F365230

General Info

Members Datasets Scaffolds Average Seq Length
254 151 508 156

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0638092|Ga0501070_0638092_101_664
Length 187
Sequence MPDLGKPHRAIGEVALPSVLSGDFPMPEPIQDLDARLNVVLVEPEIAWNTGAIGRTCVALGATLWLVRPLGFRIDDRSVRRAGLDYWEHLRYHVVDDVDEAARRIGPDRLWWFSTRASRLYTEAPFRPGDALVFGPESRGLPRKRVEENPERALRIPMRPEARSLNLANAAAIGLYEAYRRIGMGER

Samples

Sample ID Description Type Environment
1 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
62 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
121 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
124 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
125 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
126 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
127 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
128 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
129 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
132 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
133 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
134 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
138 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
139 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
140 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
141 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
144 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
147 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
148 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
149 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
150 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
151 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.36
Nodule 0
Rhizoplane 0
Rhizosphere 96.85
Stem 0
Stem Tuber 0
Unclassified 13.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501070_0638092 3300049586 Bacteria 846
2 SwRhRL3b_contig_3880061 2162886006 Unclassified 1229
3 JGI24751J29686_10000003 3300002459 Bacteria 157815
4 Ga0065704_10230835 3300005289 Bacteria 1043
5 Ga0065715_10001021 3300005293 Bacteria 7353
6 Ga0065715_10157503 3300005293 Bacteria 1660
7 Ga0065715_10660967 3300005293 Bacteria 651
8 Ga0065707_10000972 3300005295 Bacteria 9477
9 Ga0065707_10024575 3300005295 Bacteria 1369
10 Ga0070690_100007896 3300005330 Bacteria 6103
11 Ga0070670_100000167 3300005331 Bacteria 59452
12 Ga0070670_100283423 3300005331 Bacteria 1447
13 Ga0068869_100007549 3300005334 Bacteria 6960
14 Ga0068869_100081429 3300005334 Bacteria 2417
15 Ga0070666_10021275 3300005335 Bacteria 4202
16 Ga0068868_100011888 3300005338 Bacteria 6348
17 Ga0070689_100065651 3300005340 Bacteria 2826
18 Ga0070689_100292125 3300005340 Bacteria 1355
19 Ga0070689_100334920 3300005340 Bacteria 1267
20 Ga0070687_100116358 3300005343 Unclassified 1522
21 Ga0070661_100290176 3300005344 Bacteria 1271
22 Ga0070668_100031577 3300005347 Bacteria 4030
23 Ga0070669_100273838 3300005353 Bacteria 1351
24 Ga0070671_100099390 3300005355 Bacteria 2441
25 Ga0070671_100099699 3300005355 Bacteria 2437
26 Ga0070671_100444406 3300005355 Unclassified 1112
27 Ga0070673_100101537 3300005364 Bacteria 2370
28 Ga0070688_100139564 3300005365 Bacteria 1644
29 Ga0070703_10000122 3300005406 Bacteria 40208
30 Ga0070710_10500019 3300005437 Unclassified 832
31 Ga0070701_10141942 3300005438 Bacteria 1375
32 Ga0070701_10585845 3300005438 Bacteria 737
33 Ga0070705_100943591 3300005440 Bacteria 697
34 Ga0070700_100007659 3300005441 Bacteria 5844
35 Ga0070700_100300911 3300005441 Bacteria 1171
36 Ga0070700_100320341 3300005441 Bacteria 1139
37 Ga0070700_100437763 3300005441 Unclassified 992
38 Ga0070700_100540133 3300005441 Bacteria 904
39 Ga0070700_101094270 3300005441 Unclassified 660
40 Ga0070694_100016323 3300005444 Bacteria 4674
41 Ga0070694_100035992 3300005444 Bacteria 3276
42 Ga0068867_100622738 3300005459 Bacteria 944
43 Ga0068867_100632180 3300005459 Bacteria 937
44 Ga0070707_100095515 3300005468 Bacteria 2879
45 Ga0070707_100332001 3300005468 Bacteria 1477
46 Ga0070707_100381607 3300005468 Unclassified 1369
47 Ga0070707_100522588 3300005468 Bacteria 1149
48 Ga0070698_100933303 3300005471 Bacteria 814
49 Ga0070699_100030214 3300005518 Bacteria 4677
50 Ga0070699_101343043 3300005518 Bacteria 656
51 Ga0070697_100008329 3300005536 Bacteria 8087
52 Ga0070697_100702005 3300005536 Bacteria 893
53 Ga0070695_100419025 3300005545 Bacteria 1019
54 Ga0070695_100714345 3300005545 Unclassified 796
55 Ga0070693_100131621 3300005547 Bacteria 1564
56 Ga0070665_100206808 3300005548 Bacteria 1963
57 Ga0070704_100046643 3300005549 Bacteria 3024
58 Ga0070704_100095305 3300005549 Bacteria 2228
59 Ga0070704_100304818 3300005549 Bacteria 1328
60 Ga0070704_100646123 3300005549 Unclassified 934
61 Ga0070664_100444572 3300005564 Bacteria 1189
62 Ga0068857_101180185 3300005577 Bacteria 741
63 Ga0068854_100239361 3300005578 Bacteria 1444
64 Ga0068859_100011469 3300005617 Bacteria 8910
65 Ga0068859_100103835 3300005617 Unclassified 2900
66 Ga0068864_100006700 3300005618 Bacteria 9435
67 Ga0068864_100013782 3300005618 Bacteria 6703
68 Ga0068864_100478537 3300005618 Bacteria 1195
69 Ga0068864_100540153 3300005618 Bacteria 1126
70 Ga0068861_100041818 3300005719 Bacteria 3434
71 Ga0068870_10599532 3300005840 Bacteria 748
72 Ga0068858_100027935 3300005842 Bacteria 5243
73 Ga0068858_100274203 3300005842 Bacteria 1605
74 Ga0068858_100391800 3300005842 Bacteria 1334
75 Ga0068860_100049266 3300005843 Bacteria 4013
76 Ga0068860_100383558 3300005843 Bacteria 1388
77 Ga0068862_100022989 3300005844 Bacteria 5220
78 Ga0068862_100790937 3300005844 Bacteria 926
79 Ga0081455_10189132 3300005937 Bacteria 1552
80 Ga0075363_100496113 3300006048 Bacteria 725
81 Ga0075364_10381919 3300006051 Bacteria 961
82 Ga0070715_10000020 3300006163 Bacteria 119605
83 Ga0070716_100000003 3300006173 Bacteria 312721
84 Ga0070716_100939929 3300006173 Bacteria 680
85 Ga0097621_100672170 3300006237 Unclassified 952
86 Ga0068871_100002156 3300006358 Bacteria 13352
87 Ga0068871_101422048 3300006358 Unclassified 654
88 Ga0075428_100038623 3300006844 Bacteria 5254
89 Ga0075428_101087193 3300006844 Bacteria 845
90 Ga0075431_100197746 3300006847 Bacteria 2058
91 Ga0075433_10018971 3300006852 Bacteria 5724
92 Ga0075433_10357254 3300006852 Bacteria 1291
93 Ga0075434_100272096 3300006871 Bacteria 1713
94 Ga0075434_100664011 3300006871 Bacteria 1061
95 Ga0075429_100015235 3300006880 Bacteria 6664
96 Ga0068865_101100395 3300006881 Bacteria 700
97 Ga0075436_100000002 3300006914 Bacteria 475522
98 Ga0097620_100011469 3300006931 Bacteria 8910
99 Ga0097620_100103836 3300006931 Unclassified 2900
100 Ga0075435_100000785 3300007076 Bacteria 19747
101 Ga0099794_10194739 3300007265 Bacteria 1037
102 Ga0099795_10236319 3300007788 Bacteria 783
103 Ga0105245_10098643 3300009098 Bacteria 2700
104 Ga0105245_10824423 3300009098 Bacteria 967
105 Ga0105247_10082971 3300009101 Bacteria 2023
106 Ga0114129_10040799 3300009147 Bacteria 6543
107 Ga0114129_12166170 3300009147 Bacteria 669
108 Ga0105243_10000371 3300009148 Bacteria 48179
109 Ga0105243_10056179 3300009148 Bacteria 3129
110 Ga0105243_10059451 3300009148 Bacteria 3051
111 Ga0105243_11171807 3300009148 Unclassified 780
112 Ga0105241_10373695 3300009174 Bacteria 1243
113 Ga0105242_10000477 3300009176 Bacteria 31836
114 Ga0105242_10002256 3300009176 Bacteria 15216
115 Ga0105242_11368560 3300009176 Unclassified 734
116 Ga0105242_11721874 3300009176 Bacteria 663
117 Ga0105248_10104104 3300009177 Bacteria 3199
118 Ga0105248_10179536 3300009177 Bacteria 2385
119 Ga0105249_10000018 3300009553 Bacteria 275907
120 Ga0105249_10227860 3300009553 Bacteria 1837
121 Ga0105246_10311321 3300011119 Bacteria 1276
122 Ga0105246_10320208 3300011119 Bacteria 1260
123 Ga0157373_10692577 3300013100 Bacteria 746
124 Ga0157378_10158295 3300013297 Bacteria 2116
125 Ga0157378_10257131 3300013297 Bacteria 1674
126 Ga0157378_10438803 3300013297 Bacteria 1294
127 Ga0157378_10562776 3300013297 Unclassified 1147
128 Ga0157378_11045507 3300013297 Unclassified 852
129 Ga0163162_10000001 3300013306 Bacteria 751833
130 Ga0163162_10124946 3300013306 Bacteria 2678
131 Ga0163162_12413380 3300013306 Unclassified 604
132 Ga0157375_10498707 3300013308 Bacteria 1382
133 Ga0157375_10544204 3300013308 Bacteria 1323
134 Ga0157375_10971739 3300013308 Bacteria 990
135 Ga0157375_12798011 3300013308 Bacteria 583
136 Ga0163163_10000298 3300014325 Bacteria 49128
137 Ga0163163_10104792 3300014325 Bacteria 2854
138 Ga0163163_10661943 3300014325 Bacteria 1108
139 Ga0157380_10045994 3300014326 Bacteria 3426
140 Ga0157380_10222471 3300014326 Bacteria 1690
141 Ga0157380_11320402 3300014326 Unclassified 769
142 Ga0157380_11372179 3300014326 Unclassified 756
143 Ga0157380_11489231 3300014326 Unclassified 730
144 Ga0213876_10000152 3300021384 Bacteria 73209
145 Ga0207653_10000016 3300025885 Bacteria 145405
146 Ga0207642_10052671 3300025899 Unclassified 1848
147 Ga0207710_10342018 3300025900 Unclassified 761
148 Ga0207680_10206583 3300025903 Bacteria 1341
149 Ga0207685_10000008 3300025905 Bacteria 273136
150 Ga0207662_10222395 3300025918 Bacteria 1230
151 Ga0207662_10249754 3300025918 Bacteria 1164
152 Ga0207649_10174342 3300025920 Bacteria 1501
153 Ga0207646_10144071 3300025922 Unclassified 2147
154 Ga0207646_10356796 3300025922 Bacteria 1321
155 Ga0207646_10471061 3300025922 Unclassified 1133
156 Ga0207681_10552343 3300025923 Bacteria 948
157 Ga0207650_10000007 3300025925 Bacteria 530810
158 Ga0207659_10308399 3300025926 Bacteria 1302
159 Ga0207644_10046302 3300025931 Bacteria 3098
160 Ga0207644_10143416 3300025931 Bacteria 1841
161 Ga0207686_10000009 3300025934 Bacteria 241706
162 Ga0207686_10000398 3300025934 Bacteria 30227
163 Ga0207709_10000048 3300025935 Bacteria 238474
164 Ga0207709_10048402 3300025935 Bacteria 2590
165 Ga0207709_10074747 3300025935 Bacteria 2164
166 Ga0207709_11796532 3300025935 Bacteria 510
167 Ga0207670_10118605 3300025936 Bacteria 1919
168 Ga0207670_10226226 3300025936 Bacteria 1434
169 Ga0207669_10757424 3300025937 Unclassified 802
170 Ga0207704_10095630 3300025938 Bacteria 1965
171 Ga0207704_10804290 3300025938 Bacteria 785
172 Ga0207665_10000009 3300025939 Bacteria 162252
173 Ga0207665_10038844 3300025939 Bacteria 3172
174 Ga0207711_10044073 3300025941 Bacteria 3807
175 Ga0207711_10057604 3300025941 Bacteria 3340
176 Ga0207711_10267172 3300025941 Bacteria 1573
177 Ga0207689_10006909 3300025942 Bacteria 9983
178 Ga0207689_10166368 3300025942 Bacteria 1817
179 Ga0207689_10324685 3300025942 Bacteria 1277
180 Ga0207679_11059681 3300025945 Bacteria 744
181 Ga0207651_10172159 3300025960 Bacteria 1709
182 Ga0207651_10213804 3300025960 Bacteria 1554
183 Ga0207712_10000081 3300025961 Bacteria 114043
184 Ga0207712_10653947 3300025961 Unclassified 914
185 Ga0207668_10009225 3300025972 Bacteria 5903
186 Ga0207703_10237664 3300026035 Unclassified 1636
187 Ga0207703_10799866 3300026035 Bacteria 900
188 Ga0207708_10005381 3300026075 Bacteria 9432
189 Ga0207708_10211217 3300026075 Bacteria 1551
190 Ga0207708_10264341 3300026075 Bacteria 1389
191 Ga0207708_10374826 3300026075 Bacteria 1172
192 Ga0207708_10806963 3300026075 Unclassified 808
193 Ga0207641_10682651 3300026088 Bacteria 1010
194 Ga0207648_10016231 3300026089 Bacteria 6814
195 Ga0207648_10219346 3300026089 Bacteria 1690
196 Ga0207648_10328306 3300026089 Bacteria 1376
197 Ga0207648_10629836 3300026089 Bacteria 990
198 Ga0207676_10026398 3300026095 Bacteria 4321
199 Ga0207676_10256189 3300026095 Bacteria 1577
200 Ga0207676_10347814 3300026095 Bacteria 1370
201 Ga0207675_100069526 3300026118 Bacteria 3291
202 Ga0207675_100161772 3300026118 Bacteria 2135
203 Ga0207428_10083582 3300027907 Bacteria 2490
204 Ga0268265_10280277 3300028380 Bacteria 1491
205 Ga0268265_11487676 3300028380 Bacteria 680
206 Ga0268264_10851890 3300028381 Unclassified 913
207 Ga0307408_100839633 3300031548 Bacteria 837
208 Ga0307408_101065141 3300031548 Bacteria 748
209 Ga0307405_10065602 3300031731 Bacteria 2312
210 Ga0307405_10374177 3300031731 Bacteria 1107
211 Ga0307406_10239927 3300031901 Bacteria 1359
212 Ga0307411_10777255 3300032005 Bacteria 841
213 Ga0307415_100068840 3300032126 Bacteria 2479
214 Ga0307415_101086578 3300032126 Bacteria 748
215 Ga0373937_0163700 3300036401 Bacteria 2086
216 Ga0242420_000459 3300038996 Bacteria 4612
217 Ga0436365_0058334 3300039437 Bacteria 73223
218 Ga0439446_0096215 3300042156 Bacteria 932
219 Ga0439434_0048693 3300042435 Bacteria 1312
220 Ga0495651_0311878 3300046462 Bacteria 1052
221 Ga0495662_0013776 3300046476 Bacteria 3936
222 Ga0495610_0030343 3300046512 Bacteria 2835
223 Ga0495618_0129795 3300046514 Bacteria 1613
224 Ga0495586_0506727 3300046535 Bacteria 696
225 Ga0495598_0000022 3300046537 Bacteria 24493
226 Ga0495621_0001179 3300046539 Bacteria 6751
227 Ga0495656_0115061 3300046615 Bacteria 1263
228 Ga0495635_0072812 3300046663 Bacteria 2354
229 Ga0495669_0222830 3300046684 Unclassified 904
230 Ga0495680_0102772 3300047322 Bacteria 2128
231 Ga0495677_0301910 3300047445 Bacteria 630
232 Ga0495684_0468246 3300047471 Bacteria 872
233 Ga0501043_0315423 3300049579 Bacteria 1193
234 Ga0501047_0455259 3300049581 Bacteria 1109
235 Ga0501227_210092 3300049665 Bacteria 553
236 nmdc:mga03683_25817_c1 3300050489 Bacteria 1941
237 nmdc:mga03n38_582105_c1 3300050490 Bacteria 636
238 nmdc:mga00v17_964408_c1 3300050491 Bacteria 538
239 nmdc:mga06z11_160838_c1 3300050494 Bacteria 1283
240 nmdc:mga05p37_297508_c1 3300050507 Bacteria 1919
241 nmdc:mga05p37_29807_c1 3300050507 Bacteria 6658
242 nmdc:mga05p37_64289_c1 3300050507 Unclassified 4515
243 nmdc:mga09592_257218_c1 3300050508 Unclassified 1514
244 nmdc:mga06r32_98285_c1 3300050510 Bacteria 2869
245 nmdc:mga08y16_829283_c1 3300050511 Unclassified 916
246 nmdc:mga0n895_264698_c1 3300050512 Bacteria 1744
247 nmdc:mga0n895_781958_c1 3300050512 Bacteria 946
248 nmdc:mga0rr50_104_c1 3300050513 Bacteria 46623
249 nmdc:mga08x19_9_c1 3300050514 Bacteria 418852
250 nmdc:mga0a205_19038_c1 3300050515 Bacteria 6468
251 nmdc:mga0a205_273309_c1 3300050515 Bacteria 1566
252 nmdc:mga0a205_43590_c1 3300050515 Unclassified 4325
253 Ga0495655_0156935 3300053083 Bacteria 719
254 2889420276 2889415604 Bacteria 8048700
255 Ga0501070_0638092
256 SwRhRL3b_contig_3880061
257 JGI24751J29686_10000003
258 Ga0065704_10230835
259 Ga0065715_10001021
260 Ga0065715_10157503
261 Ga0065715_10660967
262 Ga0065707_10000972
263 Ga0065707_10024575
264 Ga0070690_100007896
265 Ga0070670_100000167
266 Ga0070670_100283423
267 Ga0068869_100007549
268 Ga0068869_100081429
269 Ga0070666_10021275
270 Ga0068868_100011888
271 Ga0070689_100065651
272 Ga0070689_100292125
273 Ga0070689_100334920
274 Ga0070687_100116358
275 Ga0070661_100290176
276 Ga0070668_100031577
277 Ga0070669_100273838
278 Ga0070671_100099390
279 Ga0070671_100099699
280 Ga0070671_100444406
281 Ga0070673_100101537
282 Ga0070688_100139564
283 Ga0070703_10000122
284 Ga0070710_10500019
285 Ga0070701_10141942
286 Ga0070701_10585845
287 Ga0070705_100943591
288 Ga0070700_100007659
289 Ga0070700_100300911
290 Ga0070700_100320341
291 Ga0070700_100437763
292 Ga0070700_100540133
293 Ga0070700_101094270
294 Ga0070694_100016323
295 Ga0070694_100035992
296 Ga0068867_100622738
297 Ga0068867_100632180
298 Ga0070707_100095515
299 Ga0070707_100332001
300 Ga0070707_100381607
301 Ga0070707_100522588
302 Ga0070698_100933303
303 Ga0070699_100030214
304 Ga0070699_101343043
305 Ga0070697_100008329
306 Ga0070697_100702005
307 Ga0070695_100419025
308 Ga0070695_100714345
309 Ga0070693_100131621
310 Ga0070665_100206808
311 Ga0070704_100046643
312 Ga0070704_100095305
313 Ga0070704_100304818
314 Ga0070704_100646123
315 Ga0070664_100444572
316 Ga0068857_101180185
317 Ga0068854_100239361
318 Ga0068859_100011469
319 Ga0068859_100103835
320 Ga0068864_100006700
321 Ga0068864_100013782
322 Ga0068864_100478537
323 Ga0068864_100540153
324 Ga0068861_100041818
325 Ga0068870_10599532
326 Ga0068858_100027935
327 Ga0068858_100274203
328 Ga0068858_100391800
329 Ga0068860_100049266
330 Ga0068860_100383558
331 Ga0068862_100022989
332 Ga0068862_100790937
333 Ga0081455_10189132
334 Ga0075363_100496113
335 Ga0075364_10381919
336 Ga0070715_10000020
337 Ga0070716_100000003
338 Ga0070716_100939929
339 Ga0097621_100672170
340 Ga0068871_100002156
341 Ga0068871_101422048
342 Ga0075428_100038623
343 Ga0075428_101087193
344 Ga0075431_100197746
345 Ga0075433_10018971
346 Ga0075433_10357254
347 Ga0075434_100272096
348 Ga0075434_100664011
349 Ga0075429_100015235
350 Ga0068865_101100395
351 Ga0075436_100000002
352 Ga0097620_100011469
353 Ga0097620_100103836
354 Ga0075435_100000785
355 Ga0099794_10194739
356 Ga0099795_10236319
357 Ga0105245_10098643
358 Ga0105245_10824423
359 Ga0105247_10082971
360 Ga0114129_10040799
361 Ga0114129_12166170
362 Ga0105243_10000371
363 Ga0105243_10056179
364 Ga0105243_10059451
365 Ga0105243_11171807
366 Ga0105241_10373695
367 Ga0105242_10000477
368 Ga0105242_10002256
369 Ga0105242_11368560
370 Ga0105242_11721874
371 Ga0105248_10104104
372 Ga0105248_10179536
373 Ga0105249_10000018
374 Ga0105249_10227860
375 Ga0105246_10311321
376 Ga0105246_10320208
377 Ga0157373_10692577
378 Ga0157378_10158295
379 Ga0157378_10257131
380 Ga0157378_10438803
381 Ga0157378_10562776
382 Ga0157378_11045507
383 Ga0163162_10000001
384 Ga0163162_10124946
385 Ga0163162_12413380
386 Ga0157375_10498707
387 Ga0157375_10544204
388 Ga0157375_10971739
389 Ga0157375_12798011
390 Ga0163163_10000298
391 Ga0163163_10104792
392 Ga0163163_10661943
393 Ga0157380_10045994
394 Ga0157380_10222471
395 Ga0157380_11320402
396 Ga0157380_11372179
397 Ga0157380_11489231
398 Ga0213876_10000152
399 Ga0207653_10000016
400 Ga0207642_10052671
401 Ga0207710_10342018
402 Ga0207680_10206583
403 Ga0207685_10000008
404 Ga0207662_10222395
405 Ga0207662_10249754
406 Ga0207649_10174342
407 Ga0207646_10144071
408 Ga0207646_10356796
409 Ga0207646_10471061
410 Ga0207681_10552343
411 Ga0207650_10000007
412 Ga0207659_10308399
413 Ga0207644_10046302
414 Ga0207644_10143416
415 Ga0207686_10000009
416 Ga0207686_10000398
417 Ga0207709_10000048
418 Ga0207709_10048402
419 Ga0207709_10074747
420 Ga0207709_11796532
421 Ga0207670_10118605
422 Ga0207670_10226226
423 Ga0207669_10757424
424 Ga0207704_10095630
425 Ga0207704_10804290
426 Ga0207665_10000009
427 Ga0207665_10038844
428 Ga0207711_10044073
429 Ga0207711_10057604
430 Ga0207711_10267172
431 Ga0207689_10006909
432 Ga0207689_10166368
433 Ga0207689_10324685
434 Ga0207679_11059681
435 Ga0207651_10172159
436 Ga0207651_10213804
437 Ga0207712_10000081
438 Ga0207712_10653947
439 Ga0207668_10009225
440 Ga0207703_10237664
441 Ga0207703_10799866
442 Ga0207708_10005381
443 Ga0207708_10211217
444 Ga0207708_10264341
445 Ga0207708_10374826
446 Ga0207708_10806963
447 Ga0207641_10682651
448 Ga0207648_10016231
449 Ga0207648_10219346
450 Ga0207648_10328306
451 Ga0207648_10629836
452 Ga0207676_10026398
453 Ga0207676_10256189
454 Ga0207676_10347814
455 Ga0207675_100069526
456 Ga0207675_100161772
457 Ga0207428_10083582
458 Ga0268265_10280277
459 Ga0268265_11487676
460 Ga0268264_10851890
461 Ga0307408_100839633
462 Ga0307408_101065141
463 Ga0307405_10065602
464 Ga0307405_10374177
465 Ga0307406_10239927
466 Ga0307411_10777255
467 Ga0307415_100068840
468 Ga0307415_101086578
469 Ga0373937_0163700
470 Ga0242420_000459
471 Ga0436365_0058334
472 Ga0439446_0096215
473 Ga0439434_0048693
474 Ga0495651_0311878
475 Ga0495662_0013776
476 Ga0495610_0030343
477 Ga0495618_0129795
478 Ga0495586_0506727
479 Ga0495598_0000022
480 Ga0495621_0001179
481 Ga0495656_0115061
482 Ga0495635_0072812
483 Ga0495669_0222830
484 Ga0495680_0102772
485 Ga0495677_0301910
486 Ga0495684_0468246
487 Ga0501043_0315423
488 Ga0501047_0455259
489 Ga0501227_210092
490 nmdc:mga03683_25817_c1
491 nmdc:mga03n38_582105_c1
492 nmdc:mga00v17_964408_c1
493 nmdc:mga06z11_160838_c1
494 nmdc:mga05p37_297508_c1
495 nmdc:mga05p37_29807_c1
496 nmdc:mga05p37_64289_c1
497 nmdc:mga09592_257218_c1
498 nmdc:mga06r32_98285_c1
499 nmdc:mga08y16_829283_c1
500 nmdc:mga0n895_264698_c1
501 nmdc:mga0n895_781958_c1
502 nmdc:mga0rr50_104_c1
503 nmdc:mga08x19_9_c1
504 nmdc:mga0a205_19038_c1
505 nmdc:mga0a205_273309_c1
506 nmdc:mga0a205_43590_c1
507 Ga0495655_0156935
508 2889420276

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00588

SpoU_methylase

SpoU rRNA Methylase family

36

176

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5co4-assembly1.cif.gz_A structural insights into the 2-oh methylation of c/u34 on trna 0.9542 9 156
6qkv-assembly1.cif.gz_B structure of yibk from p. aeruginosa 0.9454 9 156
6qkv-assembly1.cif.gz_A structure of yibk from p. aeruginosa 0.934 9 156
6qh8-assembly2.cif.gz_B structure of knotted yibk from p. aeruginosa 0.9334 6 156
4kdz-assembly1.cif.gz_A crystal structure of trna/rrna methyltransferase yibk from escherichia coli (target nysgrc-012599) 0.931 10 156
ID Description Score Start End Superfamily
5co4A00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9542 9 156 3.40.1280.10
af_O50394_1_154_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9181 10 156 3.40.1280.10
5co4A00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9117 9 156 3.40.1280.10
4pzkB00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9069 11 161 3.40.1280.10
af_P94978_97_258_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9042 10 156 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A838U4N0-F1-model_v4 Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) 0.9857 10 156 GO:0002130
GO:0003723
GO:0005737
GO:0008175
GO:0008757
AF-A0A0B6WT02-F1-model_v4 Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) 0.9852 10 157 GO:0002130
GO:0003723
GO:0005737
GO:0141098
GO:0141102
AF-A0A2D9TGL7-F1-model_v4 Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) 0.9809 8 156 GO:0002130
GO:0003723
GO:0005737
GO:0141098
GO:0141102
AF-A0A833CAW1-F1-model_v4 Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) 0.9806 12 156 GO:0002130
GO:0003723
GO:0005737
GO:0008175
GO:0008757
AF-A0A7X7GV22-F1-model_v4 Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) 0.9771 9 157 GO:0002130
GO:0003723
GO:0005737
GO:0008175
GO:0008757

Map