F365381
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 255 | 119 | 254 | 241 |
Family's Representative Sequence
| Representative Sequence | 3300004803|Ga0058862_11434725|Ga0058862_114347251 |
| Length | 260 |
| Sequence | MPVFVLPDINERCIPLLNMTRLSVNINKIATLRNSRGGNNPDLIQVAKDCERFGAQGITVHPRPDERHIRYNDVFELKKIVTTEFNIEGNCQEQKFIDLVLDNKPEQVTLVPDALGQLTSNHGWDTIRHQRYLKDMIGVFKQAGIRVSIFVDPVEAMVEAAATTGTDRIELYTEAYAHQYHHNKEAAIDPYVRAAERAKMLGLGINAGHDLDLHNLRYFAENIPALAEVSIGHALISDALYYGLENTIQMYLRQLAILEL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 30 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 31 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 32 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 33 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 34 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 36 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 38 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 39 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 91 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 92 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 93 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 94 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 95 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 96 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 97 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 98 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 99 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 100 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 101 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 102 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 103 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 104 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 105 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 106 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 107 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 108 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 109 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 110 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 111 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 116 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 117 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 118 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 119 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.22 |
| Metatranscriptomes | 0.39 |
| Isolates | 0.39 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.75 |
| Nodule | 0 |
| Rhizoplane | 0.39 |
| Rhizosphere | 91.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1007116 | 3300001904 | Bacteria | 1885 |
| 2 | JGI24737J22298_10010443 | 3300001990 | Bacteria | 3064 |
| 3 | JGI24735J21928_10018026 | 3300002067 | Bacteria | 2179 |
| 4 | rootH1_10112253 | 3300003316 | Bacteria | 7997 |
| 5 | rootH2_10053759 | 3300003320 | Bacteria | 2168 |
| 6 | rootL2_10125855 | 3300003322 | Bacteria | 2542 |
| 7 | rootL2_10169426 | 3300003322 | Bacteria | 1720 |
| 8 | rootH1_10031024 | 3300003323 | Bacteria | 3493 |
| 9 | rootH1_10152660 | 3300003323 | Bacteria | 4435 |
| 10 | Ga0058862_11434725 | 3300004803 | Bacteria | 907 |
| 11 | Ga0070658_10255796 | 3300005327 | Bacteria | 1486 |
| 12 | Ga0070658_10328877 | 3300005327 | Bacteria | 1306 |
| 13 | Ga0070658_10387476 | 3300005327 | Bacteria | 1199 |
| 14 | Ga0070676_10005026 | 3300005328 | Bacteria | 7009 |
| 15 | Ga0070683_100060899 | 3300005329 | Bacteria | 3508 |
| 16 | Ga0070683_100117957 | 3300005329 | Bacteria | 2506 |
| 17 | Ga0070680_100029784 | 3300005336 | Bacteria | 4382 |
| 18 | Ga0070680_100036141 | 3300005336 | Bacteria | 3990 |
| 19 | Ga0068868_100036788 | 3300005338 | Bacteria | 3792 |
| 20 | Ga0070660_100033658 | 3300005339 | Bacteria | 3865 |
| 21 | Ga0070660_100054682 | 3300005339 | Bacteria | 3083 |
| 22 | Ga0070660_100199302 | 3300005339 | Bacteria | 1623 |
| 23 | Ga0070660_100211582 | 3300005339 | Unclassified | 1574 |
| 24 | Ga0070660_100255054 | 3300005339 | Bacteria | 1431 |
| 25 | Ga0070671_100023169 | 3300005355 | Bacteria | 5078 |
| 26 | Ga0070659_100000465 | 3300005366 | Bacteria | 29940 |
| 27 | Ga0070659_100005787 | 3300005366 | Bacteria | 8902 |
| 28 | Ga0070659_100029171 | 3300005366 | Bacteria | 4263 |
| 29 | Ga0070659_100496340 | 3300005366 | Bacteria | 1040 |
| 30 | Ga0070667_100078889 | 3300005367 | Unclassified | 2814 |
| 31 | Ga0070714_100106144 | 3300005435 | Bacteria | 2481 |
| 32 | Ga0070663_100067568 | 3300005455 | Bacteria | 2593 |
| 33 | Ga0070662_100000003 | 3300005457 | Bacteria | 239813 |
| 34 | Ga0070681_10032987 | 3300005458 | Bacteria | 5198 |
| 35 | Ga0070681_10052163 | 3300005458 | Bacteria | 4079 |
| 36 | Ga0070681_10083041 | 3300005458 | Bacteria | 3157 |
| 37 | Ga0068867_100004194 | 3300005459 | Bacteria | 10140 |
| 38 | Ga0070679_100000575 | 3300005530 | Bacteria | 31162 |
| 39 | Ga0070679_100002419 | 3300005530 | Bacteria | 16911 |
| 40 | Ga0070679_100047586 | 3300005530 | Bacteria | 4274 |
| 41 | Ga0070679_100465655 | 3300005530 | Bacteria | 1208 |
| 42 | Ga0070679_100511300 | 3300005530 | Unclassified | 1145 |
| 43 | Ga0070684_100074467 | 3300005535 | Bacteria | 2993 |
| 44 | Ga0070684_100107297 | 3300005535 | Bacteria | 2501 |
| 45 | Ga0068853_100010151 | 3300005539 | Bacteria | 7609 |
| 46 | Ga0068853_100010413 | 3300005539 | Bacteria | 7525 |
| 47 | Ga0070665_100000212 | 3300005548 | Bacteria | 100019 |
| 48 | Ga0068855_100000204 | 3300005563 | Bacteria | 76041 |
| 49 | Ga0068855_100030990 | 3300005563 | Bacteria | 6391 |
| 50 | Ga0068855_100042453 | 3300005563 | Bacteria | 5388 |
| 51 | Ga0068855_100051994 | 3300005563 | Bacteria | 4825 |
| 52 | Ga0068855_100114281 | 3300005563 | Bacteria | 3095 |
| 53 | Ga0068856_100000095 | 3300005614 | Bacteria | 84075 |
| 54 | Ga0068856_100015228 | 3300005614 | Bacteria | 7432 |
| 55 | Ga0068856_100029846 | 3300005614 | Bacteria | 5329 |
| 56 | Ga0068856_100030529 | 3300005614 | Bacteria | 5268 |
| 57 | Ga0068856_100117970 | 3300005614 | Bacteria | 2655 |
| 58 | Ga0068852_100001859 | 3300005616 | Bacteria | 14363 |
| 59 | Ga0068851_10000202 | 3300005834 | Bacteria | 28826 |
| 60 | Ga0068863_100357061 | 3300005841 | Bacteria | 1424 |
| 61 | Ga0068862_100239451 | 3300005844 | Unclassified | 1649 |
| 62 | Ga0070712_100203963 | 3300006175 | Bacteria | 1555 |
| 63 | Ga0075366_10007134 | 3300006195 | Bacteria | 6153 |
| 64 | Ga0075366_10008157 | 3300006195 | Bacteria | 5811 |
| 65 | Ga0097621_100000480 | 3300006237 | Bacteria | 27941 |
| 66 | Ga0068871_100000112 | 3300006358 | Bacteria | 49503 |
| 67 | Ga0068865_100001252 | 3300006881 | Bacteria | 14770 |
| 68 | Ga0105240_10040747 | 3300009093 | Bacteria | 5936 |
| 69 | Ga0105240_10080298 | 3300009093 | Bacteria | 4011 |
| 70 | Ga0105240_10375754 | 3300009093 | Bacteria | 1606 |
| 71 | Ga0105240_10550997 | 3300009093 | Bacteria | 1276 |
| 72 | Ga0105243_10444697 | 3300009148 | Bacteria | 1214 |
| 73 | Ga0105241_10000529 | 3300009174 | Bacteria | 28750 |
| 74 | Ga0105241_10009082 | 3300009174 | Bacteria | 7314 |
| 75 | Ga0105242_10060252 | 3300009176 | Bacteria | 3118 |
| 76 | Ga0105242_10073334 | 3300009176 | Bacteria | 2845 |
| 77 | Ga0105237_10001197 | 3300009545 | Bacteria | 34705 |
| 78 | Ga0105237_10338365 | 3300009545 | Bacteria | 1509 |
| 79 | Ga0105238_10013100 | 3300009551 | Bacteria | 8367 |
| 80 | Ga0105239_10013699 | 3300010375 | Bacteria | 9005 |
| 81 | Ga0105239_10055405 | 3300010375 | Bacteria | 4348 |
| 82 | Ga0105239_10181756 | 3300010375 | Bacteria | 2353 |
| 83 | Ga0105246_10024462 | 3300011119 | Bacteria | 3925 |
| 84 | Ga0157373_10001316 | 3300013100 | Bacteria | 18999 |
| 85 | Ga0157373_10002632 | 3300013100 | Bacteria | 13617 |
| 86 | Ga0157373_10004809 | 3300013100 | Bacteria | 10161 |
| 87 | Ga0157373_10007113 | 3300013100 | Bacteria | 8342 |
| 88 | Ga0157373_10098630 | 3300013100 | Bacteria | 2056 |
| 89 | Ga0157373_10172352 | 3300013100 | Bacteria | 1522 |
| 90 | Ga0157371_10000155 | 3300013102 | Bacteria | 100230 |
| 91 | Ga0157371_10001598 | 3300013102 | Bacteria | 23238 |
| 92 | Ga0157371_10003654 | 3300013102 | Bacteria | 13849 |
| 93 | Ga0157371_10008389 | 3300013102 | Bacteria | 8237 |
| 94 | Ga0157371_10033090 | 3300013102 | Bacteria | 3716 |
| 95 | Ga0157371_10127666 | 3300013102 | Bacteria | 1808 |
| 96 | Ga0157370_10002692 | 3300013104 | Bacteria | 21301 |
| 97 | Ga0157370_10005125 | 3300013104 | Bacteria | 14778 |
| 98 | Ga0157370_10150234 | 3300013104 | Bacteria | 2168 |
| 99 | Ga0157370_10329485 | 3300013104 | Bacteria | 1408 |
| 100 | Ga0157369_10076414 | 3300013105 | Bacteria | 3590 |
| 101 | Ga0157369_10156471 | 3300013105 | Bacteria | 2407 |
| 102 | Ga0157369_10161338 | 3300013105 | Bacteria | 2367 |
| 103 | Ga0157369_10210050 | 3300013105 | Bacteria | 2040 |
| 104 | Ga0157369_10305617 | 3300013105 | Bacteria | 1654 |
| 105 | Ga0157369_10326623 | 3300013105 | Bacteria | 1594 |
| 106 | Ga0157374_10000414 | 3300013296 | Bacteria | 38746 |
| 107 | Ga0157374_10002959 | 3300013296 | Bacteria | 14226 |
| 108 | Ga0157374_10114805 | 3300013296 | Bacteria | 2593 |
| 109 | Ga0157378_10100737 | 3300013297 | Bacteria | 2638 |
| 110 | Ga0157378_10149756 | 3300013297 | Unclassified | 2173 |
| 111 | Ga0157372_10003738 | 3300013307 | Bacteria | 16334 |
| 112 | Ga0157372_10004146 | 3300013307 | Bacteria | 15520 |
| 113 | Ga0157372_10019675 | 3300013307 | Bacteria | 7274 |
| 114 | Ga0157372_10033369 | 3300013307 | Bacteria | 5653 |
| 115 | Ga0157372_10137232 | 3300013307 | Bacteria | 2817 |
| 116 | Ga0157372_10213136 | 3300013307 | Bacteria | 2238 |
| 117 | Ga0157372_10329785 | 3300013307 | Bacteria | 1777 |
| 118 | Ga0157372_10379361 | 3300013307 | Bacteria | 1647 |
| 119 | Ga0157372_10599985 | 3300013307 | Bacteria | 1283 |
| 120 | Ga0157375_10008624 | 3300013308 | Bacteria | 8927 |
| 121 | Ga0163163_10158109 | 3300014325 | Bacteria | 2311 |
| 122 | Ga0163163_10761472 | 3300014325 | Unclassified | 1032 |
| 123 | Ga0157380_10000983 | 3300014326 | Bacteria | 18096 |
| 124 | Ga0209233_1001254 | 3300025261 | Bacteria | 10199 |
| 125 | Ga0207656_10000793 | 3300025321 | Bacteria | 10322 |
| 126 | Ga0207647_10000135 | 3300025904 | Bacteria | 58247 |
| 127 | Ga0207647_10000244 | 3300025904 | Bacteria | 44547 |
| 128 | Ga0207645_10000014 | 3300025907 | Bacteria | 117512 |
| 129 | Ga0207705_10002776 | 3300025909 | Bacteria | 13384 |
| 130 | Ga0207705_10196195 | 3300025909 | Bacteria | 1528 |
| 131 | Ga0207705_10576827 | 3300025909 | Bacteria | 874 |
| 132 | Ga0207654_10000324 | 3300025911 | Bacteria | 28612 |
| 133 | Ga0207654_10007082 | 3300025911 | Bacteria | 5652 |
| 134 | Ga0207707_10022115 | 3300025912 | Bacteria | 5559 |
| 135 | Ga0207707_10025209 | 3300025912 | Bacteria | 5202 |
| 136 | Ga0207707_10316822 | 3300025912 | Bacteria | 1347 |
| 137 | Ga0207695_10321636 | 3300025913 | Bacteria | 1436 |
| 138 | Ga0207695_10550663 | 3300025913 | Bacteria | 1035 |
| 139 | Ga0207671_10010179 | 3300025914 | Bacteria | 7786 |
| 140 | Ga0207693_10197404 | 3300025915 | Bacteria | 1582 |
| 141 | Ga0207660_10025675 | 3300025917 | Bacteria | 4002 |
| 142 | Ga0207660_10067973 | 3300025917 | Bacteria | 2583 |
| 143 | Ga0207657_10009776 | 3300025919 | Bacteria | 9614 |
| 144 | Ga0207657_10110320 | 3300025919 | Bacteria | 2272 |
| 145 | Ga0207657_10140743 | 3300025919 | Bacteria | 1971 |
| 146 | Ga0207657_10171919 | 3300025919 | Bacteria | 1755 |
| 147 | Ga0207652_10000051 | 3300025921 | Bacteria | 120327 |
| 148 | Ga0207652_10000713 | 3300025921 | Bacteria | 32283 |
| 149 | Ga0207652_10010663 | 3300025921 | Bacteria | 7402 |
| 150 | Ga0207652_10649840 | 3300025921 | Bacteria | 943 |
| 151 | Ga0207694_10133299 | 3300025924 | Bacteria | 1993 |
| 152 | Ga0207700_10040514 | 3300025928 | Bacteria | 3401 |
| 153 | Ga0207644_10001693 | 3300025931 | Bacteria | 14220 |
| 154 | Ga0207690_10002435 | 3300025932 | Bacteria | 11257 |
| 155 | Ga0207690_10012450 | 3300025932 | Bacteria | 5087 |
| 156 | Ga0207690_10017962 | 3300025932 | Bacteria | 4330 |
| 157 | Ga0207690_10442862 | 3300025932 | Bacteria | 1043 |
| 158 | Ga0207706_10000009 | 3300025933 | Bacteria | 200607 |
| 159 | Ga0207686_10475536 | 3300025934 | Bacteria | 965 |
| 160 | Ga0207669_10384279 | 3300025937 | Bacteria | 1095 |
| 161 | Ga0207704_10000028 | 3300025938 | Bacteria | 122144 |
| 162 | Ga0207704_10610731 | 3300025938 | Bacteria | 894 |
| 163 | Ga0207661_10090803 | 3300025944 | Bacteria | 2544 |
| 164 | Ga0207661_10141281 | 3300025944 | Bacteria | 2072 |
| 165 | Ga0207667_10000095 | 3300025949 | Bacteria | 143866 |
| 166 | Ga0207667_10001758 | 3300025949 | Bacteria | 27270 |
| 167 | Ga0207667_10015451 | 3300025949 | Bacteria | 8671 |
| 168 | Ga0207667_10551550 | 3300025949 | Bacteria | 1166 |
| 169 | Ga0207667_10620205 | 3300025949 | Unclassified | 1089 |
| 170 | Ga0207651_10049514 | 3300025960 | Bacteria | 2847 |
| 171 | Ga0207640_10349252 | 3300025981 | Bacteria | 1188 |
| 172 | Ga0207677_10021166 | 3300026023 | Bacteria | 3968 |
| 173 | Ga0207677_10053160 | 3300026023 | Bacteria | 2756 |
| 174 | Ga0207639_10006972 | 3300026041 | Bacteria | 7701 |
| 175 | Ga0207639_10046483 | 3300026041 | Bacteria | 3275 |
| 176 | Ga0207639_10070562 | 3300026041 | Bacteria | 2729 |
| 177 | Ga0207678_10118918 | 3300026067 | Bacteria | 2255 |
| 178 | Ga0207678_10148281 | 3300026067 | Bacteria | 2002 |
| 179 | Ga0207702_10000163 | 3300026078 | Bacteria | 79263 |
| 180 | Ga0207702_10006801 | 3300026078 | Bacteria | 9807 |
| 181 | Ga0207702_10040267 | 3300026078 | Bacteria | 3918 |
| 182 | Ga0207702_10040374 | 3300026078 | Bacteria | 3913 |
| 183 | Ga0207702_10056421 | 3300026078 | Bacteria | 3335 |
| 184 | Ga0207702_10141114 | 3300026078 | Bacteria | 2180 |
| 185 | Ga0207641_10340333 | 3300026088 | Bacteria | 1427 |
| 186 | Ga0207648_10000173 | 3300026089 | Bacteria | 66953 |
| 187 | Ga0207683_10005369 | 3300026121 | Bacteria | 10986 |
| 188 | Ga0268266_10000177 | 3300028379 | Bacteria | 114318 |
| 189 | Ga0307517_10001416 | 3300028786 | Bacteria | 40353 |
| 190 | Ga0307515_10000012 | 3300028794 | Bacteria | 582232 |
| 191 | Ga0307515_10000224 | 3300028794 | Bacteria | 140276 |
| 192 | Ga0265338_10050953 | 3300028800 | Bacteria | 3736 |
| 193 | Ga0265332_10090752 | 3300031238 | Bacteria | 1292 |
| 194 | Ga0265327_10049058 | 3300031251 | Bacteria | 2216 |
| 195 | Ga0307509_10128168 | 3300031507 | Bacteria | 2499 |
| 196 | Ga0307414_10462615 | 3300032004 | Bacteria | 1115 |
| 197 | Ga0307510_10000599 | 3300033180 | Bacteria | 36447 |
| 198 | Ga0316584_0182324 | 3300036712 | Bacteria | 1554 |
| 199 | Ga0395899_0000681 | 3300037312 | Bacteria | 34363 |
| 200 | Ga0395899_0012648 | 3300037312 | Bacteria | 6469 |
| 201 | Ga0395899_0049104 | 3300037312 | Bacteria | 3137 |
| 202 | Ga0395899_0062097 | 3300037312 | Bacteria | 2751 |
| 203 | Ga0395899_0084574 | 3300037312 | Bacteria | 2306 |
| 204 | Ga0395899_0118170 | 3300037312 | Bacteria | 1901 |
| 205 | Ga0395900_0000151 | 3300037418 | Bacteria | 116281 |
| 206 | Ga0395900_0002306 | 3300037418 | Bacteria | 21189 |
| 207 | Ga0395900_0007686 | 3300037418 | Bacteria | 11120 |
| 208 | Ga0395900_0009502 | 3300037418 | Bacteria | 9969 |
| 209 | Ga0395900_0068801 | 3300037418 | Bacteria | 3638 |
| 210 | Ga0395900_0331608 | 3300037418 | Bacteria | 1499 |
| 211 | Ga0395900_0562910 | 3300037418 | Bacteria | 1083 |
| 212 | Ga0395898_0001447 | 3300037466 | Bacteria | 33615 |
| 213 | Ga0395898_0024848 | 3300037466 | Bacteria | 6040 |
| 214 | Ga0395898_0045485 | 3300037466 | Bacteria | 4315 |
| 215 | Ga0395898_0336911 | 3300037466 | Bacteria | 1438 |
| 216 | Ga0395898_0376150 | 3300037466 | Bacteria | 1354 |
| 217 | Ga0395905_0002210 | 3300037471 | Bacteria | 21952 |
| 218 | Ga0395905_0021232 | 3300037471 | Bacteria | 6144 |
| 219 | Ga0395905_0055161 | 3300037471 | Bacteria | 3719 |
| 220 | Ga0395905_0096738 | 3300037471 | Bacteria | 2772 |
| 221 | Ga0395905_0436718 | 3300037471 | Unclassified | 1206 |
| 222 | Ga0395901_0001349 | 3300038443 | Bacteria | 25743 |
| 223 | Ga0395901_0001630 | 3300038443 | Bacteria | 23212 |
| 224 | Ga0395901_0041287 | 3300038443 | Bacteria | 4780 |
| 225 | Ga0395901_0083355 | 3300038443 | Bacteria | 3342 |
| 226 | Ga0395901_0089286 | 3300038443 | Bacteria | 3225 |
| 227 | Ga0395901_0223757 | 3300038443 | Bacteria | 1966 |
| 228 | Ga0400489_51776 | 3300039093 | Bacteria | 2029 |
| 229 | Ga0400489_69338 | 3300039093 | Bacteria | 8561 |
| 230 | Ga0436365_1434925 | 3300039437 | Unclassified | 1182 |
| 231 | Ga0436361_1099943 | 3300039447 | Bacteria | 18661 |
| 232 | Ga0439465_0060548 | 3300041413 | Bacteria | 1254 |
| 233 | Ga0439448_0079360 | 3300042005 | Bacteria | 1101 |
| 234 | Ga0451577_0000213 | 3300042876 | Bacteria | 121176 |
| 235 | Ga0451577_0075075 | 3300042876 | Bacteria | 3015 |
| 236 | Ga0451577_0168413 | 3300042876 | Unclassified | 1974 |
| 237 | Ga0451577_0575562 | 3300042876 | Bacteria | 1022 |
| 238 | Ga0453684_0011647 | 3300044712 | Bacteria | 14679 |
| 239 | Ga0453684_0085134 | 3300044712 | Bacteria | 3929 |
| 240 | Ga0453684_0500843 | 3300044712 | Bacteria | 1345 |
| 241 | Ga0453684_0594324 | 3300044712 | Unclassified | 1214 |
| 242 | Ga0453684_0621916 | 3300044712 | Bacteria | 1181 |
| 243 | Ga0495585_0000250 | 3300046492 | Bacteria | 55780 |
| 244 | Ga0495631_0003504 | 3300046518 | Bacteria | 8583 |
| 245 | Ga0495687_000409 | 3300047443 | Bacteria | 53157 |
| 246 | Ga0495686_0000303 | 3300047472 | Bacteria | 84544 |
| 247 | Ga0495686_0037058 | 3300047472 | Bacteria | 3127 |
| 248 | Ga0495686_0055938 | 3300047472 | Bacteria | 2466 |
| 249 | Ga0496115_0001695 | 3300048918 | Bacteria | 15793 |
| 250 | Ga0501069_0182262 | 3300049585 | Unclassified | 1214 |
| 251 | nmdc:mga0k408_1180_c1 | 3300050493 | Bacteria | 14295 |
| 252 | nmdc:mga0k408_16119_c1 | 3300050493 | Bacteria | 4141 |
| 253 | Ga0500635_0002406 | 3300053080 | Bacteria | 4634 |
| 254 | Ga0500616_0068897 | 3300053153 | Bacteria | 1810 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006175 | Ga0070712_100203963 | Ga0070712_1002039632 | 237 |
| 2 | 3300009176 | Ga0105242_10060252 | Ga0105242_100602523 | 237 |
| 3 | 3300025915 | Ga0207693_10197404 | Ga0207693_101974042 | 237 |
| 4 | 3300031507 | Ga0307509_10128168 | Ga0307509_101281684 | 237 |
| 5 | 3300036712 | Ga0316584_0182324 | Ga0316584_0182324_790_1503 | 237 |
| 6 | 3300039093 | Ga0400489_51776 | Ga0400489_51776_1034_1747 | 237 |
| 7 | 3300039093 | Ga0400489_69338 | Ga0400489_69338_2536_3249 | 237 |
| 8 | 3300044712 | Ga0453684_0011647 | Ga0453684_0011647_7020_7733 | 237 |
| 9 | 3300044712 | Ga0453684_0500843 | Ga0453684_0500843_34_753 | 237 |
| 10 | 3300053153 | Ga0500616_0068897 | Ga0500616_0068897_216_953 | 237 |
| 11 | 3300003316 | rootH1_10112253 | rootH1_101122535 | 238 |
| 12 | 3300003320 | rootH2_10053759 | rootH2_100537592 | 238 |
| 13 | 3300003322 | rootL2_10125855 | rootL2_101258554 | 238 |
| 14 | 3300003322 | rootL2_10169426 | rootL2_101694262 | 238 |
| 15 | 3300003323 | rootH1_10031024 | rootH1_100310244 | 238 |
| 16 | 3300005328 | Ga0070676_10005026 | Ga0070676_100050263 | 238 |
| 17 | 3300005338 | Ga0068868_100036788 | Ga0068868_1000367882 | 238 |
| 18 | 3300005339 | Ga0070660_100211582 | Ga0070660_1002115822 | 238 |
| 19 | 3300005355 | Ga0070671_100023169 | Ga0070671_1000231693 | 238 |
| 20 | 3300005367 | Ga0070667_100078889 | Ga0070667_1000788892 | 238 |
| 21 | 3300005435 | Ga0070714_100106144 | Ga0070714_1001061443 | 238 |
| 22 | 3300005458 | Ga0070681_10032987 | Ga0070681_100329872 | 238 |
| 23 | 3300005459 | Ga0068867_100004194 | Ga0068867_1000041945 | 238 |
| 24 | 3300005539 | Ga0068853_100010151 | Ga0068853_1000101512 | 238 |
| 25 | 3300005539 | Ga0068853_100010413 | Ga0068853_1000104136 | 238 |
| 26 | 3300005548 | Ga0070665_100000212 | Ga0070665_10000021288 | 238 |
| 27 | 3300005614 | Ga0068856_100030529 | Ga0068856_1000305297 | 238 |
| 28 | 3300005616 | Ga0068852_100001859 | Ga0068852_10000185913 | 238 |
| 29 | 3300005834 | Ga0068851_10000202 | Ga0068851_100002028 | 238 |
| 30 | 3300005841 | Ga0068863_100357061 | Ga0068863_1003570612 | 238 |
| 31 | 3300005844 | Ga0068862_100239451 | Ga0068862_1002394512 | 238 |
| 32 | 3300006195 | Ga0075366_10007134 | Ga0075366_100071342 | 238 |
| 33 | 3300006237 | Ga0097621_100000480 | Ga0097621_10000048020 | 238 |
| 34 | 3300006358 | Ga0068871_100000112 | Ga0068871_10000011218 | 238 |
| 35 | 3300006881 | Ga0068865_100001252 | Ga0068865_10000125214 | 238 |
| 36 | 3300009093 | Ga0105240_10375754 | Ga0105240_103757542 | 238 |
| 37 | 3300009148 | Ga0105243_10444697 | Ga0105243_104446971 | 238 |
| 38 | 3300009174 | Ga0105241_10009082 | Ga0105241_100090822 | 238 |
| 39 | 3300009176 | Ga0105242_10073334 | Ga0105242_100733343 | 238 |
| 40 | 3300009545 | Ga0105237_10001197 | Ga0105237_1000119713 | 238 |
| 41 | 3300009551 | Ga0105238_10013100 | Ga0105238_100131002 | 238 |
| 42 | 3300010375 | Ga0105239_10013699 | Ga0105239_100136995 | 238 |
| 43 | 3300010375 | Ga0105239_10055405 | Ga0105239_100554053 | 238 |
| 44 | 3300010375 | Ga0105239_10181756 | Ga0105239_101817562 | 238 |
| 45 | 3300013296 | Ga0157374_10002959 | Ga0157374_1000295913 | 238 |
| 46 | 3300013297 | Ga0157378_10100737 | Ga0157378_101007372 | 238 |
| 47 | 3300013297 | Ga0157378_10149756 | Ga0157378_101497563 | 238 |
| 48 | 3300013308 | Ga0157375_10008624 | Ga0157375_100086243 | 238 |
| 49 | 3300014325 | Ga0163163_10158109 | Ga0163163_101581091 | 238 |
| 50 | 3300014325 | Ga0163163_10761472 | Ga0163163_107614722 | 238 |
| 51 | 3300014326 | Ga0157380_10000983 | Ga0157380_1000098316 | 238 |
| 52 | 3300025321 | Ga0207656_10000793 | Ga0207656_100007937 | 238 |
| 53 | 3300025907 | Ga0207645_10000014 | Ga0207645_100000149 | 238 |
| 54 | 3300025911 | Ga0207654_10007082 | Ga0207654_100070822 | 238 |
| 55 | 3300025912 | Ga0207707_10025209 | Ga0207707_100252094 | 238 |
| 56 | 3300025914 | Ga0207671_10010179 | Ga0207671_100101796 | 238 |
| 57 | 3300025924 | Ga0207694_10133299 | Ga0207694_101332992 | 238 |
| 58 | 3300025928 | Ga0207700_10040514 | Ga0207700_100405143 | 238 |
| 59 | 3300025931 | Ga0207644_10001693 | Ga0207644_100016936 | 238 |
| 60 | 3300025934 | Ga0207686_10475536 | Ga0207686_104755362 | 238 |
| 61 | 3300025937 | Ga0207669_10384279 | Ga0207669_103842792 | 238 |
| 62 | 3300025938 | Ga0207704_10000028 | Ga0207704_10000028107 | 238 |
| 63 | 3300025960 | Ga0207651_10049514 | Ga0207651_100495142 | 238 |
| 64 | 3300025981 | Ga0207640_10349252 | Ga0207640_103492522 | 238 |
| 65 | 3300026023 | Ga0207677_10053160 | Ga0207677_100531602 | 238 |
| 66 | 3300026041 | Ga0207639_10006972 | Ga0207639_100069722 | 238 |
| 67 | 3300026041 | Ga0207639_10046483 | Ga0207639_100464833 | 238 |
| 68 | 3300026078 | Ga0207702_10006801 | Ga0207702_1000680112 | 238 |
| 69 | 3300026078 | Ga0207702_10141114 | Ga0207702_101411142 | 238 |
| 70 | 3300026088 | Ga0207641_10340333 | Ga0207641_103403332 | 238 |
| 71 | 3300026089 | Ga0207648_10000173 | Ga0207648_1000017360 | 238 |
| 72 | 3300026121 | Ga0207683_10005369 | Ga0207683_100053692 | 238 |
| 73 | 3300028379 | Ga0268266_10000177 | Ga0268266_1000017733 | 238 |
| 74 | 3300028786 | Ga0307517_10001416 | Ga0307517_1000141619 | 238 |
| 75 | 3300028794 | Ga0307515_10000012 | Ga0307515_10000012280 | 238 |
| 76 | 3300028794 | Ga0307515_10000224 | Ga0307515_10000224102 | 238 |
| 77 | 3300028800 | Ga0265338_10050953 | Ga0265338_100509532 | 238 |
| 78 | 3300031238 | Ga0265332_10090752 | Ga0265332_100907522 | 238 |
| 79 | 3300031251 | Ga0265327_10049058 | Ga0265327_100490581 | 238 |
| 80 | 3300037312 | Ga0395899_0062097 | Ga0395899_0062097_1672_2388 | 238 |
| 81 | 3300037418 | Ga0395900_0007686 | Ga0395900_0007686_1464_2180 | 238 |
| 82 | 3300037418 | Ga0395900_0068801 | Ga0395900_0068801_633_1385 | 238 |
| 83 | 3300037466 | Ga0395898_0024848 | Ga0395898_0024848_4945_5661 | 238 |
| 84 | 3300037466 | Ga0395898_0376150 | Ga0395898_0376150_314_1066 | 238 |
| 85 | 3300037471 | Ga0395905_0002210 | Ga0395905_0002210_18403_19119 | 238 |
| 86 | 3300037471 | Ga0395905_0021232 | Ga0395905_0021232_2130_2882 | 238 |
| 87 | 3300037471 | Ga0395905_0096738 | Ga0395905_0096738_314_1030 | 238 |
| 88 | 3300038443 | Ga0395901_0083355 | Ga0395901_0083355_2467_3183 | 238 |
| 89 | 3300038443 | Ga0395901_0089286 | Ga0395901_0089286_506_1222 | 238 |
| 90 | 3300039437 | Ga0436365_1434925 | Ga0436365_1434925_62_778 | 238 |
| 91 | 3300039447 | Ga0436361_1099943 | Ga0436361_1099943_10844_11560 | 238 |
| 92 | 3300041413 | Ga0439465_0060548 | Ga0439465_0060548_26_745 | 238 |
| 93 | 3300042005 | Ga0439448_0079360 | Ga0439448_0079360_75_791 | 238 |
| 94 | 3300042876 | Ga0451577_0000213 | Ga0451577_0000213_66734_67453 | 238 |
| 95 | 3300042876 | Ga0451577_0075075 | Ga0451577_0075075_31_762 | 238 |
| 96 | 3300042876 | Ga0451577_0168413 | Ga0451577_0168413_153_869 | 238 |
| 97 | 3300042876 | Ga0451577_0575562 | Ga0451577_0575562_94_831 | 238 |
| 98 | 3300044712 | Ga0453684_0085134 | Ga0453684_0085134_1074_1790 | 238 |
| 99 | 3300044712 | Ga0453684_0594324 | Ga0453684_0594324_284_1009 | 238 |
| 100 | 3300044712 | Ga0453684_0621916 | Ga0453684_0621916_234_971 | 238 |
| 101 | 3300047443 | Ga0495687_000409 | Ga0495687_000409_41915_42631 | 238 |
| 102 | 3300047472 | Ga0495686_0000303 | Ga0495686_0000303_8951_9667 | 238 |
| 103 | 3300047472 | Ga0495686_0037058 | Ga0495686_0037058_93_812 | 238 |
| 104 | 3300049585 | Ga0501069_0182262 | Ga0501069_0182262_377_1093 | 238 |
| 105 | 3300050493 | nmdc:mga0k408_16119_c1 | nmdc:mga0k408_16119_c1_1818_2537 | 238 |
| 106 | iso_pu_bacteria | 2852623160 | 2852626974 | 238 |
| 107 | 3300001904 | JGI24736J21556_1007116 | JGI24736J21556_10071162 | 239 |
| 108 | 3300001990 | JGI24737J22298_10010443 | JGI24737J22298_100104432 | 239 |
| 109 | 3300002067 | JGI24735J21928_10018026 | JGI24735J21928_100180263 | 239 |
| 110 | 3300003323 | rootH1_10152660 | rootH1_101526604 | 239 |
| 111 | 3300004803 | Ga0058862_11434725 | Ga0058862_114347251 | 239 |
| 112 | 3300005327 | Ga0070658_10255796 | Ga0070658_102557962 | 239 |
| 113 | 3300005327 | Ga0070658_10328877 | Ga0070658_103288772 | 239 |
| 114 | 3300005327 | Ga0070658_10387476 | Ga0070658_103874761 | 239 |
| 115 | 3300005329 | Ga0070683_100060899 | Ga0070683_1000608992 | 239 |
| 116 | 3300005329 | Ga0070683_100117957 | Ga0070683_1001179572 | 239 |
| 117 | 3300005336 | Ga0070680_100029784 | Ga0070680_1000297843 | 239 |
| 118 | 3300005336 | Ga0070680_100036141 | Ga0070680_1000361414 | 239 |
| 119 | 3300005339 | Ga0070660_100033658 | Ga0070660_1000336582 | 239 |
| 120 | 3300005339 | Ga0070660_100054682 | Ga0070660_1000546823 | 239 |
| 121 | 3300005339 | Ga0070660_100199302 | Ga0070660_1001993021 | 239 |
| 122 | 3300005339 | Ga0070660_100255054 | Ga0070660_1002550542 | 239 |
| 123 | 3300005366 | Ga0070659_100000465 | Ga0070659_10000046519 | 239 |
| 124 | 3300005366 | Ga0070659_100005787 | Ga0070659_1000057877 | 239 |
| 125 | 3300005366 | Ga0070659_100029171 | Ga0070659_1000291712 | 239 |
| 126 | 3300005366 | Ga0070659_100496340 | Ga0070659_1004963401 | 239 |
| 127 | 3300005455 | Ga0070663_100067568 | Ga0070663_1000675681 | 239 |
| 128 | 3300005457 | Ga0070662_100000003 | Ga0070662_10000000384 | 239 |
| 129 | 3300005458 | Ga0070681_10052163 | Ga0070681_100521635 | 239 |
| 130 | 3300005458 | Ga0070681_10083041 | Ga0070681_100830413 | 239 |
| 131 | 3300005530 | Ga0070679_100000575 | Ga0070679_10000057516 | 239 |
| 132 | 3300005530 | Ga0070679_100002419 | Ga0070679_10000241910 | 239 |
| 133 | 3300005530 | Ga0070679_100047586 | Ga0070679_1000475861 | 239 |
| 134 | 3300005530 | Ga0070679_100465655 | Ga0070679_1004656553 | 239 |
| 135 | 3300005530 | Ga0070679_100511300 | Ga0070679_1005113001 | 239 |
| 136 | 3300005535 | Ga0070684_100074467 | Ga0070684_1000744672 | 239 |
| 137 | 3300005535 | Ga0070684_100107297 | Ga0070684_1001072971 | 239 |
| 138 | 3300005563 | Ga0068855_100000204 | Ga0068855_10000020445 | 239 |
| 139 | 3300005563 | Ga0068855_100030990 | Ga0068855_1000309906 | 239 |
| 140 | 3300005563 | Ga0068855_100042453 | Ga0068855_1000424534 | 239 |
| 141 | 3300005563 | Ga0068855_100051994 | Ga0068855_1000519944 | 239 |
| 142 | 3300005563 | Ga0068855_100114281 | Ga0068855_1001142812 | 239 |
| 143 | 3300005614 | Ga0068856_100000095 | Ga0068856_1000000955 | 239 |
| 144 | 3300005614 | Ga0068856_100015228 | Ga0068856_1000152282 | 239 |
| 145 | 3300005614 | Ga0068856_100029846 | Ga0068856_1000298463 | 239 |
| 146 | 3300005614 | Ga0068856_100117970 | Ga0068856_1001179705 | 239 |
| 147 | 3300006195 | Ga0075366_10008157 | Ga0075366_100081572 | 239 |
| 148 | 3300009093 | Ga0105240_10040747 | Ga0105240_100407475 | 239 |
| 149 | 3300009093 | Ga0105240_10080298 | Ga0105240_100802982 | 239 |
| 150 | 3300009093 | Ga0105240_10550997 | Ga0105240_105509972 | 239 |
| 151 | 3300009174 | Ga0105241_10000529 | Ga0105241_1000052919 | 239 |
| 152 | 3300009545 | Ga0105237_10338365 | Ga0105237_103383652 | 239 |
| 153 | 3300011119 | Ga0105246_10024462 | Ga0105246_100244624 | 239 |
| 154 | 3300013100 | Ga0157373_10001316 | Ga0157373_100013166 | 239 |
| 155 | 3300013100 | Ga0157373_10002632 | Ga0157373_1000263212 | 239 |
| 156 | 3300013100 | Ga0157373_10004809 | Ga0157373_100048096 | 239 |
| 157 | 3300013100 | Ga0157373_10007113 | Ga0157373_100071132 | 239 |
| 158 | 3300013100 | Ga0157373_10098630 | Ga0157373_100986302 | 239 |
| 159 | 3300013100 | Ga0157373_10172352 | Ga0157373_101723521 | 239 |
| 160 | 3300013102 | Ga0157371_10000155 | Ga0157371_1000015557 | 239 |
| 161 | 3300013102 | Ga0157371_10001598 | Ga0157371_100015988 | 239 |
| 162 | 3300013102 | Ga0157371_10003654 | Ga0157371_100036545 | 239 |
| 163 | 3300013102 | Ga0157371_10008389 | Ga0157371_100083891 | 239 |
| 164 | 3300013102 | Ga0157371_10033090 | Ga0157371_100330903 | 239 |
| 165 | 3300013102 | Ga0157371_10127666 | Ga0157371_101276662 | 239 |
| 166 | 3300013104 | Ga0157370_10002692 | Ga0157370_1000269216 | 239 |
| 167 | 3300013104 | Ga0157370_10005125 | Ga0157370_100051256 | 239 |
| 168 | 3300013104 | Ga0157370_10150234 | Ga0157370_101502341 | 239 |
| 169 | 3300013104 | Ga0157370_10329485 | Ga0157370_103294852 | 239 |
| 170 | 3300013105 | Ga0157369_10076414 | Ga0157369_100764143 | 239 |
| 171 | 3300013105 | Ga0157369_10156471 | Ga0157369_101564712 | 239 |
| 172 | 3300013105 | Ga0157369_10161338 | Ga0157369_101613382 | 239 |
| 173 | 3300013105 | Ga0157369_10210050 | Ga0157369_102100503 | 239 |
| 174 | 3300013105 | Ga0157369_10305617 | Ga0157369_103056173 | 239 |
| 175 | 3300013105 | Ga0157369_10326623 | Ga0157369_103266231 | 239 |
| 176 | 3300013296 | Ga0157374_10000414 | Ga0157374_1000041420 | 239 |
| 177 | 3300013296 | Ga0157374_10114805 | Ga0157374_101148052 | 239 |
| 178 | 3300013307 | Ga0157372_10003738 | Ga0157372_100037382 | 239 |
| 179 | 3300013307 | Ga0157372_10004146 | Ga0157372_100041462 | 239 |
| 180 | 3300013307 | Ga0157372_10019675 | Ga0157372_100196754 | 239 |
| 181 | 3300013307 | Ga0157372_10033369 | Ga0157372_100333694 | 239 |
| 182 | 3300013307 | Ga0157372_10137232 | Ga0157372_101372322 | 239 |
| 183 | 3300013307 | Ga0157372_10213136 | Ga0157372_102131362 | 239 |
| 184 | 3300013307 | Ga0157372_10329785 | Ga0157372_103297853 | 239 |
| 185 | 3300013307 | Ga0157372_10379361 | Ga0157372_103793612 | 239 |
| 186 | 3300013307 | Ga0157372_10599985 | Ga0157372_105999852 | 239 |
| 187 | 3300025261 | Ga0209233_1001254 | Ga0209233_10012541 | 239 |
| 188 | 3300025904 | Ga0207647_10000135 | Ga0207647_100001359 | 239 |
| 189 | 3300025904 | Ga0207647_10000244 | Ga0207647_1000024429 | 239 |
| 190 | 3300025909 | Ga0207705_10002776 | Ga0207705_100027763 | 239 |
| 191 | 3300025909 | Ga0207705_10196195 | Ga0207705_101961951 | 239 |
| 192 | 3300025909 | Ga0207705_10576827 | Ga0207705_105768271 | 239 |
| 193 | 3300025911 | Ga0207654_10000324 | Ga0207654_1000032419 | 239 |
| 194 | 3300025912 | Ga0207707_10022115 | Ga0207707_100221153 | 239 |
| 195 | 3300025912 | Ga0207707_10316822 | Ga0207707_103168221 | 239 |
| 196 | 3300025913 | Ga0207695_10321636 | Ga0207695_103216361 | 239 |
| 197 | 3300025913 | Ga0207695_10550663 | Ga0207695_105506631 | 239 |
| 198 | 3300025917 | Ga0207660_10025675 | Ga0207660_100256752 | 239 |
| 199 | 3300025917 | Ga0207660_10067973 | Ga0207660_100679735 | 239 |
| 200 | 3300025919 | Ga0207657_10009776 | Ga0207657_100097762 | 239 |
| 201 | 3300025919 | Ga0207657_10110320 | Ga0207657_101103203 | 239 |
| 202 | 3300025919 | Ga0207657_10140743 | Ga0207657_101407433 | 239 |
| 203 | 3300025919 | Ga0207657_10171919 | Ga0207657_101719192 | 239 |
| 204 | 3300025921 | Ga0207652_10000051 | Ga0207652_1000005171 | 239 |
| 205 | 3300025921 | Ga0207652_10000713 | Ga0207652_100007134 | 239 |
| 206 | 3300025921 | Ga0207652_10010663 | Ga0207652_100106634 | 239 |
| 207 | 3300025921 | Ga0207652_10649840 | Ga0207652_106498401 | 239 |
| 208 | 3300025932 | Ga0207690_10002435 | Ga0207690_100024355 | 239 |
| 209 | 3300025932 | Ga0207690_10012450 | Ga0207690_100124502 | 239 |
| 210 | 3300025932 | Ga0207690_10017962 | Ga0207690_100179623 | 239 |
| 211 | 3300025932 | Ga0207690_10442862 | Ga0207690_104428622 | 239 |
| 212 | 3300025933 | Ga0207706_10000009 | Ga0207706_1000000992 | 239 |
| 213 | 3300025938 | Ga0207704_10610731 | Ga0207704_106107311 | 239 |
| 214 | 3300025944 | Ga0207661_10090803 | Ga0207661_100908032 | 239 |
| 215 | 3300025944 | Ga0207661_10141281 | Ga0207661_101412811 | 239 |
| 216 | 3300025949 | Ga0207667_10000095 | Ga0207667_1000009579 | 239 |
| 217 | 3300025949 | Ga0207667_10001758 | Ga0207667_1000175825 | 239 |
| 218 | 3300025949 | Ga0207667_10015451 | Ga0207667_100154519 | 239 |
| 219 | 3300025949 | Ga0207667_10551550 | Ga0207667_105515502 | 239 |
| 220 | 3300025949 | Ga0207667_10620205 | Ga0207667_106202052 | 239 |
| 221 | 3300026023 | Ga0207677_10021166 | Ga0207677_100211662 | 239 |
| 222 | 3300026041 | Ga0207639_10070562 | Ga0207639_100705622 | 239 |
| 223 | 3300026067 | Ga0207678_10118918 | Ga0207678_101189182 | 239 |
| 224 | 3300026067 | Ga0207678_10148281 | Ga0207678_101482812 | 239 |
| 225 | 3300026078 | Ga0207702_10000163 | Ga0207702_1000016373 | 239 |
| 226 | 3300026078 | Ga0207702_10040267 | Ga0207702_100402673 | 239 |
| 227 | 3300026078 | Ga0207702_10040374 | Ga0207702_100403743 | 239 |
| 228 | 3300026078 | Ga0207702_10056421 | Ga0207702_100564213 | 239 |
| 229 | 3300032004 | Ga0307414_10462615 | Ga0307414_104626152 | 239 |
| 230 | 3300033180 | Ga0307510_10000599 | Ga0307510_100005997 | 239 |
| 231 | 3300037312 | Ga0395899_0000681 | Ga0395899_0000681_33616_34338 | 239 |
| 232 | 3300037312 | Ga0395899_0012648 | Ga0395899_0012648_3616_4350 | 239 |
| 233 | 3300037312 | Ga0395899_0049104 | Ga0395899_0049104_497_1228 | 239 |
| 234 | 3300037312 | Ga0395899_0084574 | Ga0395899_0084574_1140_1877 | 239 |
| 235 | 3300037312 | Ga0395899_0118170 | Ga0395899_0118170_819_1541 | 239 |
| 236 | 3300037418 | Ga0395900_0000151 | Ga0395900_0000151_100707_101432 | 239 |
| 237 | 3300037418 | Ga0395900_0002306 | Ga0395900_0002306_15645_16382 | 239 |
| 238 | 3300037418 | Ga0395900_0009502 | Ga0395900_0009502_4437_5171 | 239 |
| 239 | 3300037418 | Ga0395900_0331608 | Ga0395900_0331608_306_1028 | 239 |
| 240 | 3300037418 | Ga0395900_0562910 | Ga0395900_0562910_149_871 | 239 |
| 241 | 3300037466 | Ga0395898_0001447 | Ga0395898_0001447_9557_10291 | 239 |
| 242 | 3300037466 | Ga0395898_0045485 | Ga0395898_0045485_2873_3595 | 239 |
| 243 | 3300037466 | Ga0395898_0336911 | Ga0395898_0336911_382_1104 | 239 |
| 244 | 3300037471 | Ga0395905_0055161 | Ga0395905_0055161_772_1494 | 239 |
| 245 | 3300037471 | Ga0395905_0436718 | Ga0395905_0436718_256_978 | 239 |
| 246 | 3300038443 | Ga0395901_0001349 | Ga0395901_0001349_8562_9296 | 239 |
| 247 | 3300038443 | Ga0395901_0001630 | Ga0395901_0001630_11193_11924 | 239 |
| 248 | 3300038443 | Ga0395901_0041287 | Ga0395901_0041287_1417_2139 | 239 |
| 249 | 3300038443 | Ga0395901_0223757 | Ga0395901_0223757_772_1494 | 239 |
| 250 | 3300046492 | Ga0495585_0000250 | Ga0495585_0000250_27196_27921 | 239 |
| 251 | 3300046518 | Ga0495631_0003504 | Ga0495631_0003504_6629_7348 | 239 |
| 252 | 3300047472 | Ga0495686_0055938 | Ga0495686_0055938_51_770 | 239 |
| 253 | 3300048918 | Ga0496115_0001695 | Ga0496115_0001695_3358_4086 | 239 |
| 254 | 3300050493 | nmdc:mga0k408_1180_c1 | nmdc:mga0k408_1180_c1_11324_12043 | 239 |
| 255 | 3300053080 | Ga0500635_0002406 | Ga0500635_0002406_2934_3653 | 239 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6w6a-assembly1.cif.gz_A | crystal structure of a pyridoxine 5'-phosphate synthease from stenotrophomonas maltophilia k279a | 0.9673 | 1 | 236 |
| 1ixo-assembly3.cif.gz_A-2 | enzyme-analogue substrate complex of pyridoxine 5'-phosphate synthase | 0.9575 | 2 | 237 |
| 6w6a-assembly1.cif.gz_A | crystal structure of a pyridoxine 5'-phosphate synthease from stenotrophomonas maltophilia k279a | 0.9515 | 1 | 236 |
| 1ho1-assembly1.cif.gz_C | crystal structure of pyridoxine 5'-phosphate synthase | 0.9428 | 2 | 237 |
| 3f4n-assembly5.cif.gz_B | crystal structure of pyridoxal phosphate biosynthetic protein pdxj from yersinia pestis | 0.9421 | 1 | 236 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3gk0A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9338 | 2 | 238 | 3.20.20.70 |
| 3gk0A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9225 | 2 | 238 | 3.20.20.70 |
| 3o6cA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9073 | 1 | 239 | 3.20.20.70 |
| 3o6cA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9037 | 1 | 239 | 3.20.20.70 |
| 3t40A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.817 | 2 | 236 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1I2IY77-F1-model_v4 | Pyridoxine 5'-phosphate synthase (PNP synthase) (EC 2.6.99.2) | 0.9993 | 1 | 239 |
GO:0005829
GO:0008615 GO:0033856 |
| AF-A0A4Q9H7M9-F1-model_v4 | Pyridoxine 5'-phosphate synthase (PNP synthase) (EC 2.6.99.2) | 0.9989 | 1 | 238 |
GO:0005829
GO:0008615 GO:0033856 |
| AF-A0A520D9Z4-F1-model_v4 | Pyridoxine 5'-phosphate synthase (EC 2.6.99.2) | 0.9987 | 1 | 155 |
GO:0005829
GO:0008615 GO:0033856 |
| AF-A0A1R4KTH0-F1-model_v4 | Pyridoxine 5'-phosphate synthase (PNP synthase) (EC 2.6.99.2) | 0.9982 | 1 | 239 |
GO:0005829
GO:0008615 GO:0033856 |
| AF-A0A353R880-F1-model_v4 | Pyridoxine 5'-phosphate synthase (EC 2.6.99.2) | 0.9982 | 1 | 236 |
GO:0005829
GO:0008615 GO:0033856 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar