F365350

General Info

Members Datasets Scaffolds Average Seq Length
255 176 249 160

Family's Representative Sequence

Representative Sequence 3300002737|JGI25162J39368_1000128|JGI25162J39368_100012852
Length 158
Sequence MTSTSLPPRVGVVMGSRSDWETMEHASSVLAELGVAHEVRVVSAHRTPDLLFQYADEAVGRGIQVIIAGAGGAAHLPGMLAAKTRLPVFGVPVQSKALNGMDSLLSIAQMPAGIPVGTLAIGRAGAVNALHDPALATALDAYRHRQTQSVLDNPDPRS

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2739367700 Dyella sp. YR388 Isolate Unclassified
3 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
4 2884411467 Dyella sp. AD56 Isolate Rhizosphere
5 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
6 2919404418 Luteibacter sp. 3190 Isolate Unclassified
7 2928963466 Dyella japonica 1073 Isolate Unclassified
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
12 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
15 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
16 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
62 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
63 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
64 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
71 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
73 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
74 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
77 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
78 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
100 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
101 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
102 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
103 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
104 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
105 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
106 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
107 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
108 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
112 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
113 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
114 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
115 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
116 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
119 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
127 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
128 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
129 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
130 3300044536 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E Metagenome Unclassified
131 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
132 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
133 3300044663 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR Metagenome Unclassified
134 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
135 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
136 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
137 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
138 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
142 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
143 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
144 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
145 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
146 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
151 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
161 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
162 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
163 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
164 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
165 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
166 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
167 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
168 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
169 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
172 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
173 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
174 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
176 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.86
Metatranscriptomes 0.78
Isolates 2.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.47
Nodule 0
Rhizoplane 5.1
Rhizosphere 61.57
Stem 0
Stem Tuber 0
Unclassified 16.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_11221954 2162886012 Bacteria 932
2 JGI25162J39368_1000128 3300002737 Bacteria 83781
3 JGI25154J39366_1007915 3300002738 Bacteria 1412
4 JGI25157J39369_1000409 3300002741 Bacteria 29304
5 JGI25157J39369_1001402 3300002741 Bacteria 9265
6 JGI25163J39215_1000633 3300002771 Bacteria 9562
7 JGI25164J39214_1000067 3300002772 Bacteria 103259
8 JGI25165J46597_1000167 3300003214 Bacteria 103259
9 Ga0006562J51391_1024406 3300003578 Bacteria 4700
10 Ga0055538_1002149 3300003751 Bacteria 3089
11 Ga0055539_1018841 3300003752 Bacteria 828
12 Ga0055533_1007807 3300003756 Bacteria 1416
13 Ga0055533_1010417 3300003756 Bacteria 1054
14 Ga0055535_1000074 3300003761 Bacteria 111974
15 Ga0055535_1001067 3300003761 Bacteria 16872
16 Ga0055535_1001155 3300003761 Bacteria 15565
17 Ga0055542_1000561 3300003762 Bacteria 32846
18 Ga0055542_1001052 3300003762 Bacteria 17144
19 Ga0055542_1001067 3300003762 Bacteria 16872
20 Ga0055529_1000024 3300003763 Bacteria 305218
21 Ga0055529_1000121 3300003763 Bacteria 114639
22 Ga0055529_1000745 3300003763 Bacteria 21027
23 Ga0055529_1000880 3300003763 Bacteria 17144
24 Ga0070658_10304503 3300005327 Bacteria 1359
25 Ga0070683_100455154 3300005329 Bacteria 1221
26 Ga0070680_100193345 3300005336 Bacteria 1715
27 Ga0070661_100272860 3300005344 Bacteria 1310
28 Ga0070661_100476432 3300005344 Bacteria 996
29 Ga0070671_100000073 3300005355 Bacteria 64821
30 Ga0070659_100036324 3300005366 Bacteria 3841
31 Ga0070700_100321397 3300005441 Bacteria 1137
32 Ga0070694_100194613 3300005444 Bacteria 1508
33 Ga0070678_100309008 3300005456 Bacteria 1346
34 Ga0070662_100351837 3300005457 Bacteria 1207
35 Ga0070685_10000035 3300005466 Bacteria 81433
36 Ga0070707_100804731 3300005468 Bacteria 904
37 Ga0070698_101598884 3300005471 Bacteria 604
38 Ga0070679_100018555 3300005530 Bacteria 6752
39 Ga0068853_100670131 3300005539 Bacteria 988
40 Ga0070686_100297018 3300005544 Bacteria 1197
41 Ga0070665_100026354 3300005548 Bacteria 5855
42 Ga0070664_100061402 3300005564 Bacteria 3203
43 Ga0070664_100238476 3300005564 Bacteria 1632
44 Ga0068856_100041405 3300005614 Bacteria 4527
45 Ga0068856_100092335 3300005614 Bacteria 3012
46 Ga0068856_100364650 3300005614 Bacteria 1463
47 Ga0068859_100081455 3300005617 Bacteria 3279
48 Ga0068859_100281351 3300005617 Bacteria 1756
49 Ga0068861_100191141 3300005719 Bacteria 1711
50 Ga0068861_100735538 3300005719 Bacteria 920
51 Ga0068858_100055978 3300005842 Bacteria 3645
52 Ga0068860_100007474 3300005843 Bacteria 10930
53 Ga0068860_100673390 3300005843 Bacteria 1043
54 Ga0068862_100031739 3300005844 Bacteria 4462
55 Ga0070717_10007063 3300006028 Bacteria 8317
56 Ga0070717_10361733 3300006028 Bacteria 1299
57 Ga0097620_100081452 3300006931 Bacteria 3279
58 Ga0097620_100281342 3300006931 Bacteria 1756
59 Ga0105251_10097794 3300009011 Bacteria 1343
60 Ga0105245_10015630 3300009098 Bacteria 6619
61 Ga0105245_10375056 3300009098 Bacteria 1415
62 Ga0105247_10075234 3300009101 Bacteria 2119
63 Ga0105241_10006510 3300009174 Bacteria 8611
64 Ga0105248_11516802 3300009177 Bacteria 759
65 Ga0105238_10545412 3300009551 Bacteria 1163
66 Ga0157370_10465904 3300013104 Bacteria 1161
67 Ga0157369_10035939 3300013105 Bacteria 5430
68 Ga0157369_10074553 3300013105 Bacteria 3639
69 Ga0157378_10025051 3300013297 Bacteria 5256
70 Ga0163162_10197392 3300013306 Bacteria 2141
71 Ga0157372_10179225 3300013307 Bacteria 2453
72 Ga0157372_10869550 3300013307 Bacteria 1046
73 Ga0157379_11155320 3300014968 Bacteria 743
74 Ga0157376_10106788 3300014969 Bacteria 2457
75 Ga0157376_10182111 3300014969 Bacteria 1921
76 Ga0206350_11313396 3300020080 Bacteria 1150
77 Ga0213872_10000579 3300021361 Bacteria 28340
78 Ga0213876_10237211 3300021384 Bacteria 969
79 Ga0213875_10000005 3300021388 Bacteria 595146
80 Ga0213875_10208905 3300021388 Bacteria 919
81 Ga0209760_100292 3300025207 Bacteria 17535
82 Ga0209784_100011 3300025224 Bacteria 546770
83 Ga0209566_105620 3300025225 Bacteria 1554
84 Ga0209674_100107 3300025226 Bacteria 151298
85 Ga0209672_100005 3300025228 Bacteria 1069303
86 Ga0209672_100540 3300025228 Bacteria 20465
87 Ga0209672_102723 3300025228 Bacteria 4095
88 Ga0207427_100026 3300025231 Bacteria 412764
89 Ga0209437_100217 3300025233 Bacteria 105424
90 Ga0209258_100006 3300025242 Bacteria 1069303
91 Ga0209258_100012 3300025242 Bacteria 825544
92 Ga0209258_100027 3300025242 Bacteria 518449
93 Ga0209646_1000665 3300025246 Bacteria 12683
94 Ga0209026_1000018 3300025250 Bacteria 381351
95 Ga0209677_101664 3300025253 Bacteria 9342
96 Ga0209677_108165 3300025253 Bacteria 2074
97 Ga0209148_1000001 3300025254 Bacteria 2545271
98 Ga0209148_1000012 3300025254 Bacteria 1069303
99 Ga0209148_1000014 3300025254 Bacteria 925277
100 Ga0209759_1000066 3300025256 Bacteria 184163
101 Ga0209233_1000002 3300025261 Bacteria 2501366
102 Ga0209455_1000008 3300025272 Bacteria 1069303
103 Ga0209455_1000014 3300025272 Bacteria 806601
104 Ga0209455_1000019 3300025272 Bacteria 705658
105 Ga0207654_10173984 3300025911 Bacteria 1400
106 Ga0207707_10004486 3300025912 Bacteria 12283
107 Ga0207660_10327399 3300025917 Bacteria 1224
108 Ga0207649_10196244 3300025920 Bacteria 1423
109 Ga0207649_10375190 3300025920 Bacteria 1059
110 Ga0207652_10054173 3300025921 Bacteria 3448
111 Ga0207646_10320717 3300025922 Unclassified 1400
112 Ga0207687_10008841 3300025927 Bacteria 6584
113 Ga0207644_10000104 3300025931 Bacteria 61701
114 Ga0207706_10097951 3300025933 Bacteria 2580
115 Ga0207711_10000773 3300025941 Bacteria 31492
116 Ga0207661_10403252 3300025944 Bacteria 1240
117 Ga0207679_10278568 3300025945 Unclassified 1433
118 Ga0207667_10722924 3300025949 Unclassified 997
119 Ga0207667_11320776 3300025949 Bacteria 697
120 Ga0207703_10116738 3300026035 Bacteria 2285
121 Ga0207702_10013284 3300026078 Bacteria 6848
122 Ga0207702_10081536 3300026078 Bacteria 2810
123 Ga0207702_10203541 3300026078 Bacteria 1836
124 Ga0207675_100199627 3300026118 Bacteria 1921
125 Ga0207675_100533077 3300026118 Bacteria 1172
126 Ga0207683_10354334 3300026121 Bacteria 1347
127 Ga0207683_11586647 3300026121 Bacteria 604
128 Ga0268266_10020535 3300028379 Bacteria 5629
129 Ga0268265_10000665 3300028380 Bacteria 34098
130 Ga0268264_10000472 3300028381 Bacteria 54726
131 Ga0265324_10116979 3300029957 Bacteria 905
132 Ga0265339_10201184 3300031249 Bacteria 982
133 Ga0265331_10007918 3300031250 Bacteria 6088
134 Ga0265327_10000797 3300031251 Bacteria 48346
135 Ga0307508_10741323 3300031616 Bacteria 595
136 Ga0316575_10041956 3300031665 Bacteria 1811
137 Ga0316575_10078870 3300031665 Bacteria 1327
138 Ga0316579_10003560 3300031691 Bacteria 6100
139 Ga0316576_10012429 3300031727 Bacteria 5622
140 Ga0316576_10072356 3300031727 Bacteria 2545
141 Ga0316576_10089972 3300031727 Bacteria 2286
142 Ga0316578_10049718 3300031728 Bacteria 2451
143 Ga0316578_10099862 3300031728 Bacteria 1739
144 Ga0316577_10144392 3300031733 Bacteria 1340
145 Ga0307416_102035133 3300032002 Bacteria 677
146 Ga0307415_100207905 3300032126 Bacteria 1559
147 Ga0316583_10013182 3300032133 Bacteria 2983
148 Ga0316585_10162317 3300032137 Bacteria 738
149 Ga0316580_10012970 3300032139 Bacteria 2538
150 Ga0316580_10017721 3300032139 Bacteria 2191
151 Ga0316580_10025411 3300032139 Bacteria 1832
152 Ga0373942_0293823 3300035207 Bacteria 562
153 Ga0316574_0075366 3300035398 Bacteria 2136
154 Ga0316574_0167166 3300035398 Bacteria 1416
155 Ga0373935_0013646 3300035692 Bacteria 4905
156 Ga0373937_0022973 3300036401 Bacteria 5609
157 Ga0316582_0081054 3300036647 Bacteria 2119
158 Ga0316582_0104581 3300036647 Bacteria 1879
159 Ga0316584_0073439 3300036712 Bacteria 2563
160 Ga0395899_0000172 3300037312 Bacteria 98252
161 Ga0395900_0000029 3300037418 Bacteria 281061
162 Ga0395898_0000373 3300037466 Bacteria 98265
163 Ga0436364_0016448 3300037853 Bacteria 2799
164 Ga0436364_0058447 3300037853 Bacteria 1086
165 Ga0436364_0157811 3300037853 Bacteria 430293
166 Ga0436364_0196249 3300037853 Bacteria 4326
167 Ga0436364_0553433 3300037853 Bacteria 1078
168 Ga0436364_0596266 3300037853 Unclassified 2667
169 Ga0436364_1289277 3300037853 Bacteria 847
170 Ga0395901_0114883 3300038443 Bacteria 2827
171 Ga0395901_0399329 3300038443 Bacteria 1412
172 Ga0436365_0543679 3300039437 Bacteria 12016
173 Ga0436361_0754359 3300039447 Bacteria 78520
174 Ga0436363_0414532 3300039450 Bacteria 2366
175 Ga0436362_1151371 3300039453 Bacteria 942
176 Ga0451577_0059166 3300042876 Bacteria 3417
177 Ga0451577_0593346 3300042876 Bacteria 1005
178 Ga0466988_0026092 3300044536 Bacteria 3270
179 Ga0466969_0001320 3300044656 Bacteria 13383
180 Ga0466969_0027051 3300044656 Bacteria 2938
181 Ga0466975_0053140 3300044661 Bacteria 2887
182 Ga0466989_0008976 3300044663 Bacteria 5201
183 Ga0466966_0002722 3300044684 Bacteria 11602
184 Ga0466966_0010334 3300044684 Bacteria 6196
185 Ga0466966_0024155 3300044684 Bacteria 3978
186 Ga0466961_0011064 3300044693 Bacteria 5766
187 Ga0466961_0026380 3300044693 Bacteria 3735
188 Ga0453684_0758677 3300044712 Bacteria 1050
189 Ga0466971_0011799 3300044719 Bacteria 3828
190 Ga0466971_0045097 3300044719 Bacteria 1980
191 Ga0466970_0008350 3300044765 Bacteria 5208
192 Ga0466970_0122932 3300044765 Bacteria 1422
193 Ga0466970_0187758 3300044765 Bacteria 1148
194 Ga0466970_0697992 3300044765 Bacteria 592
195 Ga0466959_0001161 3300045049 Bacteria 15849
196 Ga0466959_0022949 3300045049 Bacteria 4613
197 Ga0466959_0274507 3300045049 Bacteria 1158
198 Ga0451576_0598000 3300045051 Bacteria 1159
199 Ga0466958_0019472 3300045836 Bacteria 3951
200 Ga0466958_0270526 3300045836 Bacteria 1088
201 Ga0495638_0002253 3300046460 Bacteria 15984
202 Ga0495650_0000561 3300046471 Bacteria 52692
203 Ga0495594_0182632 3300046499 Bacteria 1194
204 Ga0495606_0000016 3300046507 Bacteria 284865
205 Ga0495586_0024126 3300046535 Bacteria 3249
206 Ga0495625_0028233 3300046660 Bacteria 4211
207 Ga0495657_0284405 3300046675 Bacteria 989
208 Ga0495658_0170574 3300046683 Bacteria 1346
209 Ga0495649_0000790 3300046694 Bacteria 25492
210 Ga0495660_0295248 3300046810 Bacteria 736
211 Ga0496102_0370294 3300048905 Bacteria 1348
212 Ga0496104_0879163 3300048907 Bacteria 801
213 Ga0496105_0246709 3300048908 Bacteria 1448
214 Ga0496106_0971121 3300048909 Bacteria 669
215 Ga0496107_0083132 3300048910 Bacteria 2335
216 Ga0496112_0025052 3300048915 Bacteria 5724
217 Ga0496114_0068696 3300048917 Bacteria 2975
218 Ga0496114_1417603 3300048917 Bacteria 582
219 Ga0496115_0004716 3300048918 Bacteria 9885
220 Ga0496115_0035488 3300048918 Bacteria 3945
221 Ga0496115_0046454 3300048918 Bacteria 3470
222 Ga0496115_0079523 3300048918 Bacteria 2668
223 Ga0496115_0148412 3300048918 Bacteria 1935
224 Ga0496117_0021172 3300048920 Bacteria 5272
225 Ga0496117_0126731 3300048920 Bacteria 1556
226 Ga0496118_0019186 3300048921 Bacteria 6122
227 Ga0496118_0104636 3300048921 Bacteria 1899
228 Ga0496118_0295056 3300048921 Bacteria 893
229 Ga0496119_0076769 3300048922 Bacteria 1937
230 Ga0496120_0007155 3300048923 Bacteria 8366
231 Ga0496121_0000856 3300048924 Bacteria 55071
232 Ga0496121_0097048 3300048924 Bacteria 2285
233 Ga0496121_0177043 3300048924 Bacteria 1543
234 Ga0496124_0006802 3300048927 Bacteria 12347
235 Ga0496126_0006445 3300048929 Bacteria 13075
236 Ga0496126_0040333 3300048929 Bacteria 4328
237 Ga0496126_0159890 3300048929 Bacteria 1925
238 Ga0496126_0763341 3300048929 Bacteria 745
239 Ga0495678_020780 3300049459 Bacteria 2900
240 Ga0495682_0011488 3300049460 Bacteria 3407
241 Ga0501043_0481400 3300049579 Bacteria 929
242 Ga0501047_0215307 3300049581 Bacteria 1778
243 Ga0501073_0059334 3300049589 Bacteria 2673
244 nmdc:mga0sz30_84829_c1 3300050516 Bacteria 1374
245 Ga0500635_0079458 3300053080 Bacteria 1176
246 Ga0500564_007906 3300053138 Bacteria 4536
247 Ga0501084_0001367 3300054114 Bacteria 19294
248 Ga0466962_0058765 3300061719 Bacteria 1835
249 Ga0466962_0700767 3300061719 Bacteria 519

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300002737 JGI25162J39368_1000128 JGI25162J39368_100012852 145
2 3300002738 JGI25154J39366_1007915 JGI25154J39366_10079152 145
3 3300002741 JGI25157J39369_1000409 JGI25157J39369_10004099 145
4 3300002741 JGI25157J39369_1001402 JGI25157J39369_10014023 145
5 3300002771 JGI25163J39215_1000633 JGI25163J39215_10006332 145
6 3300002772 JGI25164J39214_1000067 JGI25164J39214_100006770 145
7 3300003214 JGI25165J46597_1000167 JGI25165J46597_100016770 145
8 3300003751 Ga0055538_1002149 Ga0055538_10021492 145
9 3300003761 Ga0055535_1000074 Ga0055535_100007453 145
10 3300003761 Ga0055535_1001067 Ga0055535_100106710 145
11 3300003761 Ga0055535_1001155 Ga0055535_100115514 145
12 3300003762 Ga0055542_1000561 Ga0055542_100056124 145
13 3300003762 Ga0055542_1001052 Ga0055542_10010528 145
14 3300003762 Ga0055542_1001067 Ga0055542_10010678 145
15 3300003763 Ga0055529_1000024 Ga0055529_100002423 145
16 3300003763 Ga0055529_1000121 Ga0055529_100012154 145
17 3300003763 Ga0055529_1000880 Ga0055529_10008808 145
18 3300025207 Ga0209760_100292 Ga0209760_1002929 145
19 3300025224 Ga0209784_100011 Ga0209784_100011173 145
20 3300025228 Ga0209672_102723 Ga0209672_1027232 145
21 3300025231 Ga0207427_100026 Ga0207427_10002661 145
22 3300025233 Ga0209437_100217 Ga0209437_10021721 145
23 3300025242 Ga0209258_100027 Ga0209258_100027374 145
24 3300025246 Ga0209646_1000665 Ga0209646_10006656 145
25 3300025250 Ga0209026_1000018 Ga0209026_1000018268 145
26 3300025254 Ga0209148_1000001 Ga0209148_10000011112 145
27 3300025256 Ga0209759_1000066 Ga0209759_100006630 145
28 3300025261 Ga0209233_1000002 Ga0209233_10000021118 145
29 3300025272 Ga0209455_1000019 Ga0209455_1000019441 145
30 3300009098 Ga0105245_10375056 Ga0105245_103750562 146
31 3300005327 Ga0070658_10304503 Ga0070658_103045032 152
32 3300005329 Ga0070683_100455154 Ga0070683_1004551542 152
33 3300005344 Ga0070661_100272860 Ga0070661_1002728601 152
34 3300005366 Ga0070659_100036324 Ga0070659_1000363242 152
35 3300005456 Ga0070678_100309008 Ga0070678_1003090082 152
36 3300005539 Ga0068853_100670131 Ga0068853_1006701312 152
37 3300005564 Ga0070664_100238476 Ga0070664_1002384762 152
38 3300005614 Ga0068856_100041405 Ga0068856_1000414055 152
39 3300005614 Ga0068856_100092335 Ga0068856_1000923352 152
40 3300005614 Ga0068856_100364650 Ga0068856_1003646502 152
41 3300006028 Ga0070717_10007063 Ga0070717_100070633 152
42 3300006028 Ga0070717_10361733 Ga0070717_103617332 152
43 3300013104 Ga0157370_10465904 Ga0157370_104659042 152
44 3300013105 Ga0157369_10035939 Ga0157369_100359394 152
45 3300013105 Ga0157369_10074553 Ga0157369_100745534 152
46 3300013307 Ga0157372_10869550 Ga0157372_108695502 152
47 3300021361 Ga0213872_10000579 Ga0213872_1000057927 152
48 3300021384 Ga0213876_10237211 Ga0213876_102372112 152
49 3300021388 Ga0213875_10000005 Ga0213875_10000005380 152
50 3300021388 Ga0213875_10208905 Ga0213875_102089052 152
51 3300025920 Ga0207649_10196244 Ga0207649_101962442 152
52 3300025920 Ga0207649_10375190 Ga0207649_103751902 152
53 3300025944 Ga0207661_10403252 Ga0207661_104032522 152
54 3300025949 Ga0207667_10722924 Ga0207667_107229242 152
55 3300025949 Ga0207667_11320776 Ga0207667_113207762 152
56 3300026078 Ga0207702_10013284 Ga0207702_100132842 152
57 3300026078 Ga0207702_10081536 Ga0207702_100815362 152
58 3300026078 Ga0207702_10203541 Ga0207702_102035412 152
59 3300026121 Ga0207683_10354334 Ga0207683_103543342 152
60 3300026121 Ga0207683_11586647 Ga0207683_115866471 152
61 3300035692 Ga0373935_0013646 Ga0373935_0013646_2221_2727 152
62 3300037853 Ga0436364_0016448 Ga0436364_0016448_891_1397 152
63 3300037853 Ga0436364_0058447 Ga0436364_0058447_303_794 152
64 3300037853 Ga0436364_0157811 Ga0436364_0157811_146725_147231 152
65 3300037853 Ga0436364_0196249 Ga0436364_0196249_316_807 152
66 3300037853 Ga0436364_0553433 Ga0436364_0553433_197_715 152
67 3300037853 Ga0436364_0596266 Ga0436364_0596266_1608_2066 152
68 3300037853 Ga0436364_1289277 Ga0436364_1289277_80_571 152
69 3300039437 Ga0436365_0543679 Ga0436365_0543679_1444_1959 152
70 3300039447 Ga0436361_0754359 Ga0436361_0754359_43655_44158 152
71 3300039450 Ga0436363_0414532 Ga0436363_0414532_551_1066 152
72 3300039453 Ga0436362_1151371 Ga0436362_1151371_261_761 152
73 3300044684 Ga0466966_0024155 Ga0466966_0024155_3125_3583 152
74 3300044765 Ga0466970_0187758 Ga0466970_0187758_222_680 152
75 3300044765 Ga0466970_0697992 Ga0466970_0697992_22_480 152
76 3300045049 Ga0466959_0274507 Ga0466959_0274507_31_489 152
77 3300048905 Ga0496102_0370294 Ga0496102_0370294_478_969 152
78 3300048915 Ga0496112_0025052 Ga0496112_0025052_2827_3318 152
79 3300048918 Ga0496115_0035488 Ga0496115_0035488_1421_1912 152
80 3300003578 Ga0006562J51391_1024406 Ga0006562J51391_10244063 154
81 3300003752 Ga0055539_1018841 Ga0055539_10188412 154
82 3300003756 Ga0055533_1007807 Ga0055533_10078072 154
83 3300003756 Ga0055533_1010417 Ga0055533_10104172 154
84 3300003763 Ga0055529_1000745 Ga0055529_10007459 154
85 3300005544 Ga0070686_100297018 Ga0070686_1002970182 154
86 3300009098 Ga0105245_10015630 Ga0105245_100156304 154
87 3300009174 Ga0105241_10006510 Ga0105241_100065109 154
88 3300013306 Ga0163162_10197392 Ga0163162_101973922 154
89 3300014969 Ga0157376_10106788 Ga0157376_101067882 154
90 3300014969 Ga0157376_10182111 Ga0157376_101821112 154
91 3300025225 Ga0209566_105620 Ga0209566_1056202 154
92 3300025226 Ga0209674_100107 Ga0209674_10010767 154
93 3300025228 Ga0209672_100005 Ga0209672_100005320 154
94 3300025228 Ga0209672_100540 Ga0209672_1005408 154
95 3300025242 Ga0209258_100006 Ga0209258_100006320 154
96 3300025242 Ga0209258_100012 Ga0209258_100012135 154
97 3300025253 Ga0209677_101664 Ga0209677_1016643 154
98 3300025253 Ga0209677_108165 Ga0209677_1081651 154
99 3300025254 Ga0209148_1000012 Ga0209148_1000012320 154
100 3300025254 Ga0209148_1000014 Ga0209148_1000014520 154
101 3300025272 Ga0209455_1000008 Ga0209455_1000008320 154
102 3300025272 Ga0209455_1000014 Ga0209455_1000014408 154
103 3300025911 Ga0207654_10173984 Ga0207654_101739842 154
104 3300025927 Ga0207687_10008841 Ga0207687_100088413 154
105 3300031665 Ga0316575_10041956 Ga0316575_100419562 154
106 3300031727 Ga0316576_10089972 Ga0316576_100899722 154
107 3300037312 Ga0395899_0000172 Ga0395899_0000172_4470_4934 154
108 3300037418 Ga0395900_0000029 Ga0395900_0000029_22236_22700 154
109 3300037466 Ga0395898_0000373 Ga0395898_0000373_4487_4951 154
110 3300038443 Ga0395901_0114883 Ga0395901_0114883_1468_1932 154
111 3300038443 Ga0395901_0399329 Ga0395901_0399329_53_517 154
112 3300042876 Ga0451577_0059166 Ga0451577_0059166_935_1435 154
113 3300044536 Ga0466988_0026092 Ga0466988_0026092_1680_2144 154
114 3300044656 Ga0466969_0001320 Ga0466969_0001320_3496_3960 154
115 3300044656 Ga0466969_0027051 Ga0466969_0027051_149_613 154
116 3300044661 Ga0466975_0053140 Ga0466975_0053140_176_640 154
117 3300044663 Ga0466989_0008976 Ga0466989_0008976_901_1365 154
118 3300044684 Ga0466966_0002722 Ga0466966_0002722_2878_3342 154
119 3300044684 Ga0466966_0010334 Ga0466966_0010334_2431_2895 154
120 3300044693 Ga0466961_0011064 Ga0466961_0011064_1524_1988 154
121 3300044693 Ga0466961_0026380 Ga0466961_0026380_3123_3587 154
122 3300044712 Ga0453684_0758677 Ga0453684_0758677_371_871 154
123 3300044719 Ga0466971_0011799 Ga0466971_0011799_527_991 154
124 3300044719 Ga0466971_0045097 Ga0466971_0045097_816_1280 154
125 3300044765 Ga0466970_0008350 Ga0466970_0008350_1863_2327 154
126 3300044765 Ga0466970_0122932 Ga0466970_0122932_121_585 154
127 3300045049 Ga0466959_0001161 Ga0466959_0001161_6254_6718 154
128 3300045049 Ga0466959_0022949 Ga0466959_0022949_3496_3960 154
129 3300045051 Ga0451576_0598000 Ga0451576_0598000_594_1094 154
130 3300045836 Ga0466958_0019472 Ga0466958_0019472_2977_3441 154
131 3300045836 Ga0466958_0270526 Ga0466958_0270526_289_753 154
132 3300046460 Ga0495638_0002253 Ga0495638_0002253_8272_8736 154
133 3300046471 Ga0495650_0000561 Ga0495650_0000561_51006_51470 154
134 3300046507 Ga0495606_0000016 Ga0495606_0000016_276440_276904 154
135 3300046660 Ga0495625_0028233 Ga0495625_0028233_1218_1682 154
136 3300046694 Ga0495649_0000790 Ga0495649_0000790_21489_21953 154
137 3300046810 Ga0495660_0295248 Ga0495660_0295248_69_533 154
138 3300048907 Ga0496104_0879163 Ga0496104_0879163_92_556 154
139 3300048908 Ga0496105_0246709 Ga0496105_0246709_21_485 154
140 3300048909 Ga0496106_0971121 Ga0496106_0971121_100_564 154
141 3300048910 Ga0496107_0083132 Ga0496107_0083132_1190_1654 154
142 3300048917 Ga0496114_0068696 Ga0496114_0068696_1336_1800 154
143 3300048918 Ga0496115_0004716 Ga0496115_0004716_7037_7501 154
144 3300048918 Ga0496115_0046454 Ga0496115_0046454_1247_1711 154
145 3300048918 Ga0496115_0079523 Ga0496115_0079523_1630_2094 154
146 3300048918 Ga0496115_0148412 Ga0496115_0148412_104_568 154
147 3300048920 Ga0496117_0021172 Ga0496117_0021172_640_1104 154
148 3300048920 Ga0496117_0126731 Ga0496117_0126731_107_571 154
149 3300048921 Ga0496118_0019186 Ga0496118_0019186_5376_5840 154
150 3300048921 Ga0496118_0104636 Ga0496118_0104636_1301_1765 154
151 3300048921 Ga0496118_0295056 Ga0496118_0295056_147_611 154
152 3300048922 Ga0496119_0076769 Ga0496119_0076769_195_659 154
153 3300048923 Ga0496120_0007155 Ga0496120_0007155_7676_8140 154
154 3300048924 Ga0496121_0000856 Ga0496121_0000856_52725_53189 154
155 3300048924 Ga0496121_0097048 Ga0496121_0097048_792_1256 154
156 3300048924 Ga0496121_0177043 Ga0496121_0177043_822_1286 154
157 3300048929 Ga0496126_0006445 Ga0496126_0006445_11301_11765 154
158 3300048929 Ga0496126_0040333 Ga0496126_0040333_1999_2463 154
159 3300048929 Ga0496126_0159890 Ga0496126_0159890_1236_1700 154
160 3300049459 Ga0495678_020780 Ga0495678_020780_1480_1944 154
161 3300049460 Ga0495682_0011488 Ga0495682_0011488_1876_2340 154
162 3300050516 nmdc:mga0sz30_84829_c1 nmdc:mga0sz30_84829_c1_786_1301 154
163 3300053080 Ga0500635_0079458 Ga0500635_0079458_433_936 154
164 3300061719 Ga0466962_0058765 Ga0466962_0058765_1230_1694 154
165 3300061719 Ga0466962_0700767 Ga0466962_0700767_21_485 154
166 iso_pu_bacteria 2739367700 2739730073 154
167 iso_pu_bacteria 2818991440 2819563378 154
168 iso_pu_bacteria 2884411467 2884414266 154
169 iso_pu_bacteria 2904463128 2904464313 154
170 iso_pu_bacteria 2919404418 2919404632 154
171 iso_pu_bacteria 2928963466 2928965729 154
172 3300005336 Ga0070680_100193345 Ga0070680_1001933453 155
173 3300005530 Ga0070679_100018555 Ga0070679_1000185558 155
174 3300005617 Ga0068859_100281351 Ga0068859_1002813513 155
175 3300005719 Ga0068861_100191141 Ga0068861_1001911412 155
176 3300005843 Ga0068860_100673390 Ga0068860_1006733902 155
177 3300006931 Ga0097620_100281342 Ga0097620_1002813423 155
178 3300013307 Ga0157372_10179225 Ga0157372_101792252 155
179 3300020080 Ga0206350_11313396 Ga0206350_113133962 155
180 3300025912 Ga0207707_10004486 Ga0207707_100044865 155
181 3300025917 Ga0207660_10327399 Ga0207660_103273992 155
182 3300025921 Ga0207652_10054173 Ga0207652_100541732 155
183 3300026118 Ga0207675_100199627 Ga0207675_1001996271 155
184 3300031665 Ga0316575_10078870 Ga0316575_100788702 155
185 3300031691 Ga0316579_10003560 Ga0316579_100035603 155
186 3300031727 Ga0316576_10012429 Ga0316576_100124295 155
187 3300031728 Ga0316578_10099862 Ga0316578_100998622 155
188 3300031733 Ga0316577_10144392 Ga0316577_101443922 155
189 3300032126 Ga0307415_100207905 Ga0307415_1002079053 155
190 3300032133 Ga0316583_10013182 Ga0316583_100131823 155
191 3300032139 Ga0316580_10012970 Ga0316580_100129701 155
192 3300032139 Ga0316580_10025411 Ga0316580_100254112 155
193 3300035398 Ga0316574_0167166 Ga0316574_0167166_576_1082 155
194 3300036647 Ga0316582_0081054 Ga0316582_0081054_188_694 155
195 3300036647 Ga0316582_0104581 Ga0316582_0104581_155_661 155
196 3300036712 Ga0316584_0073439 Ga0316584_0073439_335_841 155
197 3300048917 Ga0496114_1417603 Ga0496114_1417603_68_535 155
198 3300048927 Ga0496124_0006802 Ga0496124_0006802_3887_4435 155
199 3300049589 Ga0501073_0059334 Ga0501073_0059334_1540_2046 155
200 3300054114 Ga0501084_0001367 Ga0501084_0001367_10246_10752 155
201 2162886012 MBSR1b_contig_11221954 MBSR1b_0274.00008640 156
202 3300005344 Ga0070661_100476432 Ga0070661_1004764322 156
203 3300005355 Ga0070671_100000073 Ga0070671_10000007341 156
204 3300005441 Ga0070700_100321397 Ga0070700_1003213971 156
205 3300005444 Ga0070694_100194613 Ga0070694_1001946131 156
206 3300005457 Ga0070662_100351837 Ga0070662_1003518372 156
207 3300005466 Ga0070685_10000035 Ga0070685_100000353 156
208 3300005468 Ga0070707_100804731 Ga0070707_1008047311 156
209 3300005471 Ga0070698_101598884 Ga0070698_1015988841 156
210 3300005548 Ga0070665_100026354 Ga0070665_1000263545 156
211 3300005564 Ga0070664_100061402 Ga0070664_1000614022 156
212 3300005617 Ga0068859_100081455 Ga0068859_1000814553 156
213 3300005719 Ga0068861_100735538 Ga0068861_1007355381 156
214 3300005842 Ga0068858_100055978 Ga0068858_1000559782 156
215 3300005843 Ga0068860_100007474 Ga0068860_1000074749 156
216 3300005844 Ga0068862_100031739 Ga0068862_1000317392 156
217 3300006931 Ga0097620_100081452 Ga0097620_1000814523 156
218 3300009011 Ga0105251_10097794 Ga0105251_100977942 156
219 3300009101 Ga0105247_10075234 Ga0105247_100752342 156
220 3300009177 Ga0105248_11516802 Ga0105248_115168022 156
221 3300009551 Ga0105238_10545412 Ga0105238_105454122 156
222 3300013297 Ga0157378_10025051 Ga0157378_100250515 156
223 3300014968 Ga0157379_11155320 Ga0157379_111553202 156
224 3300025922 Ga0207646_10320717 Ga0207646_103207171 156
225 3300025931 Ga0207644_10000104 Ga0207644_1000010441 156
226 3300025933 Ga0207706_10097951 Ga0207706_100979514 156
227 3300025941 Ga0207711_10000773 Ga0207711_1000077313 156
228 3300025945 Ga0207679_10278568 Ga0207679_102785682 156
229 3300026035 Ga0207703_10116738 Ga0207703_101167383 156
230 3300026118 Ga0207675_100533077 Ga0207675_1005330772 156
231 3300028379 Ga0268266_10020535 Ga0268266_100205352 156
232 3300028380 Ga0268265_10000665 Ga0268265_100006659 156
233 3300028381 Ga0268264_10000472 Ga0268264_1000047210 156
234 3300029957 Ga0265324_10116979 Ga0265324_101169791 156
235 3300031249 Ga0265339_10201184 Ga0265339_102011841 156
236 3300031250 Ga0265331_10007918 Ga0265331_100079189 156
237 3300031251 Ga0265327_10000797 Ga0265327_1000079735 156
238 3300031616 Ga0307508_10741323 Ga0307508_107413231 156
239 3300031727 Ga0316576_10072356 Ga0316576_100723562 156
240 3300031728 Ga0316578_10049718 Ga0316578_100497182 156
241 3300032002 Ga0307416_102035133 Ga0307416_1020351331 156
242 3300032137 Ga0316585_10162317 Ga0316585_101623171 156
243 3300032139 Ga0316580_10017721 Ga0316580_100177212 156
244 3300035207 Ga0373942_0293823 Ga0373942_0293823_17_487 156
245 3300035398 Ga0316574_0075366 Ga0316574_0075366_375_869 156
246 3300036401 Ga0373937_0022973 Ga0373937_0022973_1568_2083 156
247 3300042876 Ga0451577_0593346 Ga0451577_0593346_474_977 156
248 3300046499 Ga0495594_0182632 Ga0495594_0182632_153_677 156
249 3300046535 Ga0495586_0024126 Ga0495586_0024126_1287_1811 156
250 3300046675 Ga0495657_0284405 Ga0495657_0284405_457_972 156
251 3300046683 Ga0495658_0170574 Ga0495658_0170574_159_683 156
252 3300048929 Ga0496126_0763341 Ga0496126_0763341_45_545 156
253 3300049579 Ga0501043_0481400 Ga0501043_0481400_273_788 156
254 3300049581 Ga0501047_0215307 Ga0501047_0215307_64_579 156
255 3300053138 Ga0500564_007906 Ga0500564_007906_3187_3708 156

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00731

AIRC

AIR carboxylase

9

149

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fw9-assembly1.cif.gz_B structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h59f from the acidophilic bacterium acetobacter aceti, at ph 8 0.972 1 146
4ycc-assembly1.cif.gz_A structure of a single tryptophan mutant of acetobacter aceti pure with y154l mutation 0.969 1 151
4zk2-assembly1.cif.gz_B structure of acetobacter aceti pure-s57d 0.9688 1 151
3oow-assembly1.cif.gz_D octameric structure of the phosphoribosylaminoimidazole carboxylase catalytic subunit from francisella tularensis subsp. tularensis schu s4. 0.9684 1 152
2fwi-assembly1.cif.gz_B structure of pure (n5-carboxyaminoimidazole ribonucleotide mutase) h59d, from the acidophilic bacterium acetobacter aceti, complexed with 5-aminoimidazole ribonucleotide (air) 0.9684 1 151
ID Description Score Start End Superfamily
af_Q2FZJ5_1_139_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9805 17 148 3.40.50.1970
3trhI00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9633 2 149 3.40.50.1970
af_Q9SJ42_1_162_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9619 1 148 3.40.50.1970
af_P21264_391_571_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.961 1 149 3.40.50.1970
5cvtB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9543 1 151 3.40.50.1970
ID Description Score Start End GO Terms
AF-A0A7G4P1D6-F1-model_v4 PurE 0.9913 6 136 GO:0006189
GO:0016853
AF-A0A1G3XQX5-F1-model_v4 5-(Carboxyamino)imidazole ribonucleotide mutase 0.991 17 149 GO:0006189
GO:0016853
AF-A0A1F8IIM4-F1-model_v4 deleted 0.9899 13 127
AF-E5G8C0-F1-model_v4 Phosphoribosylaminoimidazole carboxylase 0.9895 22 133 GO:0006189
AF-A0A447U889-F1-model_v4 N5-carboxyaminoimidazole ribonucleotide mutase (N5-CAIR mutase) (EC 5.4.99.18) (5-(carboxyamino)imidazole ribonucleotide mutase) 0.9894 11 149 GO:0006189
GO:0034023

Feature Viewer

pLDDT pTM Quality
92.76 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map