F365608

General Info

Members Datasets Scaffolds Average Seq Length
255 187 510 60

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100873470|Ga0075431_1008734702
Length 70
Sequence MARKRELIDTGTDKRFVRRNQRGKFSESDDVGRSLATDRRKRAKTKVKSGQGDKGDRPRAKTAKKAVRKK

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
7 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
8 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
75 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
76 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
117 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
123 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
128 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
129 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
130 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
131 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
132 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
133 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
134 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
135 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
145 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
146 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
147 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
148 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
149 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
150 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
151 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
156 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
157 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
158 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
159 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
160 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
161 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
162 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
163 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
164 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
165 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
166 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
167 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
171 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
172 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
173 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
174 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
175 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
176 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
177 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
178 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
179 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
180 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
181 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
182 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
185 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
186 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
187 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.47
Metatranscriptomes 2.35
Isolates 1.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.16
Nodule 0
Rhizoplane 4.71
Rhizosphere 72.94
Stem 0
Stem Tuber 0
Unclassified 17.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100873470 3300006847 Bacteria 870
2 JGI24739J22299_10075797 3300001989 Bacteria 1039
3 JGI25152J39213_1005077 3300002773 Bacteria 3957
4 JGI25152J39213_1005382 3300002773 Bacteria 3749
5 JGI25153J46596_10020282 3300003215 Bacteria 2517
6 rootL2_10256666 3300003322 Bacteria 1497
7 Ga0055525_1000123 3300003759 Bacteria 118289
8 Ga0055528_1002462 3300003790 Bacteria 9905
9 Ga0058861_11307761 3300004800 Unclassified 601
10 Ga0065712_10332619 3300005290 Bacteria 812
11 Ga0065715_10140883 3300005293 Bacteria 1856
12 Ga0070690_101071568 3300005330 Unclassified 638
13 Ga0070670_100044077 3300005331 Plasmid 3835
14 Ga0068869_100264439 3300005334 Bacteria 1378
15 Ga0070666_10122202 3300005335 Bacteria 1806
16 Ga0070691_10945055 3300005341 Bacteria 534
17 Ga0070692_10042289 3300005345 Bacteria 2339
18 Ga0070668_100016355 3300005347 Bacteria 5547
19 Ga0070669_100051415 3300005353 Bacteria 3012
20 Ga0070669_101451654 3300005353 Bacteria 596
21 Ga0070675_100804883 3300005354 Bacteria 859
22 Ga0070675_101028171 3300005354 Unclassified 757
23 Ga0070671_100659091 3300005355 Bacteria 906
24 Ga0070671_100747250 3300005355 Bacteria 850
25 Ga0070671_101979081 3300005355 Unclassified 519
26 Ga0070673_100663580 3300005364 Bacteria 955
27 Ga0070673_101922664 3300005364 Bacteria 561
28 Ga0070659_100581509 3300005366 Unclassified 961
29 Ga0070659_100861856 3300005366 Bacteria 790
30 Ga0070667_100000195 3300005367 Bacteria 72280
31 Ga0070667_100093176 3300005367 Bacteria 2594
32 Ga0070663_100592176 3300005455 Bacteria 932
33 Ga0070662_100260653 3300005457 Bacteria 1396
34 Ga0070662_101245849 3300005457 Bacteria 640
35 Ga0068867_100631528 3300005459 Bacteria 938
36 Ga0068867_100919649 3300005459 Unclassified 788
37 Ga0070699_101073316 3300005518 Unclassified 739
38 Ga0070679_102162000 3300005530 Bacteria 506
39 Ga0070684_101828661 3300005535 Unclassified 573
40 Ga0070672_100198182 3300005543 Bacteria 1678
41 Ga0070672_100636520 3300005543 Unclassified 931
42 Ga0070672_101618093 3300005543 Unclassified 581
43 Ga0070672_102014870 3300005543 Bacteria 520
44 Ga0070686_100947617 3300005544 Bacteria 703
45 Ga0070695_100185748 3300005545 Bacteria 1476
46 Ga0070696_100418129 3300005546 Bacteria 1052
47 Ga0070665_100000164 3300005548 Bacteria 120601
48 Ga0070665_100339844 3300005548 Bacteria 1506
49 Ga0070664_100320323 3300005564 Bacteria 1405
50 Ga0068854_100450176 3300005578 Bacteria 1075
51 Ga0068854_100489393 3300005578 Bacteria 1034
52 Ga0068854_100852736 3300005578 Bacteria 798
53 Ga0068854_100982179 3300005578 Bacteria 747
54 Ga0070702_101107815 3300005615 Bacteria 633
55 Ga0068859_100058523 3300005617 Bacteria 3882
56 Ga0068864_100021205 3300005618 Bacteria 5442
57 Ga0068870_10121177 3300005840 Bacteria 1507
58 Ga0068863_100008160 3300005841 Bacteria 10227
59 Ga0068863_100015677 3300005841 Bacteria 7276
60 Ga0068858_101556930 3300005842 Bacteria 652
61 Ga0068860_100000284 3300005843 Bacteria 72294
62 Ga0068860_100923922 3300005843 Bacteria 889
63 Ga0068862_100009466 3300005844 Bacteria 8062
64 Ga0068862_100586852 3300005844 Bacteria 1068
65 Ga0081538_10234698 3300005981 Bacteria 713
66 Ga0075368_10298813 3300006042 Bacteria 694
67 Ga0075364_10000471 3300006051 Bacteria 20466
68 Ga0075366_10903581 3300006195 Bacteria 550
69 Ga0075370_10700916 3300006353 Bacteria 615
70 Ga0075428_100287165 3300006844 Bacteria 1770
71 Ga0075428_100537433 3300006844 Bacteria 1250
72 Ga0075433_10220738 3300006852 Bacteria 1684
73 Ga0075433_10476855 3300006852 Bacteria 1099
74 Ga0075434_100013024 3300006871 Bacteria 7897
75 Ga0097620_100058522 3300006931 Bacteria 3882
76 Ga0105245_10414115 3300009098 Bacteria 1349
77 Ga0105247_10689336 3300009101 Bacteria 768
78 Ga0114129_10240664 3300009147 Bacteria 2433
79 Ga0105243_10699053 3300009148 Bacteria 988
80 Ga0105241_10161753 3300009174 Bacteria 1841
81 Ga0105242_10618413 3300009176 Unclassified 1049
82 Ga0105248_10736235 3300009177 Bacteria 1112
83 Ga0105248_12376219 3300009177 Unclassified 604
84 Ga0105237_12655506 3300009545 Bacteria 512
85 Ga0105238_10922330 3300009551 Bacteria 892
86 Ga0105249_10864148 3300009553 Bacteria 970
87 Ga0105239_10187347 3300010375 Bacteria 2316
88 Ga0157373_10130938 3300013100 Bacteria 1764
89 Ga0157369_10526915 3300013105 Bacteria 1222
90 Ga0157374_10897443 3300013296 Unclassified 904
91 Ga0157378_11883232 3300013297 Unclassified 647
92 Ga0157378_12503932 3300013297 Unclassified 568
93 Ga0157378_12635002 3300013297 Unclassified 555
94 Ga0163162_10052257 3300013306 Bacteria 4104
95 Ga0163162_11417713 3300013306 Unclassified 790
96 Ga0157372_11567633 3300013307 Bacteria 758
97 Ga0182008_10085580 3300014497 Bacteria 1553
98 Ga0206349_1862906 3300020075 Unclassified 596
99 Ga0206352_10815015 3300020078 Unclassified 722
100 Ga0207425_1001135 3300025245 Bacteria 11986
101 Ga0209129_1001680 3300025258 Bacteria 11986
102 Ga0209673_1007725 3300025273 Bacteria 4897
103 Ga0209025_1004530 3300025294 Bacteria 11986
104 Ga0209025_1145485 3300025294 Bacteria 663
105 Ga0209758_1009237 3300025297 Bacteria 6183
106 Ga0209256_1008918 3300025299 Bacteria 4519
107 Ga0209256_1029958 3300025299 Bacteria 1508
108 Ga0209256_1059114 3300025299 Bacteria 899
109 Ga0209256_1063906 3300025299 Bacteria 848
110 Ga0207680_10017342 3300025903 Bacteria 3803
111 Ga0207647_10288735 3300025904 Bacteria 935
112 Ga0207643_10031710 3300025908 Bacteria 2948
113 Ga0207707_10734060 3300025912 Bacteria 827
114 Ga0207657_10085519 3300025919 Bacteria 2642
115 Ga0207681_10117426 3300025923 Bacteria 1945
116 Ga0207694_10780273 3300025924 Bacteria 807
117 Ga0207650_10817897 3300025925 Unclassified 790
118 Ga0207650_11175084 3300025925 Bacteria 653
119 Ga0207659_11405560 3300025926 Bacteria 598
120 Ga0207644_11408916 3300025931 Unclassified 585
121 Ga0207691_10049582 3300025940 Bacteria 3847
122 Ga0207711_10736273 3300025941 Bacteria 919
123 Ga0207689_10073017 3300025942 Bacteria 2819
124 Ga0207661_10174415 3300025944 Unclassified 1874
125 Ga0207679_10184259 3300025945 Unclassified 1729
126 Ga0207679_11712714 3300025945 Unclassified 575
127 Ga0207651_10433988 3300025960 Bacteria 1124
128 Ga0207651_10772551 3300025960 Bacteria 850
129 Ga0207712_10513853 3300025961 Bacteria 1025
130 Ga0207668_10009268 3300025972 Bacteria 5891
131 Ga0207640_10257753 3300025981 Bacteria 1357
132 Ga0207640_10294462 3300025981 Bacteria 1281
133 Ga0207640_10430685 3300025981 Bacteria 1082
134 Ga0207658_10000279 3300025986 Bacteria 53475
135 Ga0207658_10079706 3300025986 Bacteria 2506
136 Ga0207658_11499672 3300025986 Unclassified 617
137 Ga0207703_11913687 3300026035 Bacteria 569
138 Ga0207678_10098816 3300026067 Bacteria 2493
139 Ga0207678_10189795 3300026067 Bacteria 1756
140 Ga0207678_10613878 3300026067 Bacteria 954
141 Ga0207708_10156752 3300026075 Bacteria 1796
142 Ga0207641_10006000 3300026088 Bacteria 10295
143 Ga0207641_10011272 3300026088 Bacteria 7333
144 Ga0207648_10325792 3300026089 Bacteria 1381
145 Ga0207676_10327268 3300026095 Bacteria 1409
146 Ga0207676_12126438 3300026095 Unclassified 560
147 Ga0207674_10682682 3300026116 Bacteria 991
148 Ga0207675_102324693 3300026118 Bacteria 549
149 Ga0209974_10085956 3300027876 Bacteria 1087
150 Ga0268266_10330277 3300028379 Bacteria 1429
151 Ga0268265_10232107 3300028380 Bacteria 1622
152 Ga0268265_10540714 3300028380 Bacteria 1104
153 Ga0268264_10000337 3300028381 Bacteria 72308
154 Ga0268264_10869988 3300028381 Bacteria 903
155 Ga0307408_100627879 3300031548 Bacteria 958
156 Ga0307405_10000156 3300031731 Bacteria 26152
157 Ga0307405_10564361 3300031731 Bacteria 923
158 Ga0307413_10413945 3300031824 Bacteria 1060
159 Ga0307410_11085602 3300031852 Bacteria 693
160 Ga0307406_11466351 3300031901 Bacteria 600
161 Ga0307407_10253993 3300031903 Bacteria 1206
162 Ga0307407_10704643 3300031903 Unclassified 761
163 Ga0307412_10038744 3300031911 Bacteria 3072
164 Ga0307409_100975043 3300031995 Bacteria 865
165 Ga0307409_101488552 3300031995 Bacteria 704
166 Ga0307409_101917326 3300031995 Unclassified 622
167 Ga0307416_100115885 3300032002 Bacteria 2374
168 Ga0307415_101120624 3300032126 Bacteria 738
169 Ga0307415_101767363 3300032126 Bacteria 598
170 Ga0307415_102160527 3300032126 Bacteria 544
171 Ga0307415_102308689 3300032126 Unclassified 528
172 Ga0373951_0024363 3300035091 Bacteria 1401
173 Ga0373931_0227740 3300035691 Bacteria 1125
174 Ga0395901_0234964 3300038443 Bacteria 1913
175 Ga0242420_021575 3300038996 Bacteria 1154
176 Ga0436365_0052778 3300039437 Bacteria 5394
177 Ga0451800_0408251 3300041459 Bacteria 791
178 Ga0451807_0003122 3300041486 Bacteria 655
179 Ga0450912_002964 3300042116 Bacteria 1180
180 Ga0450893_0051178 3300042532 Bacteria 774
181 Ga0450901_035252 3300042533 Bacteria 558
182 Ga0466960_0859454 3300044901 Bacteria 552
183 Ga0495606_0395701 3300046507 Bacteria 721
184 Ga0495654_0010045 3300046530 Bacteria 5167
185 Ga0495686_0000601 3300047472 Bacteria 50079
186 Ga0496101_1320151 3300048904 Unclassified 564
187 Ga0496102_0086221 3300048905 Bacteria 2900
188 Ga0496104_1509634 3300048907 Unclassified 575
189 Ga0496106_0030500 3300048909 Bacteria 4019
190 Ga0496107_0786886 3300048910 Unclassified 697
191 Ga0496110_0858431 3300048913 Bacteria 813
192 Ga0496111_0803877 3300048914 Unclassified 680
193 Ga0496112_0317624 3300048915 Unclassified 1502
194 Ga0496112_0339021 3300048915 Unclassified 1447
195 Ga0496116_0007453 3300048919 Bacteria 9702
196 Ga0496116_0024022 3300048919 Bacteria 4520
197 Ga0496117_0036163 3300048920 Bacteria 3699
198 Ga0496120_0236831 3300048923 Bacteria 864
199 Ga0496121_0001281 3300048924 Bacteria 43294
200 Ga0496121_0042462 3300048924 Bacteria 3955
201 Ga0496122_0016339 3300048925 Bacteria 7031
202 Ga0496122_0055363 3300048925 Bacteria 2968
203 Ga0496122_0072964 3300048925 Bacteria 2437
204 Ga0496122_0121888 3300048925 Bacteria 1679
205 Ga0496122_0400838 3300048925 Bacteria 696
206 Ga0496123_0017422 3300048926 Bacteria 5780
207 Ga0496123_0053708 3300048926 Bacteria 2660
208 Ga0496124_0000442 3300048927 Bacteria 73411
209 Ga0496124_0034835 3300048927 Bacteria 4411
210 Ga0496124_0073162 3300048927 Bacteria 2836
211 Ga0496124_0614905 3300048927 Bacteria 704
212 Ga0496125_0000034 3300048928 Bacteria 348231
213 Ga0496125_0104325 3300048928 Bacteria 2076
214 Ga0496126_0011432 3300048929 Bacteria 9187
215 Ga0496126_0271917 3300048929 Bacteria 1406
216 Ga0496126_0401232 3300048929 Bacteria 1112
217 Ga0501034_0050562 3300049571 Bacteria 4192
218 Ga0501034_0093632 3300049571 Bacteria 3001
219 Ga0501037_1013121 3300049573 Bacteria 540
220 Ga0501067_0295064 3300049583 Bacteria 903
221 Ga0501069_0222313 3300049585 Unclassified 1098
222 Ga0501071_1559482 3300049587 Unclassified 510
223 Ga0501073_0816067 3300049589 Bacteria 643
224 Ga0501217_147955 3300049661 Bacteria 700
225 Ga0501233_125604 3300049668 Unclassified 697
226 Ga0501221_067805 3300049704 Bacteria 837
227 Ga0501225_0022458 3300049705 Bacteria 1742
228 Ga0501081_0603731 3300049743 Bacteria 822
229 Ga0501280_002631 3300049776 Bacteria 2938
230 nmdc:mga00v17_221_c1 3300050491 Bacteria 34258
231 nmdc:mga0yw44_440_c2 3300050492 Bacteria 10409
232 nmdc:mga0qj67_1419944_c1 3300050509 Bacteria 535
233 nmdc:mga06r32_773667_c1 3300050510 Bacteria 922
234 nmdc:mga0n895_738356_c1 3300050512 Unclassified 978
235 nmdc:mga08x19_1175793_c1 3300050514 Unclassified 544
236 nmdc:mga0a205_167571_c1 3300050515 Bacteria 2092
237 Ga0500556_0287097 3300053104 Bacteria 644
238 Ga0500592_000006 3300053116 Bacteria 104757
239 Ga0500618_016951 3300053125 Unclassified 1817
240 Ga0500652_131334 3300053131 Bacteria 1045
241 Ga0500559_0044233 3300053136 Bacteria 1947
242 Ga0500568_0324556 3300053139 Bacteria 558
243 Ga0500588_0100770 3300053146 Bacteria 995
244 Ga0500604_0277463 3300053151 Unclassified 581
245 Ga0500627_0000025 3300053158 Bacteria 103391
246 Ga0500627_0286248 3300053158 Bacteria 722
247 Ga0590071_193793 3300059421 Bacteria 534
248 Ga0587090_041785 3300059510 Bacteria 810
249 Ga0587090_123806 3300059510 Bacteria 563
250 Ga0587091_045521 3300059511 Unclassified 882
251 Ga0530510_0572768 3300061734 Bacteria 858
252 Ga0530510_1303933 3300061734 Unclassified 557
253 2599723741 2599185236 Bacteria 6875203
254 2821129998 2821123053 Bacteria 7836056
255 2857537486 2857531043 Bacteria 6754041
256 Ga0075431_100873470
257 JGI24739J22299_10075797
258 JGI25152J39213_1005077
259 JGI25152J39213_1005382
260 JGI25153J46596_10020282
261 rootL2_10256666
262 Ga0055525_1000123
263 Ga0055528_1002462
264 Ga0058861_11307761
265 Ga0065712_10332619
266 Ga0065715_10140883
267 Ga0070690_101071568
268 Ga0070670_100044077
269 Ga0068869_100264439
270 Ga0070666_10122202
271 Ga0070691_10945055
272 Ga0070692_10042289
273 Ga0070668_100016355
274 Ga0070669_100051415
275 Ga0070669_101451654
276 Ga0070675_100804883
277 Ga0070675_101028171
278 Ga0070671_100659091
279 Ga0070671_100747250
280 Ga0070671_101979081
281 Ga0070673_100663580
282 Ga0070673_101922664
283 Ga0070659_100581509
284 Ga0070659_100861856
285 Ga0070667_100000195
286 Ga0070667_100093176
287 Ga0070663_100592176
288 Ga0070662_100260653
289 Ga0070662_101245849
290 Ga0068867_100631528
291 Ga0068867_100919649
292 Ga0070699_101073316
293 Ga0070679_102162000
294 Ga0070684_101828661
295 Ga0070672_100198182
296 Ga0070672_100636520
297 Ga0070672_101618093
298 Ga0070672_102014870
299 Ga0070686_100947617
300 Ga0070695_100185748
301 Ga0070696_100418129
302 Ga0070665_100000164
303 Ga0070665_100339844
304 Ga0070664_100320323
305 Ga0068854_100450176
306 Ga0068854_100489393
307 Ga0068854_100852736
308 Ga0068854_100982179
309 Ga0070702_101107815
310 Ga0068859_100058523
311 Ga0068864_100021205
312 Ga0068870_10121177
313 Ga0068863_100008160
314 Ga0068863_100015677
315 Ga0068858_101556930
316 Ga0068860_100000284
317 Ga0068860_100923922
318 Ga0068862_100009466
319 Ga0068862_100586852
320 Ga0081538_10234698
321 Ga0075368_10298813
322 Ga0075364_10000471
323 Ga0075366_10903581
324 Ga0075370_10700916
325 Ga0075428_100287165
326 Ga0075428_100537433
327 Ga0075433_10220738
328 Ga0075433_10476855
329 Ga0075434_100013024
330 Ga0097620_100058522
331 Ga0105245_10414115
332 Ga0105247_10689336
333 Ga0114129_10240664
334 Ga0105243_10699053
335 Ga0105241_10161753
336 Ga0105242_10618413
337 Ga0105248_10736235
338 Ga0105248_12376219
339 Ga0105237_12655506
340 Ga0105238_10922330
341 Ga0105249_10864148
342 Ga0105239_10187347
343 Ga0157373_10130938
344 Ga0157369_10526915
345 Ga0157374_10897443
346 Ga0157378_11883232
347 Ga0157378_12503932
348 Ga0157378_12635002
349 Ga0163162_10052257
350 Ga0163162_11417713
351 Ga0157372_11567633
352 Ga0182008_10085580
353 Ga0206349_1862906
354 Ga0206352_10815015
355 Ga0207425_1001135
356 Ga0209129_1001680
357 Ga0209673_1007725
358 Ga0209025_1004530
359 Ga0209025_1145485
360 Ga0209758_1009237
361 Ga0209256_1008918
362 Ga0209256_1029958
363 Ga0209256_1059114
364 Ga0209256_1063906
365 Ga0207680_10017342
366 Ga0207647_10288735
367 Ga0207643_10031710
368 Ga0207707_10734060
369 Ga0207657_10085519
370 Ga0207681_10117426
371 Ga0207694_10780273
372 Ga0207650_10817897
373 Ga0207650_11175084
374 Ga0207659_11405560
375 Ga0207644_11408916
376 Ga0207691_10049582
377 Ga0207711_10736273
378 Ga0207689_10073017
379 Ga0207661_10174415
380 Ga0207679_10184259
381 Ga0207679_11712714
382 Ga0207651_10433988
383 Ga0207651_10772551
384 Ga0207712_10513853
385 Ga0207668_10009268
386 Ga0207640_10257753
387 Ga0207640_10294462
388 Ga0207640_10430685
389 Ga0207658_10000279
390 Ga0207658_10079706
391 Ga0207658_11499672
392 Ga0207703_11913687
393 Ga0207678_10098816
394 Ga0207678_10189795
395 Ga0207678_10613878
396 Ga0207708_10156752
397 Ga0207641_10006000
398 Ga0207641_10011272
399 Ga0207648_10325792
400 Ga0207676_10327268
401 Ga0207676_12126438
402 Ga0207674_10682682
403 Ga0207675_102324693
404 Ga0209974_10085956
405 Ga0268266_10330277
406 Ga0268265_10232107
407 Ga0268265_10540714
408 Ga0268264_10000337
409 Ga0268264_10869988
410 Ga0307408_100627879
411 Ga0307405_10000156
412 Ga0307405_10564361
413 Ga0307413_10413945
414 Ga0307410_11085602
415 Ga0307406_11466351
416 Ga0307407_10253993
417 Ga0307407_10704643
418 Ga0307412_10038744
419 Ga0307409_100975043
420 Ga0307409_101488552
421 Ga0307409_101917326
422 Ga0307416_100115885
423 Ga0307415_101120624
424 Ga0307415_101767363
425 Ga0307415_102160527
426 Ga0307415_102308689
427 Ga0373951_0024363
428 Ga0373931_0227740
429 Ga0395901_0234964
430 Ga0242420_021575
431 Ga0436365_0052778
432 Ga0451800_0408251
433 Ga0451807_0003122
434 Ga0450912_002964
435 Ga0450893_0051178
436 Ga0450901_035252
437 Ga0466960_0859454
438 Ga0495606_0395701
439 Ga0495654_0010045
440 Ga0495686_0000601
441 Ga0496101_1320151
442 Ga0496102_0086221
443 Ga0496104_1509634
444 Ga0496106_0030500
445 Ga0496107_0786886
446 Ga0496110_0858431
447 Ga0496111_0803877
448 Ga0496112_0317624
449 Ga0496112_0339021
450 Ga0496116_0007453
451 Ga0496116_0024022
452 Ga0496117_0036163
453 Ga0496120_0236831
454 Ga0496121_0001281
455 Ga0496121_0042462
456 Ga0496122_0016339
457 Ga0496122_0055363
458 Ga0496122_0072964
459 Ga0496122_0121888
460 Ga0496122_0400838
461 Ga0496123_0017422
462 Ga0496123_0053708
463 Ga0496124_0000442
464 Ga0496124_0034835
465 Ga0496124_0073162
466 Ga0496124_0614905
467 Ga0496125_0000034
468 Ga0496125_0104325
469 Ga0496126_0011432
470 Ga0496126_0271917
471 Ga0496126_0401232
472 Ga0501034_0050562
473 Ga0501034_0093632
474 Ga0501037_1013121
475 Ga0501067_0295064
476 Ga0501069_0222313
477 Ga0501071_1559482
478 Ga0501073_0816067
479 Ga0501217_147955
480 Ga0501233_125604
481 Ga0501221_067805
482 Ga0501225_0022458
483 Ga0501081_0603731
484 Ga0501280_002631
485 nmdc:mga00v17_221_c1
486 nmdc:mga0yw44_440_c2
487 nmdc:mga0qj67_1419944_c1
488 nmdc:mga06r32_773667_c1
489 nmdc:mga0n895_738356_c1
490 nmdc:mga08x19_1175793_c1
491 nmdc:mga0a205_167571_c1
492 Ga0500556_0287097
493 Ga0500592_000006
494 Ga0500618_016951
495 Ga0500652_131334
496 Ga0500559_0044233
497 Ga0500568_0324556
498 Ga0500588_0100770
499 Ga0500604_0277463
500 Ga0500627_0000025
501 Ga0500627_0286248
502 Ga0590071_193793
503 Ga0587090_041785
504 Ga0587090_123806
505 Ga0587091_045521
506 Ga0530510_0572768
507 Ga0530510_1303933
508 2599723741
509 2821129998
510 2857537486

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map