F365830

General Info

Members Datasets Scaffolds Average Seq Length
255 163 510 174

Family's Representative Sequence

Representative Sequence 3300032133|Ga0316583_10005372|Ga0316583_100053723
Length 192
Sequence MRAILIAALLAVLAGCASAPTTPQQQAPASVEDRSPGQPGAQTQGIGSNQISGVDLTAQKQGAAATTASGKSPLTDPSNILSHRSIYYDFDQYDIKDEYRPLIEAHAAYLRAHPDAKVLIQGNTDERGSREYNVALGQRRADGVKKMLLLLGVKEDQVEAVSLGEEKPKALGTTEEAYAQNRRCDILYKGEY

Samples

Sample ID Description Type Environment
1 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
77 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
78 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
79 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
80 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
83 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
92 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
93 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
94 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
95 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
96 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
97 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
98 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
99 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
100 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
105 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
106 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
107 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
108 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
109 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
110 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
111 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
112 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
113 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
114 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
120 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
121 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
122 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
123 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
124 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
125 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
138 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
139 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
140 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
141 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
142 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
143 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
144 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
145 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
146 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
147 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
153 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
159 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
160 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
161 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
162 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
163 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 0
Rhizosphere 99.61
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316583_10005372 3300032133 Bacteria 4598
2 Ga0065707_10602866 3300005295 Bacteria 687
3 Ga0070683_100058611 3300005329 Bacteria 3577
4 Ga0070683_100331094 3300005329 Bacteria 1450
5 Ga0070690_100036136 3300005330 Bacteria 3103
6 Ga0070670_100022116 3300005331 Bacteria 5473
7 Ga0070670_100167989 3300005331 Bacteria 1902
8 Ga0070666_10577396 3300005335 Bacteria 819
9 Ga0070680_100148166 3300005336 Bacteria 1970
10 Ga0070680_100507530 3300005336 Bacteria 1032
11 Ga0070661_100425166 3300005344 Bacteria 1053
12 Ga0070692_10660274 3300005345 Bacteria 699
13 Ga0070671_100408501 3300005355 Bacteria 1162
14 Ga0070673_100763718 3300005364 Bacteria 891
15 Ga0070659_100149630 3300005366 Bacteria 1904
16 Ga0070710_10294679 3300005437 Bacteria 1057
17 Ga0070694_100013857 3300005444 Bacteria 5041
18 Ga0070708_100084839 3300005445 Bacteria 2873
19 Ga0068867_100443807 3300005459 Bacteria 1104
20 Ga0070706_100032853 3300005467 Bacteria 4787
21 Ga0070706_100143969 3300005467 Bacteria 2225
22 Ga0070706_100157914 3300005467 Bacteria 2117
23 Ga0070707_100244211 3300005468 Bacteria 1747
24 Ga0070698_100264819 3300005471 Bacteria 1651
25 Ga0070698_100339544 3300005471 Bacteria 1433
26 Ga0070699_100109481 3300005518 Bacteria 2424
27 Ga0070699_100187179 3300005518 Bacteria 1838
28 Ga0070679_100599448 3300005530 Bacteria 1045
29 Ga0070684_100018672 3300005535 Bacteria 5719
30 Ga0070697_100012724 3300005536 Bacteria 6588
31 Ga0070697_100075135 3300005536 Bacteria 2777
32 Ga0070697_100140296 3300005536 Bacteria 2032
33 Ga0068853_100110111 3300005539 Bacteria 2446
34 Ga0070695_100075839 3300005545 Bacteria 2213
35 Ga0070695_100210245 3300005545 Bacteria 1396
36 Ga0070696_100111935 3300005546 Bacteria 1967
37 Ga0070693_100103746 3300005547 Bacteria 1737
38 Ga0070704_100011830 3300005549 Bacteria 5369
39 Ga0070704_100013619 3300005549 Bacteria 5055
40 Ga0068855_100061206 3300005563 Bacteria 4399
41 Ga0070664_100151538 3300005564 Bacteria 2047
42 Ga0068857_100616407 3300005577 Bacteria 1026
43 Ga0068854_100033395 3300005578 Bacteria 3587
44 Ga0068854_100197383 3300005578 Bacteria 1580
45 Ga0068856_100242480 3300005614 Bacteria 1818
46 Ga0070702_100039174 3300005615 Bacteria 2643
47 Ga0070702_100343750 3300005615 Bacteria 1048
48 Ga0068852_100083070 3300005616 Bacteria 2848
49 Ga0068859_100219447 3300005617 Bacteria 1989
50 Ga0070716_100055708 3300006173 Bacteria 2264
51 Ga0070712_100367062 3300006175 Bacteria 1182
52 Ga0068871_100007628 3300006358 Bacteria 7739
53 Ga0068871_100183560 3300006358 Bacteria 1799
54 Ga0075430_100102231 3300006846 Bacteria 2392
55 Ga0075433_10019552 3300006852 Bacteria 5646
56 Ga0075433_10031015 3300006852 Bacteria 4566
57 Ga0075434_100051064 3300006871 Bacteria 4108
58 Ga0075434_100526435 3300006871 Bacteria 1202
59 Ga0075436_100011819 3300006914 Bacteria 5990
60 Ga0075436_100046128 3300006914 Bacteria 3006
61 Ga0075436_100068141 3300006914 Bacteria 2459
62 Ga0075436_100334710 3300006914 Bacteria 1089
63 Ga0075436_100453651 3300006914 Bacteria 934
64 Ga0097620_100219456 3300006931 Bacteria 1989
65 Ga0075435_100004323 3300007076 Bacteria 9765
66 Ga0075435_100721789 3300007076 Bacteria 866
67 Ga0111539_10494405 3300009094 Bacteria 1425
68 Ga0111539_10882267 3300009094 Bacteria 1040
69 Ga0105245_10012155 3300009098 Bacteria 7487
70 Ga0114129_11873366 3300009147 Bacteria 728
71 Ga0105243_11496579 3300009148 Bacteria 699
72 Ga0105248_10486898 3300009177 Bacteria 1390
73 Ga0105248_11119191 3300009177 Bacteria 890
74 Ga0105237_10420507 3300009545 Bacteria 1342
75 Ga0157370_10023946 3300013104 Bacteria 6054
76 Ga0157369_10006636 3300013105 Bacteria 13384
77 Ga0157369_10138234 3300013105 Bacteria 2579
78 Ga0157374_10260175 3300013296 Bacteria 1709
79 Ga0157378_10754896 3300013297 Bacteria 996
80 Ga0157372_10109324 3300013307 Bacteria 3166
81 Ga0157372_11144373 3300013307 Bacteria 900
82 Ga0207684_10053183 3300025910 Bacteria 3437
83 Ga0207684_10113060 3300025910 Bacteria 2324
84 Ga0207684_10429388 3300025910 Bacteria 1135
85 Ga0207707_10377422 3300025912 Bacteria 1219
86 Ga0207671_10502125 3300025914 Bacteria 967
87 Ga0207693_10025924 3300025915 Bacteria 4643
88 Ga0207663_10505234 3300025916 Bacteria 939
89 Ga0207660_10137683 3300025917 Bacteria 1864
90 Ga0207662_10034875 3300025918 Bacteria 2937
91 Ga0207649_10104282 3300025920 Bacteria 1882
92 Ga0207649_10286758 3300025920 Bacteria 1199
93 Ga0207652_10161019 3300025921 Bacteria 2012
94 Ga0207652_11063756 3300025921 Bacteria 709
95 Ga0207646_10006512 3300025922 Bacteria 12054
96 Ga0207687_10018159 3300025927 Bacteria 4640
97 Ga0207690_10088236 3300025932 Bacteria 2184
98 Ga0207690_10117762 3300025932 Bacteria 1924
99 Ga0207665_10017080 3300025939 Bacteria 4765
100 Ga0207661_10018930 3300025944 Bacteria 5124
101 Ga0207661_10301375 3300025944 Bacteria 1437
102 Ga0207679_10267308 3300025945 Bacteria 1461
103 Ga0207640_10149376 3300025981 Bacteria 1715
104 Ga0207639_10228971 3300026041 Bacteria 1610
105 Ga0207698_10127476 3300026142 Bacteria 2167
106 Ga0209968_1047316 3300027526 Bacteria 742
107 Ga0265327_10047818 3300031251 Bacteria 2254
108 Ga0307408_100050546 3300031548 Bacteria 2990
109 Ga0307408_100440967 3300031548 Bacteria 1127
110 Ga0316575_10016601 3300031665 Bacteria 2788
111 Ga0316579_10000246 3300031691 Bacteria 16511
112 Ga0316578_10079530 3300031728 Bacteria 1949
113 Ga0307405_10063987 3300031731 Bacteria 2335
114 Ga0307413_10002093 3300031824 Bacteria 7997
115 Ga0307413_10526644 3300031824 Bacteria 954
116 Ga0307410_10021442 3300031852 Bacteria 3974
117 Ga0307406_10310430 3300031901 Bacteria 1215
118 Ga0307407_10087776 3300031903 Bacteria 1898
119 Ga0307407_10682250 3300031903 Bacteria 772
120 Ga0307412_10047294 3300031911 Bacteria 2825
121 Ga0307409_100004961 3300031995 Bacteria 7576
122 Ga0307416_100022251 3300032002 Bacteria 4571
123 Ga0307416_100550443 3300032002 Bacteria 1227
124 Ga0307416_100906633 3300032002 Bacteria 982
125 Ga0307414_10056478 3300032004 Bacteria 2754
126 Ga0307411_10001245 3300032005 Bacteria 10146
127 Ga0307411_11017247 3300032005 Bacteria 743
128 Ga0307411_11057877 3300032005 Bacteria 729
129 Ga0316583_10006044 3300032133 Bacteria 4351
130 Ga0373938_0015810 3300034957 Bacteria 1467
131 Ga0373938_0058328 3300034957 Bacteria 897
132 Ga0373929_0006540 3300035085 Bacteria 2107
133 Ga0373940_0264133 3300035088 Bacteria 584
134 Ga0373951_0123343 3300035091 Bacteria 707
135 Ga0373951_0127945 3300035091 Bacteria 696
136 Ga0373932_0033668 3300035112 Bacteria 1440
137 Ga0373939_0106993 3300035114 Bacteria 968
138 Ga0373960_0007770 3300035121 Bacteria 2550
139 Ga0373946_0162892 3300035171 Bacteria 1048
140 Ga0373931_0018950 3300035691 Bacteria 3429
141 Ga0373931_0225003 3300035691 Bacteria 1131
142 Ga0373931_0276155 3300035691 Bacteria 1030
143 Ga0373931_0402108 3300035691 Bacteria 867
144 Ga0373947_0125268 3300035725 Bacteria 1635
145 Ga0373937_0185073 3300036401 Bacteria 1956
146 Ga0373937_0637400 3300036401 Bacteria 1011
147 Ga0316582_0040819 3300036647 Bacteria 2898
148 Ga0373925_0598233 3300037068 Bacteria 908
149 Ga0316581_0008497 3300037588 Bacteria 2796
150 Ga0439441_015694 3300042001 Bacteria 1343
151 Ga0439441_084327 3300042001 Bacteria 696
152 Ga0439443_003460 3300042003 Bacteria 1990
153 Ga0439451_028658 3300042009 Bacteria 1122
154 Ga0450922_013465 3300042124 Bacteria 800
155 Ga0439446_0010917 3300042156 Bacteria 2456
156 Ga0439435_0000550 3300042436 Bacteria 6020
157 Ga0439444_0001375 3300042437 Bacteria 3132
158 Ga0439460_0003557 3300042461 Bacteria 3765
159 Ga0450893_0038483 3300042532 Bacteria 870
160 Ga0466964_0027857 3300044706 Bacteria 2221
161 Ga0453684_0598840 3300044712 Bacteria 1208
162 Ga0466971_0360481 3300044719 Bacteria 705
163 Ga0451576_0004192 3300045051 Bacteria 18963
164 Ga0466967_0065333 3300045976 Bacteria 3238
165 Ga0495663_0133892 3300046525 Bacteria 838
166 Ga0495609_0124160 3300046538 Bacteria 1109
167 Ga0495621_0073182 3300046539 Bacteria 1266
168 Ga0495656_0044052 3300046615 Bacteria 1877
169 Ga0495659_0059375 3300046664 Bacteria 1409
170 Ga0495669_0047146 3300046684 Bacteria 1924
171 Ga0501031_0069842 3300049568 Bacteria 2288
172 Ga0501033_0003828 3300049570 Bacteria 12243
173 Ga0501036_0000147 3300049572 Bacteria 45721
174 Ga0501036_0089928 3300049572 Bacteria 2594
175 Ga0501036_0165250 3300049572 Bacteria 1866
176 Ga0501037_0265536 3300049573 Bacteria 1199
177 Ga0501038_0002565 3300049574 Bacteria 16939
178 Ga0501038_0249053 3300049574 Bacteria 1408
179 Ga0501038_0275684 3300049574 Bacteria 1325
180 Ga0501039_0000724 3300049575 Bacteria 23815
181 Ga0501039_0113960 3300049575 Bacteria 2115
182 Ga0501039_0189627 3300049575 Bacteria 1617
183 Ga0501039_0388314 3300049575 Bacteria 1096
184 Ga0501040_0000126 3300049576 Bacteria 40601
185 Ga0501040_0134438 3300049576 Bacteria 1740
186 Ga0501040_0449843 3300049576 Bacteria 927
187 Ga0501041_0000027 3300049577 Bacteria 46977
188 Ga0501041_0109881 3300049577 Bacteria 1710
189 Ga0501041_0436943 3300049577 Bacteria 830
190 Ga0501042_0002234 3300049578 Bacteria 11818
191 Ga0501042_0037135 3300049578 Bacteria 3457
192 Ga0501046_0000388 3300049580 Bacteria 44125
193 Ga0501046_0178151 3300049580 Bacteria 1591
194 Ga0501047_0082463 3300049581 Bacteria 3091
195 Ga0501048_0000092 3300049582 Bacteria 48223
196 Ga0501068_0008737 3300049584 Bacteria 5651
197 Ga0501068_0084298 3300049584 Bacteria 1955
198 Ga0501069_0184021 3300049585 Bacteria 1208
199 Ga0501069_0215210 3300049585 Bacteria 1116
200 Ga0501069_0450005 3300049585 Bacteria 765
201 Ga0501071_0006268 3300049587 Bacteria 7717
202 Ga0501071_0090063 3300049587 Bacteria 2252
203 Ga0501072_0000150 3300049588 Bacteria 51488
204 Ga0501072_0102099 3300049588 Bacteria 2279
205 Ga0501072_0157278 3300049588 Bacteria 1812
206 Ga0501073_0412512 3300049589 Bacteria 933
207 Ga0501074_0012871 3300049590 Bacteria 6083
208 Ga0501074_0442740 3300049590 Bacteria 921
209 Ga0501075_0001096 3300049591 Bacteria 17450
210 Ga0501075_0110842 3300049591 Bacteria 2086
211 Ga0501075_0140771 3300049591 Bacteria 1838
212 Ga0501075_0421770 3300049591 Bacteria 1017
213 Ga0501076_0000630 3300049592 Bacteria 22475
214 Ga0501076_0020758 3300049592 Bacteria 5030
215 Ga0501076_0181077 3300049592 Bacteria 1718
216 Ga0501076_0414555 3300049592 Bacteria 1108
217 Ga0501077_0003830 3300049593 Bacteria 9064
218 Ga0501227_049320 3300049665 Bacteria 1059
219 Ga0501079_0003653 3300049741 Bacteria 11334
220 Ga0501079_0044826 3300049741 Bacteria 3413
221 Ga0501080_0078391 3300049742 Bacteria 3073
222 Ga0501080_0178238 3300049742 Bacteria 1957
223 Ga0501080_0971283 3300049742 Bacteria 738
224 Ga0501081_0000091 3300049743 Bacteria 36726
225 Ga0501035_0025469 3300049822 Bacteria 5423
226 Ga0501035_0448020 3300049822 Bacteria 1068
227 Ga0501035_0846163 3300049822 Bacteria 728
228 Ga0501044_0024572 3300049823 Bacteria 6394
229 Ga0501045_0000256 3300049824 Bacteria 30739
230 Ga0501045_0028988 3300049824 Bacteria 3997
231 Ga0501045_0280405 3300049824 Bacteria 1241
232 nmdc:mga0k408_790556_c1 3300050493 Bacteria 553
233 nmdc:mga05p37_369088_c1 3300050507 Bacteria 1685
234 nmdc:mga0qj67_396543_c1 3300050509 Bacteria 1114
235 nmdc:mga08y16_873390_c1 3300050511 Bacteria 887
236 nmdc:mga0n895_13903_c1 3300050512 Bacteria 7287
237 nmdc:mga0n895_234178_c1 3300050512 Bacteria 1864
238 nmdc:mga0rr50_54818_c1 3300050513 Bacteria 2972
239 nmdc:mga0rr50_818214_c1 3300050513 Bacteria 795
240 nmdc:mga08x19_16521_c1 3300050514 Bacteria 4503
241 nmdc:mga08x19_26592_c1 3300050514 Bacteria 3611
242 nmdc:mga08x19_325732_c1 3300050514 Bacteria 1070
243 nmdc:mga08x19_4644_c1 3300050514 Bacteria 8150
244 nmdc:mga0a205_15460_c1 3300050515 Bacteria 7135
245 nmdc:mga0a205_23325_c1 3300050515 Bacteria 5869
246 nmdc:mga0a205_694902_c1 3300050515 Bacteria 867
247 nmdc:mga0a205_827176_c1 3300050515 Bacteria 773
248 Ga0501084_0000998 3300054114 Bacteria 21983
249 Ga0501084_0028361 3300054114 Bacteria 4679
250 Ga0501084_0213498 3300054114 Bacteria 1628
251 Ga0501082_0001880 3300060353 Bacteria 18475
252 Ga0501082_0019987 3300060353 Bacteria 5771
253 Ga0501082_0129556 3300060353 Bacteria 2189
254 Ga0530510_0001121 3300061734 Bacteria 17806
255 Ga0530510_0015188 3300061734 Bacteria 5438
256 Ga0316583_10005372
257 Ga0065707_10602866
258 Ga0070683_100058611
259 Ga0070683_100331094
260 Ga0070690_100036136
261 Ga0070670_100022116
262 Ga0070670_100167989
263 Ga0070666_10577396
264 Ga0070680_100148166
265 Ga0070680_100507530
266 Ga0070661_100425166
267 Ga0070692_10660274
268 Ga0070671_100408501
269 Ga0070673_100763718
270 Ga0070659_100149630
271 Ga0070710_10294679
272 Ga0070694_100013857
273 Ga0070708_100084839
274 Ga0068867_100443807
275 Ga0070706_100032853
276 Ga0070706_100143969
277 Ga0070706_100157914
278 Ga0070707_100244211
279 Ga0070698_100264819
280 Ga0070698_100339544
281 Ga0070699_100109481
282 Ga0070699_100187179
283 Ga0070679_100599448
284 Ga0070684_100018672
285 Ga0070697_100012724
286 Ga0070697_100075135
287 Ga0070697_100140296
288 Ga0068853_100110111
289 Ga0070695_100075839
290 Ga0070695_100210245
291 Ga0070696_100111935
292 Ga0070693_100103746
293 Ga0070704_100011830
294 Ga0070704_100013619
295 Ga0068855_100061206
296 Ga0070664_100151538
297 Ga0068857_100616407
298 Ga0068854_100033395
299 Ga0068854_100197383
300 Ga0068856_100242480
301 Ga0070702_100039174
302 Ga0070702_100343750
303 Ga0068852_100083070
304 Ga0068859_100219447
305 Ga0070716_100055708
306 Ga0070712_100367062
307 Ga0068871_100007628
308 Ga0068871_100183560
309 Ga0075430_100102231
310 Ga0075433_10019552
311 Ga0075433_10031015
312 Ga0075434_100051064
313 Ga0075434_100526435
314 Ga0075436_100011819
315 Ga0075436_100046128
316 Ga0075436_100068141
317 Ga0075436_100334710
318 Ga0075436_100453651
319 Ga0097620_100219456
320 Ga0075435_100004323
321 Ga0075435_100721789
322 Ga0111539_10494405
323 Ga0111539_10882267
324 Ga0105245_10012155
325 Ga0114129_11873366
326 Ga0105243_11496579
327 Ga0105248_10486898
328 Ga0105248_11119191
329 Ga0105237_10420507
330 Ga0157370_10023946
331 Ga0157369_10006636
332 Ga0157369_10138234
333 Ga0157374_10260175
334 Ga0157378_10754896
335 Ga0157372_10109324
336 Ga0157372_11144373
337 Ga0207684_10053183
338 Ga0207684_10113060
339 Ga0207684_10429388
340 Ga0207707_10377422
341 Ga0207671_10502125
342 Ga0207693_10025924
343 Ga0207663_10505234
344 Ga0207660_10137683
345 Ga0207662_10034875
346 Ga0207649_10104282
347 Ga0207649_10286758
348 Ga0207652_10161019
349 Ga0207652_11063756
350 Ga0207646_10006512
351 Ga0207687_10018159
352 Ga0207690_10088236
353 Ga0207690_10117762
354 Ga0207665_10017080
355 Ga0207661_10018930
356 Ga0207661_10301375
357 Ga0207679_10267308
358 Ga0207640_10149376
359 Ga0207639_10228971
360 Ga0207698_10127476
361 Ga0209968_1047316
362 Ga0265327_10047818
363 Ga0307408_100050546
364 Ga0307408_100440967
365 Ga0316575_10016601
366 Ga0316579_10000246
367 Ga0316578_10079530
368 Ga0307405_10063987
369 Ga0307413_10002093
370 Ga0307413_10526644
371 Ga0307410_10021442
372 Ga0307406_10310430
373 Ga0307407_10087776
374 Ga0307407_10682250
375 Ga0307412_10047294
376 Ga0307409_100004961
377 Ga0307416_100022251
378 Ga0307416_100550443
379 Ga0307416_100906633
380 Ga0307414_10056478
381 Ga0307411_10001245
382 Ga0307411_11017247
383 Ga0307411_11057877
384 Ga0316583_10006044
385 Ga0373938_0015810
386 Ga0373938_0058328
387 Ga0373929_0006540
388 Ga0373940_0264133
389 Ga0373951_0123343
390 Ga0373951_0127945
391 Ga0373932_0033668
392 Ga0373939_0106993
393 Ga0373960_0007770
394 Ga0373946_0162892
395 Ga0373931_0018950
396 Ga0373931_0225003
397 Ga0373931_0276155
398 Ga0373931_0402108
399 Ga0373947_0125268
400 Ga0373937_0185073
401 Ga0373937_0637400
402 Ga0316582_0040819
403 Ga0373925_0598233
404 Ga0316581_0008497
405 Ga0439441_015694
406 Ga0439441_084327
407 Ga0439443_003460
408 Ga0439451_028658
409 Ga0450922_013465
410 Ga0439446_0010917
411 Ga0439435_0000550
412 Ga0439444_0001375
413 Ga0439460_0003557
414 Ga0450893_0038483
415 Ga0466964_0027857
416 Ga0453684_0598840
417 Ga0466971_0360481
418 Ga0451576_0004192
419 Ga0466967_0065333
420 Ga0495663_0133892
421 Ga0495609_0124160
422 Ga0495621_0073182
423 Ga0495656_0044052
424 Ga0495659_0059375
425 Ga0495669_0047146
426 Ga0501031_0069842
427 Ga0501033_0003828
428 Ga0501036_0000147
429 Ga0501036_0089928
430 Ga0501036_0165250
431 Ga0501037_0265536
432 Ga0501038_0002565
433 Ga0501038_0249053
434 Ga0501038_0275684
435 Ga0501039_0000724
436 Ga0501039_0113960
437 Ga0501039_0189627
438 Ga0501039_0388314
439 Ga0501040_0000126
440 Ga0501040_0134438
441 Ga0501040_0449843
442 Ga0501041_0000027
443 Ga0501041_0109881
444 Ga0501041_0436943
445 Ga0501042_0002234
446 Ga0501042_0037135
447 Ga0501046_0000388
448 Ga0501046_0178151
449 Ga0501047_0082463
450 Ga0501048_0000092
451 Ga0501068_0008737
452 Ga0501068_0084298
453 Ga0501069_0184021
454 Ga0501069_0215210
455 Ga0501069_0450005
456 Ga0501071_0006268
457 Ga0501071_0090063
458 Ga0501072_0000150
459 Ga0501072_0102099
460 Ga0501072_0157278
461 Ga0501073_0412512
462 Ga0501074_0012871
463 Ga0501074_0442740
464 Ga0501075_0001096
465 Ga0501075_0110842
466 Ga0501075_0140771
467 Ga0501075_0421770
468 Ga0501076_0000630
469 Ga0501076_0020758
470 Ga0501076_0181077
471 Ga0501076_0414555
472 Ga0501077_0003830
473 Ga0501227_049320
474 Ga0501079_0003653
475 Ga0501079_0044826
476 Ga0501080_0078391
477 Ga0501080_0178238
478 Ga0501080_0971283
479 Ga0501081_0000091
480 Ga0501035_0025469
481 Ga0501035_0448020
482 Ga0501035_0846163
483 Ga0501044_0024572
484 Ga0501045_0000256
485 Ga0501045_0028988
486 Ga0501045_0280405
487 nmdc:mga0k408_790556_c1
488 nmdc:mga05p37_369088_c1
489 nmdc:mga0qj67_396543_c1
490 nmdc:mga08y16_873390_c1
491 nmdc:mga0n895_13903_c1
492 nmdc:mga0n895_234178_c1
493 nmdc:mga0rr50_54818_c1
494 nmdc:mga0rr50_818214_c1
495 nmdc:mga08x19_16521_c1
496 nmdc:mga08x19_26592_c1
497 nmdc:mga08x19_325732_c1
498 nmdc:mga08x19_4644_c1
499 nmdc:mga0a205_15460_c1
500 nmdc:mga0a205_23325_c1
501 nmdc:mga0a205_694902_c1
502 nmdc:mga0a205_827176_c1
503 Ga0501084_0000998
504 Ga0501084_0028361
505 Ga0501084_0213498
506 Ga0501082_0001880
507 Ga0501082_0019987
508 Ga0501082_0129556
509 Ga0530510_0001121
510 Ga0530510_0015188

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00691

OmpA

OmpA family

87

182

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pwt-assembly3.cif.gz_C crystal structure of peptidoglycan-associated outer membrane lipoprotein from yersinia pestis co92 0.9673 74 177
4pwt-assembly1.cif.gz_A crystal structure of peptidoglycan-associated outer membrane lipoprotein from yersinia pestis co92 0.9633 70 177
2hqs-assembly1.cif.gz_H crystal structure of tolb/pal complex 0.9611 74 178
4b5c-assembly3.cif.gz_C crystal structure of the peptidoglycan-associated lipoprotein from burkholderia pseudomallei 0.9585 67 179
4g4x-assembly1.cif.gz_A crystal structure of peptidoglycan-associated lipoprotein from acinetobacter baumannii 0.958 73 179
ID Description Score Start End Superfamily
4pwtC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.9663 74 177 3.30.1330.60
5n2cC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.9537 67 179 3.30.1330.60
5u1hB00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.9419 74 176 3.30.1330.60
3td4B00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.931 75 178 3.30.1330.60
2w8bC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.9305 73 177 3.30.1330.60
ID Description Score Start End GO Terms
AF-A0A3C0TD60-F1-model_v4 Peptidoglycan-associated lipoprotein Pal 0.9697 73 179 GO:0009279
GO:0051301
AF-A0A3D4U8P8-F1-model_v4 Peptidoglycan-associated lipoprotein (PAL) 0.9663 69 179 GO:0009279
GO:0051301
AF-H5TBL5-F1-model_v4 Peptidoglycan-associated lipoprotein (PAL) 0.9612 70 179 GO:0009279
GO:0051301
AF-A0A4P5TLZ7-F1-model_v4 OmpA-like domain-containing protein 0.9592 74 178 GO:0009279
AF-A0A847VMC0-F1-model_v4 Peptidoglycan-associated lipoprotein Pal 0.9585 76 178 GO:0009279
GO:0051301

Map