga0496117_0094924_1503_1832 109
207 3300048921 Ga0496118_0027802 Ga0496118_0027802_1105_1434 109
208 3300048929 Ga0496126_0068637 Ga0496126_0068637_1826_2155 109
209 3300049568 Ga0501031_0037450 Ga0501031_0037450_376_705 109
210 3300049569 Ga0501032_0188946 Ga0501032_0188946_988_1317 109
211 3300049569 Ga0501032_0251651 Ga0501032_0251651_273_620 109
212 3300049569 Ga0501032_0352185 Ga0501032_0352185_127_456 109
213 3300049569 Ga0501032_0377106 Ga0501032_0377106_154_483 109
214 3300049570 Ga0501033_0012327 Ga0501033_0012327_2665_3012 109
215 3300049571 Ga0501034_0042623 Ga0501034_0042623_1891_2220 109
216 3300049572 Ga0501036_0022388 Ga0501036_0022388_2375_2704 109
217 3300049572 Ga0501036_0127128 Ga0501036_0127128_262_627 109
218 3300049573 Ga0501037_0150597 Ga0501037_0150597_508_855 109
219 3300049573 Ga0501037_0188501 Ga0501037_0188501_1081_1422 109
220 3300049573 Ga0501037_0500267 Ga0501037_0500267_376_705 109
221 3300049574 Ga0501038_0015909 Ga0501038_0015909_1104_1451 109
222 3300049574 Ga0501038_0052861 Ga0501038_0052861_825_1154 109
223 3300049574 Ga0501038_1397457 Ga0501038_1397457_110_457 109
224 3300049575 Ga0501039_0015414 Ga0501039_0015414_4649_4978 109
225 3300049575 Ga0501039_0417403 Ga0501039_0417403_632_979 109
226 3300049575 Ga0501039_0429013 Ga0501039_0429013_526_873 109
227 3300049576 Ga0501040_0007210 Ga0501040_0007210_907_1236 109
228 3300049576 Ga0501040_0218093 Ga0501040_0218093_659_988 109
229 3300049579 Ga0501043_0055893 Ga0501043_0055893_404_733 109
230 3300049579 Ga0501043_0105417 Ga0501043_0105417_1876_2205 109
231 3300049580 Ga0501046_0763995 Ga0501046_0763995_59_388 109
232 3300049581 Ga0501047_0075200 Ga0501047_0075200_588_917 109
233 3300049582 Ga0501048_0638328 Ga0501048_0638328_364_693 109
234 3300049588 Ga0501072_0166578 Ga0501072_0166578_830_1159 109
235 3300049590 Ga0501074_1045277 Ga0501074_1045277_102_431 109
236 3300049593 Ga0501077_0300316 Ga0501077_0300316_551_880 109
237 3300049741 Ga0501079_0287072 Ga0501079_0287072_403_732 109
238 3300049743 Ga0501081_0124417 Ga0501081_0124417_1045_1374 109
239 3300049744 Ga0501083_0297331 Ga0501083_0297331_510_839 109
240 3300049822 Ga0501035_0004274 Ga0501035_0004274_10609_10950 109
241 3300049822 Ga0501035_0024471 Ga0501035_0024471_2619_2948 109
242 3300049822 Ga0501035_1167154 Ga0501035_1167154_97_444 109
243 3300049823 Ga0501044_0000540 Ga0501044_0000540_37046_37393 109
244 3300049823 Ga0501044_0060512 Ga0501044_0060512_1961_2290 109
245 3300049823 Ga0501044_0102132 Ga0501044_0102132_977_1306 109
246 3300049823 Ga0501044_1420174 Ga0501044_1420174_164_493 109
247 3300049824 Ga0501045_0034266 Ga0501045_0034266_2900_3229 109
248 3300053085 Ga0495619_0259901 Ga0495619_0259901_507_836 109
249 3300053161 Ga0500634_0384636 Ga0500634_0384636_81_422 109
250 3300053177 Ga0500636_0441996 Ga0500636_0441996_59_397 109
251 3300060353 Ga0501082_0192677 Ga0501082_0192677_979_1308 109
252 3300061719 Ga0466962_0013692 Ga0466962_0013692_2000_2347 109
253 3300061719 Ga0466962_0101667 Ga0466962_0101667_553_900 109
254 3300061734 Ga0530510_0369715 Ga0530510_0369715_200_529 109
255 iso_pu_bacteria 2734482258 2735818357 109

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21716

dnstrm_HI1420

Probable addiction module antidote protein

9

104

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f51-assembly1.cif.gz_A crystal structure of the clp gene regulator clgr from corynebacterium glutamicum 0.7522 46 98
7xi5-assembly1.cif.gz_A anti-crispr-associated aca10 0.7451 46 95
2lyk-assembly1.cif.gz_B noe-based 3d structure of the cylr2 homodimer at 270k (-3 celsius degrees) 0.7324 49 97
5woq-assembly2.cif.gz_C crystal structure of an xre family protein transcriptional regulator from mycobacterium smegmatis 0.7313 49 97
3f52-assembly1.cif.gz_A crystal structure of the clp gene regulator clgr from c. glutamicum 0.7238 46 97
ID Description Score Start End Superfamily
3f51A00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.7522 46 98 1.10.260.40
3f51C00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.7361 39 98 1.10.260.40
2lykB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.7324 49 97 1.10.260.40
3f52A00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.7238 46 97 1.10.260.40
2lyjA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.71 62 97 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A118HQC9-F1-model_v4 Transcriptional regulator 0.9322 1 103 GO:0003677
AF-A0A6J5F7W3-F1-model_v4 HTH cro/C1-type domain-containing protein 0.9239 4 109
AF-A0A118HQC9-F1-model_v4 Transcriptional regulator 0.915 1 103 GO:0003677
AF-A0A7W5B6B4-F1-model_v4 Putative addiction module antidote protein 0.9123 1 105 GO:0003677
AF-A0A3P1XA14-F1-model_v4 deleted 0.8975 26 109

Feature Viewer

pLDDT pTM Quality
86.93 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map