F365381

General Info

Members Datasets Scaffolds Average Seq Length
255 119 254 241

Family's Representative Sequence

Representative Sequence 3300004803|Ga0058862_11434725|Ga0058862_114347251
Length 260
Sequence MPVFVLPDINERCIPLLNMTRLSVNINKIATLRNSRGGNNPDLIQVAKDCERFGAQGITVHPRPDERHIRYNDVFELKKIVTTEFNIEGNCQEQKFIDLVLDNKPEQVTLVPDALGQLTSNHGWDTIRHQRYLKDMIGVFKQAGIRVSIFVDPVEAMVEAAATTGTDRIELYTEAYAHQYHHNKEAAIDPYVRAAERAKMLGLGINAGHDLDLHNLRYFAENIPALAEVSIGHALISDALYYGLENTIQMYLRQLAILEL

Samples

Sample ID Description Type Environment
1 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
58 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
94 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
95 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
96 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
97 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
98 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
107 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
108 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
109 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
110 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
111 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
112 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
113 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
114 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
115 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
116 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
117 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
118 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
119 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0.39
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.75
Nodule 0
Rhizoplane 0.39
Rhizosphere 91.37
Stem 0
Stem Tuber 0
Unclassified 5.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1007116 3300001904 Bacteria 1885
2 JGI24737J22298_10010443 3300001990 Bacteria 3064
3 JGI24735J21928_10018026 3300002067 Bacteria 2179
4 rootH1_10112253 3300003316 Bacteria 7997
5 rootH2_10053759 3300003320 Bacteria 2168
6 rootL2_10125855 3300003322 Bacteria 2542
7 rootL2_10169426 3300003322 Bacteria 1720
8 rootH1_10031024 3300003323 Bacteria 3493
9 rootH1_10152660 3300003323 Bacteria 4435
10 Ga0058862_11434725 3300004803 Bacteria 907
11 Ga0070658_10255796 3300005327 Bacteria 1486
12 Ga0070658_10328877 3300005327 Bacteria 1306
13 Ga0070658_10387476 3300005327 Bacteria 1199
14 Ga0070676_10005026 3300005328 Bacteria 7009
15 Ga0070683_100060899 3300005329 Bacteria 3508
16 Ga0070683_100117957 3300005329 Bacteria 2506
17 Ga0070680_100029784 3300005336 Bacteria 4382
18 Ga0070680_100036141 3300005336 Bacteria 3990
19 Ga0068868_100036788 3300005338 Bacteria 3792
20 Ga0070660_100033658 3300005339 Bacteria 3865
21 Ga0070660_100054682 3300005339 Bacteria 3083
22 Ga0070660_100199302 3300005339 Bacteria 1623
23 Ga0070660_100211582 3300005339 Unclassified 1574
24 Ga0070660_100255054 3300005339 Bacteria 1431
25 Ga0070671_100023169 3300005355 Bacteria 5078
26 Ga0070659_100000465 3300005366 Bacteria 29940
27 Ga0070659_100005787 3300005366 Bacteria 8902
28 Ga0070659_100029171 3300005366 Bacteria 4263
29 Ga0070659_100496340 3300005366 Bacteria 1040
30 Ga0070667_100078889 3300005367 Unclassified 2814
31 Ga0070714_100106144 3300005435 Bacteria 2481
32 Ga0070663_100067568 3300005455 Bacteria 2593
33 Ga0070662_100000003 3300005457 Bacteria 239813
34 Ga0070681_10032987 3300005458 Bacteria 5198
35 Ga0070681_10052163 3300005458 Bacteria 4079
36 Ga0070681_10083041 3300005458 Bacteria 3157
37 Ga0068867_100004194 3300005459 Bacteria 10140
38 Ga0070679_100000575 3300005530 Bacteria 31162
39 Ga0070679_100002419 3300005530 Bacteria 16911
40 Ga0070679_100047586 3300005530 Bacteria 4274
41 Ga0070679_100465655 3300005530 Bacteria 1208
42 Ga0070679_100511300 3300005530 Unclassified 1145
43 Ga0070684_100074467 3300005535 Bacteria 2993
44 Ga0070684_100107297 3300005535 Bacteria 2501
45 Ga0068853_100010151 3300005539 Bacteria 7609
46 Ga0068853_100010413 3300005539 Bacteria 7525
47 Ga0070665_100000212 3300005548 Bacteria 100019
48 Ga0068855_100000204 3300005563 Bacteria 76041
49 Ga0068855_100030990 3300005563 Bacteria 6391
50 Ga0068855_100042453 3300005563 Bacteria 5388
51 Ga0068855_100051994 3300005563 Bacteria 4825
52 Ga0068855_100114281 3300005563 Bacteria 3095
53 Ga0068856_100000095 3300005614 Bacteria 84075
54 Ga0068856_100015228 3300005614 Bacteria 7432
55 Ga0068856_100029846 3300005614 Bacteria 5329
56 Ga0068856_100030529 3300005614 Bacteria 5268
57 Ga0068856_100117970 3300005614 Bacteria 2655
58 Ga0068852_100001859 3300005616 Bacteria 14363
59 Ga0068851_10000202 3300005834 Bacteria 28826
60 Ga0068863_100357061 3300005841 Bacteria 1424
61 Ga0068862_100239451 3300005844 Unclassified 1649
62 Ga0070712_100203963 3300006175 Bacteria 1555
63 Ga0075366_10007134 3300006195 Bacteria 6153
64 Ga0075366_10008157 3300006195 Bacteria 5811
65 Ga0097621_100000480 3300006237 Bacteria 27941
66 Ga0068871_100000112 3300006358 Bacteria 49503
67 Ga0068865_100001252 3300006881 Bacteria 14770
68 Ga0105240_10040747 3300009093 Bacteria 5936
69 Ga0105240_10080298 3300009093 Bacteria 4011
70 Ga0105240_10375754 3300009093 Bacteria 1606
71 Ga0105240_10550997 3300009093 Bacteria 1276
72 Ga0105243_10444697 3300009148 Bacteria 1214
73 Ga0105241_10000529 3300009174 Bacteria 28750
74 Ga0105241_10009082 3300009174 Bacteria 7314
75 Ga0105242_10060252 3300009176 Bacteria 3118
76 Ga0105242_10073334 3300009176 Bacteria 2845
77 Ga0105237_10001197 3300009545 Bacteria 34705
78 Ga0105237_10338365 3300009545 Bacteria 1509
79 Ga0105238_10013100 3300009551 Bacteria 8367
80 Ga0105239_10013699 3300010375 Bacteria 9005
81 Ga0105239_10055405 3300010375 Bacteria 4348
82 Ga0105239_10181756 3300010375 Bacteria 2353
83 Ga0105246_10024462 3300011119 Bacteria 3925
84 Ga0157373_10001316 3300013100 Bacteria 18999
85 Ga0157373_10002632 3300013100 Bacteria 13617
86 Ga0157373_10004809 3300013100 Bacteria 10161
87 Ga0157373_10007113 3300013100 Bacteria 8342
88 Ga0157373_10098630 3300013100 Bacteria 2056
89 Ga0157373_10172352 3300013100 Bacteria 1522
90 Ga0157371_10000155 3300013102 Bacteria 100230
91 Ga0157371_10001598 3300013102 Bacteria 23238
92 Ga0157371_10003654 3300013102 Bacteria 13849
93 Ga0157371_10008389 3300013102 Bacteria 8237
94 Ga0157371_10033090 3300013102 Bacteria 3716
95 Ga0157371_10127666 3300013102 Bacteria 1808
96 Ga0157370_10002692 3300013104 Bacteria 21301
97 Ga0157370_10005125 3300013104 Bacteria 14778
98 Ga0157370_10150234 3300013104 Bacteria 2168
99 Ga0157370_10329485 3300013104 Bacteria 1408
100 Ga0157369_10076414 3300013105 Bacteria 3590
101 Ga0157369_10156471 3300013105 Bacteria 2407
102 Ga0157369_10161338 3300013105 Bacteria 2367
103 Ga0157369_10210050 3300013105 Bacteria 2040
104 Ga0157369_10305617 3300013105 Bacteria 1654
105 Ga0157369_10326623 3300013105 Bacteria 1594
106 Ga0157374_10000414 3300013296 Bacteria 38746
107 Ga0157374_10002959 3300013296 Bacteria 14226
108 Ga0157374_10114805 3300013296 Bacteria 2593
109 Ga0157378_10100737 3300013297 Bacteria 2638
110 Ga0157378_10149756 3300013297 Unclassified 2173
111 Ga0157372_10003738 3300013307 Bacteria 16334
112 Ga0157372_10004146 3300013307 Bacteria 15520
113 Ga0157372_10019675 3300013307 Bacteria 7274
114 Ga0157372_10033369 3300013307 Bacteria 5653
115 Ga0157372_10137232 3300013307 Bacteria 2817
116 Ga0157372_10213136 3300013307 Bacteria 2238
117 Ga0157372_10329785 3300013307 Bacteria 1777
118 Ga0157372_10379361 3300013307 Bacteria 1647
119 Ga0157372_10599985 3300013307 Bacteria 1283
120 Ga0157375_10008624 3300013308 Bacteria 8927
121 Ga0163163_10158109 3300014325 Bacteria 2311
122 Ga0163163_10761472 3300014325 Unclassified 1032
123 Ga0157380_10000983 3300014326 Bacteria 18096
124 Ga0209233_1001254 3300025261 Bacteria 10199
125 Ga0207656_10000793 3300025321 Bacteria 10322
126 Ga0207647_10000135 3300025904 Bacteria 58247
127 Ga0207647_10000244 3300025904 Bacteria 44547
128 Ga0207645_10000014 3300025907 Bacteria 117512
129 Ga0207705_10002776 3300025909 Bacteria 13384
130 Ga0207705_10196195 3300025909 Bacteria 1528
131 Ga0207705_10576827 3300025909 Bacteria 874
132 Ga0207654_10000324 3300025911 Bacteria 28612
133 Ga0207654_10007082 3300025911 Bacteria 5652
134 Ga0207707_10022115 3300025912 Bacteria 5559
135 Ga0207707_10025209 3300025912 Bacteria 5202
136 Ga0207707_10316822 3300025912 Bacteria 1347
137 Ga0207695_10321636 3300025913 Bacteria 1436
138 Ga0207695_10550663 3300025913 Bacteria 1035
139 Ga0207671_10010179 3300025914 Bacteria 7786
140 Ga0207693_10197404 3300025915 Bacteria 1582
141 Ga0207660_10025675 3300025917 Bacteria 4002
142 Ga0207660_10067973 3300025917 Bacteria 2583
143 Ga0207657_10009776 3300025919 Bacteria 9614
144 Ga0207657_10110320 3300025919 Bacteria 2272
145 Ga0207657_10140743 3300025919 Bacteria 1971
146 Ga0207657_10171919 3300025919 Bacteria 1755
147 Ga0207652_10000051 3300025921 Bacteria 120327
148 Ga0207652_10000713 3300025921 Bacteria 32283
149 Ga0207652_10010663 3300025921 Bacteria 7402
150 Ga0207652_10649840 3300025921 Bacteria 943
151 Ga0207694_10133299 3300025924 Bacteria 1993
152 Ga0207700_10040514 3300025928 Bacteria 3401
153 Ga0207644_10001693 3300025931 Bacteria 14220
154 Ga0207690_10002435 3300025932 Bacteria 11257
155 Ga0207690_10012450 3300025932 Bacteria 5087
156 Ga0207690_10017962 3300025932 Bacteria 4330
157 Ga0207690_10442862 3300025932 Bacteria 1043
158 Ga0207706_10000009 3300025933 Bacteria 200607
159 Ga0207686_10475536 3300025934 Bacteria 965
160 Ga0207669_10384279 3300025937 Bacteria 1095
161 Ga0207704_10000028 3300025938 Bacteria 122144
162 Ga0207704_10610731 3300025938 Bacteria 894
163 Ga0207661_10090803 3300025944 Bacteria 2544
164 Ga0207661_10141281 3300025944 Bacteria 2072
165 Ga0207667_10000095 3300025949 Bacteria 143866
166 Ga0207667_10001758 3300025949 Bacteria 27270
167 Ga0207667_10015451 3300025949 Bacteria 8671
168 Ga0207667_10551550 3300025949 Bacteria 1166
169 Ga0207667_10620205 3300025949 Unclassified 1089
170 Ga0207651_10049514 3300025960 Bacteria 2847
171 Ga0207640_10349252 3300025981 Bacteria 1188
172 Ga0207677_10021166 3300026023 Bacteria 3968
173 Ga0207677_10053160 3300026023 Bacteria 2756
174 Ga0207639_10006972 3300026041 Bacteria 7701
175 Ga0207639_10046483 3300026041 Bacteria 3275
176 Ga0207639_10070562 3300026041 Bacteria 2729
177 Ga0207678_10118918 3300026067 Bacteria 2255
178 Ga0207678_10148281 3300026067 Bacteria 2002
179 Ga0207702_10000163 3300026078 Bacteria 79263
180 Ga0207702_10006801 3300026078 Bacteria 9807
181 Ga0207702_10040267 3300026078 Bacteria 3918
182 Ga0207702_10040374 3300026078 Bacteria 3913
183 Ga0207702_10056421 3300026078 Bacteria 3335
184 Ga0207702_10141114 3300026078 Bacteria 2180
185 Ga0207641_10340333 3300026088 Bacteria 1427
186 Ga0207648_10000173 3300026089 Bacteria 66953
187 Ga0207683_10005369 3300026121 Bacteria 10986
188 Ga0268266_10000177 3300028379 Bacteria 114318
189 Ga0307517_10001416 3300028786 Bacteria 40353
190 Ga0307515_10000012 3300028794 Bacteria 582232
191 Ga0307515_10000224 3300028794 Bacteria 140276
192 Ga0265338_10050953 3300028800 Bacteria 3736
193 Ga0265332_10090752 3300031238 Bacteria 1292
194 Ga0265327_10049058 3300031251 Bacteria 2216
195 Ga0307509_10128168 3300031507 Bacteria 2499
196 Ga0307414_10462615 3300032004 Bacteria 1115
197 Ga0307510_10000599 3300033180 Bacteria 36447
198 Ga0316584_0182324 3300036712 Bacteria 1554
199 Ga0395899_0000681 3300037312 Bacteria 34363
200 Ga0395899_0012648 3300037312 Bacteria 6469
201 Ga0395899_0049104 3300037312 Bacteria 3137
202 Ga0395899_0062097 3300037312 Bacteria 2751
203 Ga0395899_0084574 3300037312 Bacteria 2306
204 Ga0395899_0118170 3300037312 Bacteria 1901
205 Ga0395900_0000151 3300037418 Bacteria 116281
206 Ga0395900_0002306 3300037418 Bacteria 21189
207 Ga0395900_0007686 3300037418 Bacteria 11120
208 Ga0395900_0009502 3300037418 Bacteria 9969
209 Ga0395900_0068801 3300037418 Bacteria 3638
210 Ga0395900_0331608 3300037418 Bacteria 1499
211 Ga0395900_0562910 3300037418 Bacteria 1083
212 Ga0395898_0001447 3300037466 Bacteria 33615
213 Ga0395898_0024848 3300037466 Bacteria 6040
214 Ga0395898_0045485 3300037466 Bacteria 4315
215 Ga0395898_0336911 3300037466 Bacteria 1438
216 Ga0395898_0376150 3300037466 Bacteria 1354
217 Ga0395905_0002210 3300037471 Bacteria 21952
218 Ga0395905_0021232 3300037471 Bacteria 6144
219 Ga0395905_0055161 3300037471 Bacteria 3719
220 Ga0395905_0096738 3300037471 Bacteria 2772
221 Ga0395905_0436718 3300037471 Unclassified 1206
222 Ga0395901_0001349 3300038443 Bacteria 25743
223 Ga0395901_0001630 3300038443 Bacteria 23212
224 Ga0395901_0041287 3300038443 Bacteria 4780
225 Ga0395901_0083355 3300038443 Bacteria 3342
226 Ga0395901_0089286 3300038443 Bacteria 3225
227 Ga0395901_0223757 3300038443 Bacteria 1966
228 Ga0400489_51776 3300039093 Bacteria 2029
229 Ga0400489_69338 3300039093 Bacteria 8561
230 Ga0436365_1434925 3300039437 Unclassified 1182
231 Ga0436361_1099943 3300039447 Bacteria 18661
232 Ga0439465_0060548 3300041413 Bacteria 1254
233 Ga0439448_0079360 3300042005 Bacteria 1101
234 Ga0451577_0000213 3300042876 Bacteria 121176
235 Ga0451577_0075075 3300042876 Bacteria 3015
236 Ga0451577_0168413 3300042876 Unclassified 1974
237 Ga0451577_0575562 3300042876 Bacteria 1022
238 Ga0453684_0011647 3300044712 Bacteria 14679
239 Ga0453684_0085134 3300044712 Bacteria 3929
240 Ga0453684_0500843 3300044712 Bacteria 1345
241 Ga0453684_0594324 3300044712 Unclassified 1214
242 Ga0453684_0621916 3300044712 Bacteria 1181
243 Ga0495585_0000250 3300046492 Bacteria 55780
244 Ga0495631_0003504 3300046518 Bacteria 8583
245 Ga0495687_000409 3300047443 Bacteria 53157
246 Ga0495686_0000303 3300047472 Bacteria 84544
247 Ga0495686_0037058 3300047472 Bacteria 3127
248 Ga0495686_0055938 3300047472 Bacteria 2466
249 Ga0496115_0001695 3300048918 Bacteria 15793
250 Ga0501069_0182262 3300049585 Unclassified 1214
251 nmdc:mga0k408_1180_c1 3300050493 Bacteria 14295
252 nmdc:mga0k408_16119_c1 3300050493 Bacteria 4141
253 Ga0500635_0002406 3300053080 Bacteria 4634
254 Ga0500616_0068897 3300053153 Bacteria 1810

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006175 Ga0070712_100203963 Ga0070712_1002039632 237
2 3300009176 Ga0105242_10060252 Ga0105242_100602523 237
3 3300025915 Ga0207693_10197404 Ga0207693_101974042 237
4 3300031507 Ga0307509_10128168 Ga0307509_101281684 237
5 3300036712 Ga0316584_0182324 Ga0316584_0182324_790_1503 237
6 3300039093 Ga0400489_51776 Ga0400489_51776_1034_1747 237
7 3300039093 Ga0400489_69338 Ga0400489_69338_2536_3249 237
8 3300044712 Ga0453684_0011647 Ga0453684_0011647_7020_7733 237
9 3300044712 Ga0453684_0500843 Ga0453684_0500843_34_753 237
10 3300053153 Ga0500616_0068897 Ga0500616_0068897_216_953 237
11 3300003316 rootH1_10112253 rootH1_101122535 238
12 3300003320 rootH2_10053759 rootH2_100537592 238
13 3300003322 rootL2_10125855 rootL2_101258554 238
14 3300003322 rootL2_10169426 rootL2_101694262 238
15 3300003323 rootH1_10031024 rootH1_100310244 238
16 3300005328 Ga0070676_10005026 Ga0070676_100050263 238
17 3300005338 Ga0068868_100036788 Ga0068868_1000367882 238
18 3300005339 Ga0070660_100211582 Ga0070660_1002115822 238
19 3300005355 Ga0070671_100023169 Ga0070671_1000231693 238
20 3300005367 Ga0070667_100078889 Ga0070667_1000788892 238
21 3300005435 Ga0070714_100106144 Ga0070714_1001061443 238
22 3300005458 Ga0070681_10032987 Ga0070681_100329872 238
23 3300005459 Ga0068867_100004194 Ga0068867_1000041945 238
24 3300005539 Ga0068853_100010151 Ga0068853_1000101512 238
25 3300005539 Ga0068853_100010413 Ga0068853_1000104136 238
26 3300005548 Ga0070665_100000212 Ga0070665_10000021288 238
27 3300005614 Ga0068856_100030529 Ga0068856_1000305297 238
28 3300005616 Ga0068852_100001859 Ga0068852_10000185913 238
29 3300005834 Ga0068851_10000202 Ga0068851_100002028 238
30 3300005841 Ga0068863_100357061 Ga0068863_1003570612 238
31 3300005844 Ga0068862_100239451 Ga0068862_1002394512 238
32 3300006195 Ga0075366_10007134 Ga0075366_100071342 238
33 3300006237 Ga0097621_100000480 Ga0097621_10000048020 238
34 3300006358 Ga0068871_100000112 Ga0068871_10000011218 238
35 3300006881 Ga0068865_100001252 Ga0068865_10000125214 238
36 3300009093 Ga0105240_10375754 Ga0105240_103757542 238
37 3300009148 Ga0105243_10444697 Ga0105243_104446971 238
38 3300009174 Ga0105241_10009082 Ga0105241_100090822 238
39 3300009176 Ga0105242_10073334 Ga0105242_100733343 238
40 3300009545 Ga0105237_10001197 Ga0105237_1000119713 238
41 3300009551 Ga0105238_10013100 Ga0105238_100131002 238
42 3300010375 Ga0105239_10013699 Ga0105239_100136995 238
43 3300010375 Ga0105239_10055405 Ga0105239_100554053 238
44 3300010375 Ga0105239_10181756 Ga0105239_101817562 238
45 3300013296 Ga0157374_10002959 Ga0157374_1000295913 238
46 3300013297 Ga0157378_10100737 Ga0157378_101007372 238
47 3300013297 Ga0157378_10149756 Ga0157378_101497563 238
48 3300013308 Ga0157375_10008624 Ga0157375_100086243 238
49 3300014325 Ga0163163_10158109 Ga0163163_101581091 238
50 3300014325 Ga0163163_10761472 Ga0163163_107614722 238
51 3300014326 Ga0157380_10000983 Ga0157380_1000098316 238
52 3300025321 Ga0207656_10000793 Ga0207656_100007937 238
53 3300025907 Ga0207645_10000014 Ga0207645_100000149 238
54 3300025911 Ga0207654_10007082 Ga0207654_100070822 238
55 3300025912 Ga0207707_10025209 Ga0207707_100252094 238
56 3300025914 Ga0207671_10010179 Ga0207671_100101796 238
57 3300025924 Ga0207694_10133299 Ga0207694_101332992 238
58 3300025928 Ga0207700_10040514 Ga0207700_100405143 238
59 3300025931 Ga0207644_10001693 Ga0207644_100016936 238
60 3300025934 Ga0207686_10475536 Ga0207686_104755362 238
61 3300025937 Ga0207669_10384279 Ga0207669_103842792 238
62 3300025938 Ga0207704_10000028 Ga0207704_10000028107 238
63 3300025960 Ga0207651_10049514 Ga0207651_100495142 238
64 3300025981 Ga0207640_10349252 Ga0207640_103492522 238
65 3300026023 Ga0207677_10053160 Ga0207677_100531602 238
66 3300026041 Ga0207639_10006972 Ga0207639_100069722 238
67 3300026041 Ga0207639_10046483 Ga0207639_100464833 238
68 3300026078 Ga0207702_10006801 Ga0207702_1000680112 238
69 3300026078 Ga0207702_10141114 Ga0207702_101411142 238
70 3300026088 Ga0207641_10340333 Ga0207641_103403332 238
71 3300026089 Ga0207648_10000173 Ga0207648_1000017360 238
72 3300026121 Ga0207683_10005369 Ga0207683_100053692 238
73 3300028379 Ga0268266_10000177 Ga0268266_1000017733 238
74 3300028786 Ga0307517_10001416 Ga0307517_1000141619 238
75 3300028794 Ga0307515_10000012 Ga0307515_10000012280 238
76 3300028794 Ga0307515_10000224 Ga0307515_10000224102 238
77 3300028800 Ga0265338_10050953 Ga0265338_100509532 238
78 3300031238 Ga0265332_10090752 Ga0265332_100907522 238
79 3300031251 Ga0265327_10049058 Ga0265327_100490581 238
80 3300037312 Ga0395899_0062097 Ga0395899_0062097_1672_2388 238
81 3300037418 Ga0395900_0007686 Ga0395900_0007686_1464_2180 238
82 3300037418 Ga0395900_0068801 Ga0395900_0068801_633_1385 238
83 3300037466 Ga0395898_0024848 Ga0395898_0024848_4945_5661 238
84 3300037466 Ga0395898_0376150 Ga0395898_0376150_314_1066 238
85 3300037471 Ga0395905_0002210 Ga0395905_0002210_18403_19119 238
86 3300037471 Ga0395905_0021232 Ga0395905_0021232_2130_2882 238
87 3300037471 Ga0395905_0096738 Ga0395905_0096738_314_1030 238
88 3300038443 Ga0395901_0083355 Ga0395901_0083355_2467_3183 238
89 3300038443 Ga0395901_0089286 Ga0395901_0089286_506_1222 238
90 3300039437 Ga0436365_1434925 Ga0436365_1434925_62_778 238
91 3300039447 Ga0436361_1099943 Ga0436361_1099943_10844_11560 238
92 3300041413 Ga0439465_0060548 Ga0439465_0060548_26_745 238
93 3300042005 Ga0439448_0079360 Ga0439448_0079360_75_791 238
94 3300042876 Ga0451577_0000213 Ga0451577_0000213_66734_67453 238
95 3300042876 Ga0451577_0075075 Ga0451577_0075075_31_762 238
96 3300042876 Ga0451577_0168413 Ga0451577_0168413_153_869 238
97 3300042876 Ga0451577_0575562 Ga0451577_0575562_94_831 238
98 3300044712 Ga0453684_0085134 Ga0453684_0085134_1074_1790 238
99 3300044712 Ga0453684_0594324 Ga0453684_0594324_284_1009 238
100 3300044712 Ga0453684_0621916 Ga0453684_0621916_234_971 238
101 3300047443 Ga0495687_000409 Ga0495687_000409_41915_42631 238
102 3300047472 Ga0495686_0000303 Ga0495686_0000303_8951_9667 238
103 3300047472 Ga0495686_0037058 Ga0495686_0037058_93_812 238
104 3300049585 Ga0501069_0182262 Ga0501069_0182262_377_1093 238
105 3300050493 nmdc:mga0k408_16119_c1 nmdc:mga0k408_16119_c1_1818_2537 238
106 iso_pu_bacteria 2852623160 2852626974 238
107 3300001904 JGI24736J21556_1007116 JGI24736J21556_10071162 239
108 3300001990 JGI24737J22298_10010443 JGI24737J22298_100104432 239
109 3300002067 JGI24735J21928_10018026 JGI24735J21928_100180263 239
110 3300003323 rootH1_10152660 rootH1_101526604 239
111 3300004803 Ga0058862_11434725 Ga0058862_114347251 239
112 3300005327 Ga0070658_10255796 Ga0070658_102557962 239
113 3300005327 Ga0070658_10328877 Ga0070658_103288772 239
114 3300005327 Ga0070658_10387476 Ga0070658_103874761 239
115 3300005329 Ga0070683_100060899 Ga0070683_1000608992 239
116 3300005329 Ga0070683_100117957 Ga0070683_1001179572 239
117 3300005336 Ga0070680_100029784 Ga0070680_1000297843 239
118 3300005336 Ga0070680_100036141 Ga0070680_1000361414 239
119 3300005339 Ga0070660_100033658 Ga0070660_1000336582 239
120 3300005339 Ga0070660_100054682 Ga0070660_1000546823 239
121 3300005339 Ga0070660_100199302 Ga0070660_1001993021 239
122 3300005339 Ga0070660_100255054 Ga0070660_1002550542 239
123 3300005366 Ga0070659_100000465 Ga0070659_10000046519 239
124 3300005366 Ga0070659_100005787 Ga0070659_1000057877 239
125 3300005366 Ga0070659_100029171 Ga0070659_1000291712 239
126 3300005366 Ga0070659_100496340 Ga0070659_1004963401 239
127 3300005455 Ga0070663_100067568 Ga0070663_1000675681 239
128 3300005457 Ga0070662_100000003 Ga0070662_10000000384 239
129 3300005458 Ga0070681_10052163 Ga0070681_100521635 239
130 3300005458 Ga0070681_10083041 Ga0070681_100830413 239
131 3300005530 Ga0070679_100000575 Ga0070679_10000057516 239
132 3300005530 Ga0070679_100002419 Ga0070679_10000241910 239
133 3300005530 Ga0070679_100047586 Ga0070679_1000475861 239
134 3300005530 Ga0070679_100465655 Ga0070679_1004656553 239
135 3300005530 Ga0070679_100511300 Ga0070679_1005113001 239
136 3300005535 Ga0070684_100074467 Ga0070684_1000744672 239
137 3300005535 Ga0070684_100107297 Ga0070684_1001072971 239
138 3300005563 Ga0068855_100000204 Ga0068855_10000020445 239
139 3300005563 Ga0068855_100030990 Ga0068855_1000309906 239
140 3300005563 Ga0068855_100042453 Ga0068855_1000424534 239
141 3300005563 Ga0068855_100051994 Ga0068855_1000519944 239
142 3300005563 Ga0068855_100114281 Ga0068855_1001142812 239
143 3300005614 Ga0068856_100000095 Ga0068856_1000000955 239
144 3300005614 Ga0068856_100015228 Ga0068856_1000152282 239
145 3300005614 Ga0068856_100029846 Ga0068856_1000298463 239
146 3300005614 Ga0068856_100117970 Ga0068856_1001179705 239
147 3300006195 Ga0075366_10008157 Ga0075366_100081572 239
148 3300009093 Ga0105240_10040747 Ga0105240_100407475 239
149 3300009093 Ga0105240_10080298 Ga0105240_100802982 239
150 3300009093 Ga0105240_10550997 Ga0105240_105509972 239
151 3300009174 Ga0105241_10000529 Ga0105241_1000052919 239
152 3300009545 Ga0105237_10338365 Ga0105237_103383652 239
153 3300011119 Ga0105246_10024462 Ga0105246_100244624 239
154 3300013100 Ga0157373_10001316 Ga0157373_100013166 239
155 3300013100 Ga0157373_10002632 Ga0157373_1000263212 239
156 3300013100 Ga0157373_10004809 Ga0157373_100048096 239
157 3300013100 Ga0157373_10007113 Ga0157373_100071132 239
158 3300013100 Ga0157373_10098630 Ga0157373_100986302 239
159 3300013100 Ga0157373_10172352 Ga0157373_101723521 239
160 3300013102 Ga0157371_10000155 Ga0157371_1000015557 239
161 3300013102 Ga0157371_10001598 Ga0157371_100015988 239
162 3300013102 Ga0157371_10003654 Ga0157371_100036545 239
163 3300013102 Ga0157371_10008389 Ga0157371_100083891 239
164 3300013102 Ga0157371_10033090 Ga0157371_100330903 239
165 3300013102 Ga0157371_10127666 Ga0157371_101276662 239
166 3300013104 Ga0157370_10002692 Ga0157370_1000269216 239
167 3300013104 Ga0157370_10005125 Ga0157370_100051256 239
168 3300013104 Ga0157370_10150234 Ga0157370_101502341 239
169 3300013104 Ga0157370_10329485 Ga0157370_103294852 239
170 3300013105 Ga0157369_10076414 Ga0157369_100764143 239
171 3300013105 Ga0157369_10156471 Ga0157369_101564712 239
172 3300013105 Ga0157369_10161338 Ga0157369_101613382 239
173 3300013105 Ga0157369_10210050 Ga0157369_102100503 239
174 3300013105 Ga0157369_10305617 Ga0157369_103056173 239
175 3300013105 Ga0157369_10326623 Ga0157369_103266231 239
176 3300013296 Ga0157374_10000414 Ga0157374_1000041420 239
177 3300013296 Ga0157374_10114805 Ga0157374_101148052 239
178 3300013307 Ga0157372_10003738 Ga0157372_100037382 239
179 3300013307 Ga0157372_10004146 Ga0157372_100041462 239
180 3300013307 Ga0157372_10019675 Ga0157372_100196754 239
181 3300013307 Ga0157372_10033369 Ga0157372_100333694 239
182 3300013307 Ga0157372_10137232 Ga0157372_101372322 239
183 3300013307 Ga0157372_10213136 Ga0157372_102131362 239
184 3300013307 Ga0157372_10329785 Ga0157372_103297853 239
185 3300013307 Ga0157372_10379361 Ga0157372_103793612 239
186 3300013307 Ga0157372_10599985 Ga0157372_105999852 239
187 3300025261 Ga0209233_1001254 Ga0209233_10012541 239
188 3300025904 Ga0207647_10000135 Ga0207647_100001359 239
189 3300025904 Ga0207647_10000244 Ga0207647_1000024429 239
190 3300025909 Ga0207705_10002776 Ga0207705_100027763 239
191 3300025909 Ga0207705_10196195 Ga0207705_101961951 239
192 3300025909 Ga0207705_10576827 Ga0207705_105768271 239
193 3300025911 Ga0207654_10000324 Ga0207654_1000032419 239
194 3300025912 Ga0207707_10022115 Ga0207707_100221153 239
195 3300025912 Ga0207707_10316822 Ga0207707_103168221 239
196 3300025913 Ga0207695_10321636 Ga0207695_103216361 239
197 3300025913 Ga0207695_10550663 Ga0207695_105506631 239
198 3300025917 Ga0207660_10025675 Ga0207660_100256752 239
199 3300025917 Ga0207660_10067973 Ga0207660_100679735 239
200 3300025919 Ga0207657_10009776 Ga0207657_100097762 239
201 3300025919 Ga0207657_10110320 Ga0207657_101103203 239
202 3300025919 Ga0207657_10140743 Ga0207657_101407433 239
203 3300025919 Ga0207657_10171919 Ga0207657_101719192 239
204 3300025921 Ga0207652_10000051 Ga0207652_1000005171 239
205 3300025921 Ga0207652_10000713 Ga0207652_100007134 239
206 3300025921 Ga0207652_10010663 Ga0207652_100106634 239
207 3300025921 Ga0207652_10649840 Ga0207652_106498401 239
208 3300025932 Ga0207690_10002435 Ga0207690_100024355 239
209 3300025932 Ga0207690_10012450 Ga0207690_100124502 239
210 3300025932 Ga0207690_10017962 Ga0207690_100179623 239
211 3300025932 Ga0207690_10442862 Ga0207690_104428622 239
212 3300025933 Ga0207706_10000009 Ga0207706_1000000992 239
213 3300025938 Ga0207704_10610731 Ga0207704_106107311 239
214 3300025944 Ga0207661_10090803 Ga0207661_100908032 239
215 3300025944 Ga0207661_10141281 Ga0207661_101412811 239
216 3300025949 Ga0207667_10000095 Ga0207667_1000009579 239
217 3300025949 Ga0207667_10001758 Ga0207667_1000175825 239
218 3300025949 Ga0207667_10015451 Ga0207667_100154519 239
219 3300025949 Ga0207667_10551550 Ga0207667_105515502 239
220 3300025949 Ga0207667_10620205 Ga0207667_106202052 239
221 3300026023 Ga0207677_10021166 Ga0207677_100211662 239
222 3300026041 Ga0207639_10070562 Ga0207639_100705622 239
223 3300026067 Ga0207678_10118918 Ga0207678_101189182 239
224 3300026067 Ga0207678_10148281 Ga0207678_101482812 239
225 3300026078 Ga0207702_10000163 Ga0207702_1000016373 239
226 3300026078 Ga0207702_10040267 Ga0207702_100402673 239
227 3300026078 Ga0207702_10040374 Ga0207702_100403743 239
228 3300026078 Ga0207702_10056421 Ga0207702_100564213 239
229 3300032004 Ga0307414_10462615 Ga0307414_104626152 239
230 3300033180 Ga0307510_10000599 Ga0307510_100005997 239
231 3300037312 Ga0395899_0000681 Ga0395899_0000681_33616_34338 239
232 3300037312 Ga0395899_0012648 Ga0395899_0012648_3616_4350 239
233 3300037312 Ga0395899_0049104 Ga0395899_0049104_497_1228 239
234 3300037312 Ga0395899_0084574 Ga0395899_0084574_1140_1877 239
235 3300037312 Ga0395899_0118170 Ga0395899_0118170_819_1541 239
236 3300037418 Ga0395900_0000151 Ga0395900_0000151_100707_101432 239
237 3300037418 Ga0395900_0002306 Ga0395900_0002306_15645_16382 239
238 3300037418 Ga0395900_0009502 Ga0395900_0009502_4437_5171 239
239 3300037418 Ga0395900_0331608 Ga0395900_0331608_306_1028 239
240 3300037418 Ga0395900_0562910 Ga0395900_0562910_149_871 239
241 3300037466 Ga0395898_0001447 Ga0395898_0001447_9557_10291 239
242 3300037466 Ga0395898_0045485 Ga0395898_0045485_2873_3595 239
243 3300037466 Ga0395898_0336911 Ga0395898_0336911_382_1104 239
244 3300037471 Ga0395905_0055161 Ga0395905_0055161_772_1494 239
245 3300037471 Ga0395905_0436718 Ga0395905_0436718_256_978 239
246 3300038443 Ga0395901_0001349 Ga0395901_0001349_8562_9296 239
247 3300038443 Ga0395901_0001630 Ga0395901_0001630_11193_11924 239
248 3300038443 Ga0395901_0041287 Ga0395901_0041287_1417_2139 239
249 3300038443 Ga0395901_0223757 Ga0395901_0223757_772_1494 239
250 3300046492 Ga0495585_0000250 Ga0495585_0000250_27196_27921 239
251 3300046518 Ga0495631_0003504 Ga0495631_0003504_6629_7348 239
252 3300047472 Ga0495686_0055938 Ga0495686_0055938_51_770 239
253 3300048918 Ga0496115_0001695 Ga0496115_0001695_3358_4086 239
254 3300050493 nmdc:mga0k408_1180_c1 nmdc:mga0k408_1180_c1_11324_12043 239
255 3300053080 Ga0500635_0002406 Ga0500635_0002406_2934_3653 239

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03740

PdxJ

Pyridoxal phosphate biosynthesis protein PdxJ

21

255

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6w6a-assembly1.cif.gz_A crystal structure of a pyridoxine 5'-phosphate synthease from stenotrophomonas maltophilia k279a 0.9673 1 236
1ixo-assembly3.cif.gz_A-2 enzyme-analogue substrate complex of pyridoxine 5'-phosphate synthase 0.9575 2 237
6w6a-assembly1.cif.gz_A crystal structure of a pyridoxine 5'-phosphate synthease from stenotrophomonas maltophilia k279a 0.9515 1 236
1ho1-assembly1.cif.gz_C crystal structure of pyridoxine 5'-phosphate synthase 0.9428 2 237
3f4n-assembly5.cif.gz_B crystal structure of pyridoxal phosphate biosynthetic protein pdxj from yersinia pestis 0.9421 1 236
ID Description Score Start End Superfamily
3gk0A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9338 2 238 3.20.20.70
3gk0A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9225 2 238 3.20.20.70
3o6cA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9073 1 239 3.20.20.70
3o6cA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9037 1 239 3.20.20.70
3t40A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.817 2 236 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A1I2IY77-F1-model_v4 Pyridoxine 5'-phosphate synthase (PNP synthase) (EC 2.6.99.2) 0.9993 1 239 GO:0005829
GO:0008615
GO:0033856
AF-A0A4Q9H7M9-F1-model_v4 Pyridoxine 5'-phosphate synthase (PNP synthase) (EC 2.6.99.2) 0.9989 1 238 GO:0005829
GO:0008615
GO:0033856
AF-A0A520D9Z4-F1-model_v4 Pyridoxine 5'-phosphate synthase (EC 2.6.99.2) 0.9987 1 155 GO:0005829
GO:0008615
GO:0033856
AF-A0A1R4KTH0-F1-model_v4 Pyridoxine 5'-phosphate synthase (PNP synthase) (EC 2.6.99.2) 0.9982 1 239 GO:0005829
GO:0008615
GO:0033856
AF-A0A353R880-F1-model_v4 Pyridoxine 5'-phosphate synthase (EC 2.6.99.2) 0.9982 1 236 GO:0005829
GO:0008615
GO:0033856

Feature Viewer

pLDDT pTM Quality
95.38 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map