F365859

General Info

Members Datasets Scaffolds Average Seq Length
255 164 510 245

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0002940|Ga0395898_0002940_17561_18388
Length 275
Sequence VPEDYFGKTVAERYDESAADMFEPAVVDPTVDFLAALAGGGAALELGIGTGRIALPLAERGVQVHGIDLSEAMVSKLQAKPGAERIGVTIGDFATTRVEGSFSLAYLVFNTINNLTTQDAQVACFENVAAHLEPGGCFVIEVGVPPGKPLRVFDLSDTHVGVDEYDAATQRLVSHHFSLVDGNWERLSIPFRSVSPAELDLMARVAGMTLRERWANWNRAPFTSESRKPSRSGRSRRRSEVRALVSEAISRSRKDAAAGRXXXGRGAAVRQARVA

Samples

Sample ID Description Type Environment
1 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
74 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
75 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
80 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
81 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
82 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
83 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
86 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
87 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
88 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
89 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
90 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
91 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
92 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
93 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
94 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
99 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
100 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
101 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
102 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
103 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
104 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
105 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
106 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
107 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
108 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
109 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
110 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
111 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
112 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
113 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
114 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
115 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
116 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
119 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
135 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
136 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
137 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
138 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
139 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
140 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
143 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
146 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
147 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
148 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
149 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
150 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
151 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
152 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
153 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
154 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
155 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
156 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
157 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
158 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
159 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
160 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
161 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
162 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
163 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
164 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0
Isolates 0.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.92
Nodule 0
Rhizoplane 10.98
Rhizosphere 83.53
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395898_0002940 3300037466 Bacteria 19377
2 Ga0070676_10114197 3300005328 Bacteria 1686
3 Ga0070683_100273071 3300005329 Bacteria 1608
4 Ga0070680_100477902 3300005336 Bacteria 1065
5 Ga0070692_10167001 3300005345 Bacteria 1266
6 Ga0070668_100006748 3300005347 Bacteria 8507
7 Ga0070675_100260316 3300005354 Bacteria 1520
8 Ga0070674_100563150 3300005356 Bacteria 958
9 Ga0070688_100020714 3300005365 Bacteria 3829
10 Ga0070714_100137447 3300005435 Bacteria 2190
11 Ga0070710_10236245 3300005437 Bacteria 1169
12 Ga0070694_100237222 3300005444 Bacteria 1374
13 Ga0070678_100255244 3300005456 Bacteria 1472
14 Ga0070662_100025914 3300005457 Bacteria 4054
15 Ga0070681_10000165 3300005458 Bacteria 50320
16 Ga0070681_10436131 3300005458 Bacteria 1222
17 Ga0070706_100039347 3300005467 Bacteria 4366
18 Ga0070707_100605938 3300005468 Bacteria 1058
19 Ga0070698_100093449 3300005471 Bacteria 2987
20 Ga0070699_100058586 3300005518 Bacteria 3336
21 Ga0070684_100002073 3300005535 Bacteria 14767
22 Ga0070684_100133218 3300005535 Bacteria 2243
23 Ga0070686_100031645 3300005544 Bacteria 3236
24 Ga0070696_100006653 3300005546 Bacteria 7720
25 Ga0070696_100085510 3300005546 Bacteria 2239
26 Ga0070693_100027128 3300005547 Bacteria 3099
27 Ga0070664_100281040 3300005564 Bacteria 1501
28 Ga0068857_100646577 3300005577 Bacteria 1002
29 Ga0068856_100109596 3300005614 Bacteria 2757
30 Ga0068861_100045035 3300005719 Bacteria 3320
31 Ga0068858_100134354 3300005842 Bacteria 2320
32 Ga0081455_10015802 3300005937 Bacteria 7311
33 Ga0081455_10026347 3300005937 Bacteria 5349
34 Ga0081538_10001488 3300005981 Bacteria 24042
35 Ga0081539_10002811 3300005985 Bacteria 23271
36 Ga0081539_10009953 3300005985 Bacteria 7835
37 Ga0075365_10067419 3300006038 Bacteria 2403
38 Ga0075364_10003669 3300006051 Bacteria 8755
39 Ga0075364_10088733 3300006051 Bacteria 2050
40 Ga0075364_10311607 3300006051 Bacteria 1072
41 Ga0070712_100014352 3300006175 Bacteria 5086
42 Ga0075362_10023662 3300006177 Bacteria 2600
43 Ga0075428_100189921 3300006844 Bacteria 2222
44 Ga0075430_100009925 3300006846 Bacteria 8053
45 Ga0075431_100080783 3300006847 Bacteria 3357
46 Ga0075433_10005757 3300006852 Bacteria 9751
47 Ga0075433_10186661 3300006852 Bacteria 1845
48 Ga0075434_100038706 3300006871 Bacteria 4724
49 Ga0075434_100065052 3300006871 Bacteria 3631
50 Ga0075434_100246212 3300006871 Bacteria 1807
51 Ga0075434_100548167 3300006871 Bacteria 1176
52 Ga0075436_100012419 3300006914 Bacteria 5838
53 Ga0075435_100006866 3300007076 Bacteria 8080
54 Ga0111539_10003285 3300009094 Bacteria 21386
55 Ga0111539_10370547 3300009094 Bacteria 1667
56 Ga0105245_10003275 3300009098 Bacteria 14532
57 Ga0105245_10506569 3300009098 Bacteria 1224
58 Ga0114129_10049393 3300009147 Bacteria 5910
59 Ga0114129_10194147 3300009147 Bacteria 2754
60 Ga0105242_10220879 3300009176 Bacteria 1693
61 Ga0105249_10012165 3300009553 Bacteria 7578
62 Ga0105239_10054789 3300010375 Bacteria 4375
63 Ga0163162_10552827 3300013306 Bacteria 1279
64 Ga0163162_10745441 3300013306 Bacteria 1099
65 Ga0157372_10060259 3300013307 Bacteria 4247
66 Ga0157372_10088188 3300013307 Bacteria 3522
67 Ga0157372_10259326 3300013307 Bacteria 2019
68 Ga0157375_10176731 3300013308 Bacteria 2285
69 Ga0163163_10129518 3300014325 Bacteria 2563
70 Ga0163161_10028880 3300017792 Bacteria 3941
71 Ga0163161_10324449 3300017792 Bacteria 1218
72 Ga0213876_10060939 3300021384 Bacteria 1991
73 Ga0207692_10237493 3300025898 Bacteria 1087
74 Ga0207688_10046484 3300025901 Bacteria 2424
75 Ga0207688_10087079 3300025901 Bacteria 1790
76 Ga0207684_10070081 3300025910 Bacteria 2979
77 Ga0207693_10022729 3300025915 Bacteria 4981
78 Ga0207660_10113726 3300025917 Bacteria 2040
79 Ga0207660_10314572 3300025917 Bacteria 1249
80 Ga0207646_10058795 3300025922 Bacteria 3433
81 Ga0207687_10012871 3300025927 Bacteria 5467
82 Ga0207706_10024452 3300025933 Bacteria 5416
83 Ga0207669_10061743 3300025937 Bacteria 2305
84 Ga0207665_10164693 3300025939 Bacteria 1597
85 Ga0207661_10218841 3300025944 Bacteria 1682
86 Ga0207661_10246899 3300025944 Bacteria 1585
87 Ga0207679_10241301 3300025945 Bacteria 1531
88 Ga0207668_10045856 3300025972 Bacteria 2983
89 Ga0207640_10299947 3300025981 Bacteria 1271
90 Ga0207703_10180237 3300026035 Bacteria 1864
91 Ga0207674_10545295 3300026116 Bacteria 1120
92 Ga0207675_100005616 3300026118 Bacteria 12009
93 Ga0207428_10001733 3300027907 Bacteria 22359
94 Ga0207428_10185800 3300027907 Bacteria 1568
95 Ga0207428_10277224 3300027907 Bacteria 1245
96 Ga0316579_10035372 3300031691 Bacteria 2302
97 Ga0316576_10104834 3300031727 Bacteria 2116
98 Ga0316578_10033545 3300031728 Bacteria 2942
99 Ga0307409_100464620 3300031995 Bacteria 1224
100 Ga0307409_100704424 3300031995 Bacteria 1009
101 Ga0307416_100027736 3300032002 Bacteria 4199
102 Ga0373937_0186951 3300036401 Bacteria 1946
103 Ga0316584_0015044 3300036712 Bacteria 5527
104 Ga0316584_0351170 3300036712 Bacteria 1059
105 Ga0395899_0130312 3300037312 Bacteria 1796
106 Ga0395899_0244121 3300037312 Bacteria 1235
107 Ga0395899_0244258 3300037312 Bacteria 1234
108 Ga0395900_0034573 3300037418 Bacteria 5206
109 Ga0395900_0337056 3300037418 Bacteria 1484
110 Ga0395898_0114052 3300037466 Bacteria 2590
111 Ga0395898_0179287 3300037466 Bacteria 2024
112 Ga0395898_0312780 3300037466 Bacteria 1498
113 Ga0395898_0525703 3300037466 Bacteria 1124
114 Ga0395898_0584190 3300037466 Bacteria 1059
115 Ga0395898_0975363 3300037466 Bacteria 784
116 Ga0395905_0004143 3300037471 Bacteria 15173
117 Ga0395905_0043967 3300037471 Bacteria 4191
118 Ga0395905_0444587 3300037471 Bacteria 1194
119 Ga0436364_1230444 3300037853 Bacteria 2410
120 Ga0395901_0001411 3300038443 Bacteria 25086
121 Ga0395901_0064822 3300038443 Bacteria 3803
122 Ga0395901_0085755 3300038443 Bacteria 3292
123 Ga0395901_0186077 3300038443 Bacteria 2178
124 Ga0395901_0254873 3300038443 Bacteria 1827
125 Ga0395901_0546705 3300038443 Bacteria 1174
126 Ga0242420_016219 3300038996 Bacteria 1295
127 Ga0436365_0348076 3300039437 Bacteria 2751
128 Ga0451853_0070535 3300041512 Bacteria 3363
129 Ga0450893_0029211 3300042532 Bacteria 977
130 Ga0466966_0014026 3300044684 Bacteria 5305
131 Ga0466961_0184513 3300044693 Bacteria 1294
132 Ga0466964_0061822 3300044706 Bacteria 1560
133 Ga0466971_0029477 3300044719 Bacteria 2455
134 Ga0466957_0013799 3300044842 Bacteria 4694
135 Ga0466960_0069521 3300044901 Bacteria 1749
136 Ga0466960_0120768 3300044901 Bacteria 1372
137 Ga0451576_0323634 3300045051 Bacteria 1614
138 Ga0466958_0422495 3300045836 Bacteria 862
139 Ga0466967_0000627 3300045976 Bacteria 17686
140 Ga0466967_0003100 3300045976 Bacteria 10687
141 Ga0466967_0009781 3300045976 Bacteria 7147
142 Ga0466967_0059348 3300045976 Bacteria 3386
143 Ga0466967_0148400 3300045976 Bacteria 2189
144 Ga0466967_0219211 3300045976 Bacteria 1807
145 Ga0495582_0129049 3300046473 Bacteria 1428
146 Ga0495584_0146248 3300046491 Bacteria 1201
147 Ga0495631_0120595 3300046518 Bacteria 1128
148 Ga0495644_0048577 3300046523 Bacteria 1594
149 Ga0495645_0141721 3300046543 Bacteria 1677
150 Ga0495667_0014192 3300046559 Bacteria 5379
151 Ga0495657_0196212 3300046675 Bacteria 1232
152 Ga0495657_0366415 3300046675 Bacteria 851
153 Ga0495670_0149454 3300046691 Bacteria 1225
154 Ga0496100_0089740 3300048903 Bacteria 2095
155 Ga0496101_0155537 3300048904 Bacteria 1751
156 Ga0496101_0216339 3300048904 Bacteria 1486
157 Ga0496101_0555273 3300048904 Bacteria 908
158 Ga0496102_0041524 3300048905 Bacteria 4165
159 Ga0496102_0250171 3300048905 Bacteria 1671
160 Ga0496102_0258239 3300048905 Bacteria 1643
161 Ga0496103_0051314 3300048906 Bacteria 2553
162 Ga0496104_0004731 3300048907 Bacteria 11847
163 Ga0496105_0165471 3300048908 Bacteria 1814
164 Ga0496107_0341446 3300048910 Bacteria 1114
165 Ga0496108_0059808 3300048911 Bacteria 3204
166 Ga0496108_0349295 3300048911 Bacteria 1290
167 Ga0496109_0000576 3300048912 Bacteria 30721
168 Ga0496109_0022853 3300048912 Bacteria 5542
169 Ga0496109_0035605 3300048912 Bacteria 4492
170 Ga0496109_0343520 3300048912 Bacteria 1410
171 Ga0496110_0001609 3300048913 Bacteria 16533
172 Ga0496110_0018898 3300048913 Bacteria 5790
173 Ga0496110_0062627 3300048913 Bacteria 3286
174 Ga0496111_0024796 3300048914 Bacteria 4230
175 Ga0496111_0215757 3300048914 Bacteria 1425
176 Ga0496112_0000802 3300048915 Bacteria 22159
177 Ga0496112_0038764 3300048915 Bacteria 4655
178 Ga0496112_0557547 3300048915 Bacteria 1079
179 Ga0496113_0053909 3300048916 Bacteria 3008
180 Ga0496113_0087781 3300048916 Bacteria 2392
181 Ga0496113_0200912 3300048916 Bacteria 1584
182 Ga0501031_0025211 3300049568 Bacteria 3878
183 Ga0501031_0039211 3300049568 Bacteria 3091
184 Ga0501031_0361647 3300049568 Bacteria 939
185 Ga0501032_0061036 3300049569 Bacteria 2528
186 Ga0501033_0229413 3300049570 Bacteria 1319
187 Ga0501036_0030473 3300049572 Bacteria 4556
188 Ga0501036_0294208 3300049572 Bacteria 1358
189 Ga0501037_0059651 3300049573 Bacteria 2783
190 Ga0501038_0017033 3300049574 Bacteria 6575
191 Ga0501039_0009054 3300049575 Bacteria 7586
192 Ga0501040_0022506 3300049576 Bacteria 4218
193 Ga0501041_0029620 3300049577 Bacteria 3302
194 Ga0501042_0042369 3300049578 Bacteria 3240
195 Ga0501042_0100016 3300049578 Bacteria 2085
196 Ga0501043_0247774 3300049579 Bacteria 1373
197 Ga0501046_0044690 3300049580 Bacteria 3522
198 Ga0501048_0002992 3300049582 Bacteria 12902
199 Ga0501069_0001226 3300049585 Bacteria 12530
200 Ga0501069_0150253 3300049585 Bacteria 1338
201 Ga0501070_0008313 3300049586 Bacteria 8767
202 Ga0501070_0011887 3300049586 Bacteria 7351
203 Ga0501070_0147949 3300049586 Bacteria 1938
204 Ga0501071_0027056 3300049587 Bacteria 4033
205 Ga0501072_0004492 3300049588 Bacteria 10600
206 Ga0501074_0049688 3300049590 Bacteria 3028
207 Ga0501074_0141454 3300049590 Bacteria 1721
208 Ga0501075_0059720 3300049591 Bacteria 2872
209 Ga0501076_0032047 3300049592 Bacteria 4101
210 Ga0501076_0143695 3300049592 Bacteria 1939
211 Ga0501077_0065234 3300049593 Bacteria 2309
212 Ga0501079_0004199 3300049741 Bacteria 10677
213 Ga0501079_0017276 3300049741 Bacteria 5508
214 Ga0501080_0034005 3300049742 Bacteria 4759
215 Ga0501080_0096793 3300049742 Bacteria 2740
216 Ga0501081_0005382 3300049743 Bacteria 8262
217 Ga0501081_0050011 3300049743 Bacteria 2879
218 Ga0501081_0340962 3300049743 Bacteria 1103
219 Ga0501083_0290069 3300049744 Bacteria 1064
220 Ga0501044_0413127 3300049823 Bacteria 1260
221 Ga0501045_0032275 3300049824 Bacteria 3794
222 Ga0501045_0430385 3300049824 Bacteria 981
223 nmdc:mga03683_114974_c1 3300050489 Bacteria 1193
224 nmdc:mga00v17_12766_c1 3300050491 Bacteria 4641
225 nmdc:mga00v17_242417_c1 3300050491 Bacteria 1169
226 nmdc:mga0yw44_45428_c1 3300050492 Bacteria 2633
227 nmdc:mga05p37_165135_c1 3300050507 Bacteria 2703
228 nmdc:mga05p37_205345_c1 3300050507 Bacteria 2384
229 nmdc:mga05p37_80322_c1 3300050507 Bacteria 4017
230 nmdc:mga09592_805536_c1 3300050508 Bacteria 794
231 nmdc:mga0qj67_34495_c1 3300050509 Bacteria 3953
232 nmdc:mga06r32_79553_c1 3300050510 Bacteria 3189
233 nmdc:mga08y16_626571_c1 3300050511 Bacteria 1082
234 nmdc:mga08y16_82388_c1 3300050511 Bacteria 3354
235 nmdc:mga0n895_13825_c1 3300050512 Bacteria 7304
236 nmdc:mga0n895_414436_c1 3300050512 Bacteria 1362
237 nmdc:mga0n895_741633_c1 3300050512 Bacteria 976
238 nmdc:mga0rr50_216836_c1 3300050513 Bacteria 1579
239 nmdc:mga08x19_23907_c1 3300050514 Bacteria 3793
240 nmdc:mga08x19_439424_c1 3300050514 Bacteria 918
241 nmdc:mga0a205_2464_c2 3300050515 Bacteria 15984
242 nmdc:mga0a205_3354_c1 3300050515 Bacteria 12991
243 nmdc:mga0a205_86308_c1 3300050515 Bacteria 3031
244 Ga0500573_0160003 3300053140 Bacteria 1226
245 Ga0501084_0002055 3300054114 Bacteria 16065
246 Ga0501084_0049718 3300054114 Bacteria 3509
247 Ga0501082_0003917 3300060353 Bacteria 12992
248 Ga0501082_0070403 3300060353 Bacteria 3012
249 Ga0501082_0302045 3300060353 Bacteria 1394
250 Ga0466962_0036141 3300061719 Bacteria 2364
251 Ga0466962_0044917 3300061719 Bacteria 2113
252 Ga0530510_0003695 3300061734 Bacteria 10526
253 Ga0530510_0152341 3300061734 Bacteria 1708
254 2753073747 2751185734 Bacteria 8863695
255 2870729954 2870721527 Bacteria 9689237
256 Ga0395898_0002940
257 Ga0070676_10114197
258 Ga0070683_100273071
259 Ga0070680_100477902
260 Ga0070692_10167001
261 Ga0070668_100006748
262 Ga0070675_100260316
263 Ga0070674_100563150
264 Ga0070688_100020714
265 Ga0070714_100137447
266 Ga0070710_10236245
267 Ga0070694_100237222
268 Ga0070678_100255244
269 Ga0070662_100025914
270 Ga0070681_10000165
271 Ga0070681_10436131
272 Ga0070706_100039347
273 Ga0070707_100605938
274 Ga0070698_100093449
275 Ga0070699_100058586
276 Ga0070684_100002073
277 Ga0070684_100133218
278 Ga0070686_100031645
279 Ga0070696_100006653
280 Ga0070696_100085510
281 Ga0070693_100027128
282 Ga0070664_100281040
283 Ga0068857_100646577
284 Ga0068856_100109596
285 Ga0068861_100045035
286 Ga0068858_100134354
287 Ga0081455_10015802
288 Ga0081455_10026347
289 Ga0081538_10001488
290 Ga0081539_10002811
291 Ga0081539_10009953
292 Ga0075365_10067419
293 Ga0075364_10003669
294 Ga0075364_10088733
295 Ga0075364_10311607
296 Ga0070712_100014352
297 Ga0075362_10023662
298 Ga0075428_100189921
299 Ga0075430_100009925
300 Ga0075431_100080783
301 Ga0075433_10005757
302 Ga0075433_10186661
303 Ga0075434_100038706
304 Ga0075434_100065052
305 Ga0075434_100246212
306 Ga0075434_100548167
307 Ga0075436_100012419
308 Ga0075435_100006866
309 Ga0111539_10003285
310 Ga0111539_10370547
311 Ga0105245_10003275
312 Ga0105245_10506569
313 Ga0114129_10049393
314 Ga0114129_10194147
315 Ga0105242_10220879
316 Ga0105249_10012165
317 Ga0105239_10054789
318 Ga0163162_10552827
319 Ga0163162_10745441
320 Ga0157372_10060259
321 Ga0157372_10088188
322 Ga0157372_10259326
323 Ga0157375_10176731
324 Ga0163163_10129518
325 Ga0163161_10028880
326 Ga0163161_10324449
327 Ga0213876_10060939
328 Ga0207692_10237493
329 Ga0207688_10046484
330 Ga0207688_10087079
331 Ga0207684_10070081
332 Ga0207693_10022729
333 Ga0207660_10113726
334 Ga0207660_10314572
335 Ga0207646_10058795
336 Ga0207687_10012871
337 Ga0207706_10024452
338 Ga0207669_10061743
339 Ga0207665_10164693
340 Ga0207661_10218841
341 Ga0207661_10246899
342 Ga0207679_10241301
343 Ga0207668_10045856
344 Ga0207640_10299947
345 Ga0207703_10180237
346 Ga0207674_10545295
347 Ga0207675_100005616
348 Ga0207428_10001733
349 Ga0207428_10185800
350 Ga0207428_10277224
351 Ga0316579_10035372
352 Ga0316576_10104834
353 Ga0316578_10033545
354 Ga0307409_100464620
355 Ga0307409_100704424
356 Ga0307416_100027736
357 Ga0373937_0186951
358 Ga0316584_0015044
359 Ga0316584_0351170
360 Ga0395899_0130312
361 Ga0395899_0244121
362 Ga0395899_0244258
363 Ga0395900_0034573
364 Ga0395900_0337056
365 Ga0395898_0114052
366 Ga0395898_0179287
367 Ga0395898_0312780
368 Ga0395898_0525703
369 Ga0395898_0584190
370 Ga0395898_0975363
371 Ga0395905_0004143
372 Ga0395905_0043967
373 Ga0395905_0444587
374 Ga0436364_1230444
375 Ga0395901_0001411
376 Ga0395901_0064822
377 Ga0395901_0085755
378 Ga0395901_0186077
379 Ga0395901_0254873
380 Ga0395901_0546705
381 Ga0242420_016219
382 Ga0436365_0348076
383 Ga0451853_0070535
384 Ga0450893_0029211
385 Ga0466966_0014026
386 Ga0466961_0184513
387 Ga0466964_0061822
388 Ga0466971_0029477
389 Ga0466957_0013799
390 Ga0466960_0069521
391 Ga0466960_0120768
392 Ga0451576_0323634
393 Ga0466958_0422495
394 Ga0466967_0000627
395 Ga0466967_0003100
396 Ga0466967_0009781
397 Ga0466967_0059348
398 Ga0466967_0148400
399 Ga0466967_0219211
400 Ga0495582_0129049
401 Ga0495584_0146248
402 Ga0495631_0120595
403 Ga0495644_0048577
404 Ga0495645_0141721
405 Ga0495667_0014192
406 Ga0495657_0196212
407 Ga0495657_0366415
408 Ga0495670_0149454
409 Ga0496100_0089740
410 Ga0496101_0155537
411 Ga0496101_0216339
412 Ga0496101_0555273
413 Ga0496102_0041524
414 Ga0496102_0250171
415 Ga0496102_0258239
416 Ga0496103_0051314
417 Ga0496104_0004731
418 Ga0496105_0165471
419 Ga0496107_0341446
420 Ga0496108_0059808
421 Ga0496108_0349295
422 Ga0496109_0000576
423 Ga0496109_0022853
424 Ga0496109_0035605
425 Ga0496109_0343520
426 Ga0496110_0001609
427 Ga0496110_0018898
428 Ga0496110_0062627
429 Ga0496111_0024796
430 Ga0496111_0215757
431 Ga0496112_0000802
432 Ga0496112_0038764
433 Ga0496112_0557547
434 Ga0496113_0053909
435 Ga0496113_0087781
436 Ga0496113_0200912
437 Ga0501031_0025211
438 Ga0501031_0039211
439 Ga0501031_0361647
440 Ga0501032_0061036
441 Ga0501033_0229413
442 Ga0501036_0030473
443 Ga0501036_0294208
444 Ga0501037_0059651
445 Ga0501038_0017033
446 Ga0501039_0009054
447 Ga0501040_0022506
448 Ga0501041_0029620
449 Ga0501042_0042369
450 Ga0501042_0100016
451 Ga0501043_0247774
452 Ga0501046_0044690
453 Ga0501048_0002992
454 Ga0501069_0001226
455 Ga0501069_0150253
456 Ga0501070_0008313
457 Ga0501070_0011887
458 Ga0501070_0147949
459 Ga0501071_0027056
460 Ga0501072_0004492
461 Ga0501074_0049688
462 Ga0501074_0141454
463 Ga0501075_0059720
464 Ga0501076_0032047
465 Ga0501076_0143695
466 Ga0501077_0065234
467 Ga0501079_0004199
468 Ga0501079_0017276
469 Ga0501080_0034005
470 Ga0501080_0096793
471 Ga0501081_0005382
472 Ga0501081_0050011
473 Ga0501081_0340962
474 Ga0501083_0290069
475 Ga0501044_0413127
476 Ga0501045_0032275
477 Ga0501045_0430385
478 nmdc:mga03683_114974_c1
479 nmdc:mga00v17_12766_c1
480 nmdc:mga00v17_242417_c1
481 nmdc:mga0yw44_45428_c1
482 nmdc:mga05p37_165135_c1
483 nmdc:mga05p37_205345_c1
484 nmdc:mga05p37_80322_c1
485 nmdc:mga09592_805536_c1
486 nmdc:mga0qj67_34495_c1
487 nmdc:mga06r32_79553_c1
488 nmdc:mga08y16_626571_c1
489 nmdc:mga08y16_82388_c1
490 nmdc:mga0n895_13825_c1
491 nmdc:mga0n895_414436_c1
492 nmdc:mga0n895_741633_c1
493 nmdc:mga0rr50_216836_c1
494 nmdc:mga08x19_23907_c1
495 nmdc:mga08x19_439424_c1
496 nmdc:mga0a205_2464_c2
497 nmdc:mga0a205_3354_c1
498 nmdc:mga0a205_86308_c1
499 Ga0500573_0160003
500 Ga0501084_0002055
501 Ga0501084_0049718
502 Ga0501082_0003917
503 Ga0501082_0070403
504 Ga0501082_0302045
505 Ga0466962_0036141
506 Ga0466962_0044917
507 Ga0530510_0003695
508 Ga0530510_0152341
509 2753073747
510 2870729954

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13649

Methyltransf_25

Methyltransferase domain

43

136

0.91

PF08241

Methyltransf_11

Methyltransferase domain

44

140

0.87

PF13847

Methyltransf_31

Methyltransferase domain

37

170

0.83

PF08242

Methyltransf_12

Methyltransferase domain

44

138

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hgy-assembly1.cif.gz_E structure of the ccbj methyltransferase from streptomyces caelestis 0.8915 23 242
4hh4-assembly1.cif.gz_C structure of the ccbj methyltransferase from streptomyces caelestis 0.8867 5 242
6tl0-assembly1.cif.gz_A solution structure and 1h, 13c and 15n chemical shift assignments for the complex of vps29 with varp 687-747 0.8826 165 198
4hh4-assembly1.cif.gz_C structure of the ccbj methyltransferase from streptomyces caelestis 0.8697 5 242
7wzf-assembly1.cif.gz_A structural and mechanism analysis of yunm 0.8586 11 239
ID Description Score Start End Superfamily
4hgzB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9101 29 242 3.40.50.150
4hh4B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8938 10 242 3.40.50.150
3d2lA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8868 11 242 3.40.50.150
4hgzB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8738 29 242 3.40.50.150
3d2lA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8722 11 242 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7W0PYD9-F1-model_v4 Class I SAM-dependent methyltransferase 0.9904 1 241 GO:0008168
GO:0032259
AF-A0A7V9PWJ8-F1-model_v4 Class I SAM-dependent methyltransferase 0.9899 44 241 GO:0008168
GO:0032259
AF-A0A7W0PYD9-F1-model_v4 Class I SAM-dependent methyltransferase 0.9823 1 241 GO:0008168
GO:0032259
AF-A0A1C6RA79-F1-model_v4 SAM-dependent methyltransferase 0.9698 29 240 GO:0008168
GO:0032259
AF-A0A4R0JC25-F1-model_v4 GNAT family N-acetyltransferase 0.9697 5 240 GO:0016747

Map