F365217

General Info

Members Datasets Scaffolds Average Seq Length
254 181 508 129

Family's Representative Sequence

Representative Sequence 3300049575|Ga0501039_0055819|Ga0501039_0055819_2333_2779
Length 148
Sequence MSGTRTSTAVPGETIAPAMPHPAVPGAAIDAEQACPISPVVDIVFSRWTTPILWTLHAFGRQRFVELSRRIGTITPKVLTQRLRQLERDGLVVRTYHPEVPPRVEYEISPLGRSLAPLFAQLADWATEHLPEVDTARRAYDTSDRPLP

Samples

Sample ID Description Type Environment
1 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
27 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
33 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
34 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
40 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
59 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
60 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
61 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
62 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
63 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
64 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
65 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
66 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
67 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
68 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
69 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
70 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
71 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
72 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
73 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
74 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
75 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
76 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
77 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
78 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
79 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
80 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
81 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
82 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
83 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
84 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
85 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
86 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
87 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
88 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
89 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
90 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
91 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
92 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
93 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
94 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
97 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
98 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
99 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
100 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
101 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
102 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
103 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
104 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
105 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
106 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
107 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
108 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
109 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
110 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
111 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
112 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
113 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
114 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
115 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
116 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
117 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
118 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
119 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
120 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
121 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
134 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
137 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
138 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
139 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
143 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
144 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
145 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
146 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
147 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
148 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
149 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
150 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
151 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
152 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
153 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
154 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
155 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
156 2619618881 Frankia sp. ACN1ag Isolate Unclassified
157 2643221647 Streptomyces sp. Root369 Isolate Unclassified
158 2671180195 Frankia sp. CcI49 Isolate Nodule
159 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
160 2687453737 Frankia sp. BMG5.36 Isolate Nodule
161 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
162 2773857922 Frankia sp. CcI49 Isolate Nodule
163 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
164 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
165 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
166 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
167 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
168 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
169 2867428634 Streptomyces sp. RP5T Isolate Unclassified
170 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
171 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
172 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
173 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
174 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
175 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
176 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
177 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
178 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
179 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
180 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
181 8054913762 Frankia gtarii Agncl-10 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.98
Metatranscriptomes 0.79
Isolates 10.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.06
Nodule 1.57
Rhizoplane 1.97
Rhizosphere 74.02
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501039_0055819 3300049575 Bacteria 3060
2 JGI24740J21852_10020427 3300001979 Bacteria 2311
3 JGI24735J21928_10052033 3300002067 Bacteria 1182
4 JGI25406J46586_10017172 3300003203 Bacteria 2997
5 rootH2_10047215 3300003320 Bacteria 3970
6 Ga0006562J51391_1027297 3300003578 Bacteria 2030
7 Ga0070680_101367324 3300005336 Bacteria 613
8 Ga0070682_100654425 3300005337 Bacteria 837
9 Ga0070668_100000709 3300005347 Bacteria 22813
10 Ga0070668_100204487 3300005347 Bacteria 1622
11 Ga0070667_100211682 3300005367 Bacteria 1723
12 Ga0070709_11580720 3300005434 Bacteria 534
13 Ga0070714_100058863 3300005435 Bacteria 3293
14 Ga0070714_100165273 3300005435 Bacteria 2005
15 Ga0070714_100566069 3300005435 Bacteria 1089
16 Ga0070714_101970128 3300005435 Bacteria 570
17 Ga0070713_100019825 3300005436 Bacteria 5146
18 Ga0070713_100177942 3300005436 Bacteria 1910
19 Ga0070700_100303551 3300005441 Bacteria 1166
20 Ga0070663_100002468 3300005455 Bacteria 10434
21 Ga0070678_100758677 3300005456 Bacteria 878
22 Ga0070679_100253611 3300005530 Bacteria 1715
23 Ga0070665_100136809 3300005548 Bacteria 2453
24 Ga0070704_101717573 3300005549 Bacteria 580
25 Ga0081539_10000197 3300005985 Bacteria 140516
26 Ga0081539_10000436 3300005985 Bacteria 88853
27 Ga0081539_10346528 3300005985 Bacteria 625
28 Ga0070717_10022085 3300006028 Bacteria 5024
29 Ga0070717_10190701 3300006028 Bacteria 1791
30 Ga0075365_10247248 3300006038 Bacteria 1253
31 Ga0075363_100003944 3300006048 Bacteria 6407
32 Ga0075363_100855156 3300006048 Bacteria 555
33 Ga0075364_10000301 3300006051 Bacteria 24078
34 Ga0070712_100025015 3300006175 Bacteria 3963
35 Ga0075362_10065609 3300006177 Bacteria 1649
36 Ga0075369_10014071 3300006186 Bacteria 3190
37 Ga0075370_10073427 3300006353 Bacteria 1959
38 Ga0105250_10009507 3300009092 Bacteria 4092
39 Ga0105238_11213167 3300009551 Bacteria 779
40 Ga0105249_10639219 3300009553 Bacteria 1121
41 Ga0105032_120066 3300009979 Bacteria 521
42 Ga0105029_100439 3300009984 Bacteria 2230
43 Ga0105035_116828 3300009988 Bacteria 677
44 Ga0157372_10086827 3300013307 Bacteria 3549
45 Ga0157515_137799 3300013875 Bacteria 746
46 Ga0163163_10643262 3300014325 Bacteria 1124
47 Ga0157379_10777077 3300014968 Bacteria 903
48 Ga0183367_1004 3300015688 Bacteria 716880
49 Ga0207680_10708404 3300025903 Bacteria 721
50 Ga0207685_10099160 3300025905 Bacteria 1242
51 Ga0207699_10056622 3300025906 Bacteria 2338
52 Ga0207693_10033910 3300025915 Bacteria 4027
53 Ga0207663_10381065 3300025916 Bacteria 1074
54 Ga0207660_11217116 3300025917 Bacteria 613
55 Ga0207681_10060200 3300025923 Bacteria 2606
56 Ga0207694_11248003 3300025924 Bacteria 629
57 Ga0207700_10014888 3300025928 Bacteria 5110
58 Ga0207700_10165274 3300025928 Bacteria 1841
59 Ga0207664_10029212 3300025929 Bacteria 4197
60 Ga0207664_10958973 3300025929 Bacteria 767
61 Ga0207665_10957103 3300025939 Bacteria 680
62 Ga0207712_11336348 3300025961 Bacteria 641
63 Ga0207668_10002144 3300025972 Bacteria 11508
64 Ga0207668_10512802 3300025972 Bacteria 1033
65 Ga0207678_10001184 3300026067 Bacteria 23897
66 Ga0207708_10340943 3300026075 Bacteria 1227
67 Ga0209371_1045201 3300027312 Bacteria 872
68 Ga0268266_10125127 3300028379 Bacteria 2293
69 Ga0268265_10596549 3300028380 Bacteria 1055
70 Ga0307515_10000592 3300028794 Bacteria 84684
71 Ga0307515_10048533 3300028794 Bacteria 6417
72 Ga0307515_10115947 3300028794 Bacteria 3080
73 Ga0307515_10774455 3300028794 Bacteria 580
74 Ga0268256_1094263 3300030500 Bacteria 540
75 Ga0307512_10030317 3300030522 Bacteria 4707
76 Ga0307512_10236445 3300030522 Bacteria 931
77 Ga0307512_10241861 3300030522 Bacteria 912
78 Ga0307513_10001973 3300031456 Bacteria 29050
79 Ga0307513_10089546 3300031456 Bacteria 3141
80 Ga0307509_10270332 3300031507 Bacteria 1468
81 Ga0307408_100399933 3300031548 Bacteria 1179
82 Ga0307508_10002311 3300031616 Bacteria 20242
83 Ga0307508_10166017 3300031616 Bacteria 1811
84 Ga0307514_10030105 3300031649 Bacteria 4358
85 Ga0307405_10829549 3300031731 Bacteria 777
86 Ga0307410_10480808 3300031852 Bacteria 1019
87 Ga0307406_11245115 3300031901 Bacteria 648
88 Ga0307409_100895273 3300031995 Bacteria 901
89 Ga0307507_10164526 3300033179 Bacteria 1629
90 Ga0307507_10214881 3300033179 Bacteria 1304
91 Ga0307510_10392936 3300033180 Bacteria 831
92 Ga0307510_10452167 3300033180 Bacteria 725
93 Ga0373956_0011746 3300035119 Bacteria 3613
94 Ga0373927_0287078 3300035695 Bacteria 1083
95 Ga0372808_006288 3300036459 Bacteria 1596
96 Ga0395901_0962069 3300038443 Bacteria 832
97 Ga0439439_0000277 3300041406 Bacteria 8106
98 Ga0451837_1342296 3300041494 Bacteria 1056
99 Ga0451853_2844610 3300041512 Bacteria 529
100 Ga0439433_0011653 3300041999 Bacteria 1926
101 Ga0439449_0005064 3300042007 Bacteria 5070
102 Ga0439457_001875 3300042014 Bacteria 6214
103 Ga0450900_005889 3300042136 Bacteria 1464
104 Ga0450903_006525 3300042138 Bacteria 1933
105 Ga0450908_078172 3300042184 Bacteria 592
106 Ga0466969_0028235 3300044656 Bacteria 2868
107 Ga0466969_0088234 3300044656 Bacteria 1472
108 Ga0466972_0002046 3300044658 Bacteria 9878
109 Ga0466972_0197836 3300044658 Bacteria 941
110 Ga0466965_0009743 3300044683 Bacteria 4469
111 Ga0466966_0005013 3300044684 Bacteria 8712
112 Ga0466966_0008617 3300044684 Bacteria 6751
113 Ga0466966_0021138 3300044684 Bacteria 4273
114 Ga0466966_0064050 3300044684 Bacteria 2316
115 Ga0466961_0003792 3300044693 Bacteria 9451
116 Ga0466961_0016386 3300044693 Bacteria 4761
117 Ga0466961_0118182 3300044693 Bacteria 1666
118 Ga0466971_0215429 3300044719 Bacteria 909
119 Ga0466968_0054161 3300044735 Bacteria 1719
120 Ga0466968_0224086 3300044735 Bacteria 886
121 Ga0466970_0032744 3300044765 Bacteria 2747
122 Ga0466970_0045507 3300044765 Bacteria 2337
123 Ga0466970_0075031 3300044765 Bacteria 1821
124 Ga0466957_0138382 3300044842 Bacteria 1567
125 Ga0466957_0754111 3300044842 Bacteria 689
126 Ga0466960_0005760 3300044901 Bacteria 4931
127 Ga0466960_0025929 3300044901 Bacteria 2658
128 Ga0466960_0542863 3300044901 Bacteria 685
129 Ga0466959_0001390 3300045049 Bacteria 14803
130 Ga0466959_0001463 3300045049 Bacteria 14470
131 Ga0495629_0059621 3300046459 Bacteria 2668
132 Ga0495594_0017558 3300046499 Bacteria 3782
133 Ga0495594_0187843 3300046499 Bacteria 1177
134 Ga0495606_0179687 3300046507 Bacteria 1221
135 Ga0495630_0296960 3300046517 Bacteria 1234
136 Ga0495645_0151632 3300046543 Bacteria 1610
137 Ga0495622_0221789 3300046557 Bacteria 837
138 Ga0495668_0000640 3300046616 Bacteria 42150
139 Ga0495625_0000446 3300046660 Bacteria 62028
140 Ga0495588_0086428 3300046674 Bacteria 1640
141 Ga0495599_0286147 3300046678 Bacteria 997
142 Ga0495670_0277406 3300046691 Bacteria 896
143 Ga0495581_0212759 3300047315 Bacteria 1130
144 Ga0495604_0044195 3300047317 Bacteria 3483
145 Ga0495636_0001260 3300047318 Bacteria 9591
146 Ga0495636_0237060 3300047318 Bacteria 841
147 Ga0495683_0104297 3300047323 Bacteria 1360
148 Ga0495685_161683 3300047447 Bacteria 725
149 Ga0495615_0177622 3300048090 Bacteria 647
150 Ga0495626_0000163 3300048091 Bacteria 81615
151 Ga0496105_0428726 3300048908 Bacteria 1046
152 Ga0496108_0137312 3300048911 Bacteria 2105
153 Ga0496109_0140908 3300048912 Bacteria 2254
154 Ga0496111_0712638 3300048914 Bacteria 729
155 Ga0496112_1210732 3300048915 Bacteria 672
156 Ga0496121_0279422 3300048924 Bacteria 1143
157 Ga0496126_0227278 3300048929 Bacteria 1565
158 Ga0501031_0295542 3300049568 Bacteria 1050
159 Ga0501031_0628219 3300049568 Bacteria 691
160 Ga0501032_0004345 3300049569 Bacteria 10702
161 Ga0501033_0054976 3300049570 Bacteria 2943
162 Ga0501034_0013467 3300049571 Bacteria 8417
163 Ga0501034_0055621 3300049571 Bacteria 3982
164 Ga0501036_0007059 3300049572 Bacteria 9138
165 Ga0501036_0435404 3300049572 Bacteria 1093
166 Ga0501037_0026850 3300049573 Bacteria 4253
167 Ga0501037_0124180 3300049573 Bacteria 1854
168 Ga0501037_0141180 3300049573 Bacteria 1724
169 Ga0501037_0354143 3300049573 Bacteria 1012
170 Ga0501037_0526331 3300049573 Bacteria 800
171 Ga0501038_0005379 3300049574 Bacteria 11893
172 Ga0501038_0017807 3300049574 Bacteria 6419
173 Ga0501038_0058599 3300049574 Bacteria 3301
174 Ga0501038_0066709 3300049574 Bacteria 3064
175 Ga0501039_0050705 3300049575 Bacteria 3211
176 Ga0501042_0541407 3300049578 Bacteria 846
177 Ga0501043_0026388 3300049579 Bacteria 4558
178 Ga0501043_0085627 3300049579 Bacteria 2476
179 Ga0501043_0131049 3300049579 Bacteria 1965
180 Ga0501046_0048796 3300049580 Bacteria 3351
181 Ga0501046_0476407 3300049580 Bacteria 896
182 Ga0501047_0001008 3300049581 Bacteria 28428
183 Ga0501047_0033310 3300049581 Bacteria 4973
184 Ga0501047_0036100 3300049581 Bacteria 4776
185 Ga0501047_0124124 3300049581 Bacteria 2462
186 Ga0501047_0206566 3300049581 Bacteria 1823
187 Ga0501047_0255812 3300049581 Bacteria 1599
188 Ga0501047_0330132 3300049581 Bacteria 1364
189 Ga0501047_0423531 3300049581 Bacteria 1162
190 Ga0501047_0681009 3300049581 Bacteria 846
191 Ga0501048_0133547 3300049582 Bacteria 1754
192 Ga0501068_0268615 3300049584 Bacteria 1089
193 Ga0501069_0731320 3300049585 Bacteria 598
194 Ga0501070_0006352 3300049586 Bacteria 10060
195 Ga0501070_0138470 3300049586 Bacteria 2010
196 Ga0501073_0038740 3300049589 Bacteria 3380
197 Ga0501073_0767292 3300049589 Bacteria 665
198 Ga0501074_0125809 3300049590 Bacteria 1833
199 Ga0501083_0306106 3300049744 Bacteria 1034
200 Ga0501276_007260 3300049773 Bacteria 885
201 Ga0501035_0007370 3300049822 Bacteria 10281
202 Ga0501035_0216356 3300049822 Bacteria 1637
203 Ga0501035_0217324 3300049822 Bacteria 1633
204 Ga0501035_1115827 3300049822 Bacteria 615
205 Ga0501035_1254198 3300049822 Bacteria 573
206 Ga0501044_0016700 3300049823 Bacteria 7879
207 Ga0501044_0017103 3300049823 Bacteria 7781
208 Ga0501044_0028163 3300049823 Bacteria 5930
209 Ga0501044_0071208 3300049823 Bacteria 3535
210 Ga0501044_0139578 3300049823 Bacteria 2412
211 Ga0501044_0394913 3300049823 Bacteria 1296
212 nmdc:mga03683_117504_c1 3300050489 Bacteria 1180
213 nmdc:mga03n38_12768_c1 3300050490 Bacteria 3170
214 nmdc:mga03n38_22947_c1 3300050490 Bacteria 2533
215 nmdc:mga00v17_939_c1 3300050491 Bacteria 6895
216 nmdc:mga0yw44_404772_c1 3300050492 Bacteria 923
217 nmdc:mga07m45_195338_c1 3300050496 Bacteria 1177
218 nmdc:mga0sz30_2780_c1 3300050516 Bacteria 6245
219 Ga0495655_0246754 3300053083 Bacteria 599
220 Ga0500644_0111977 3300053088 Bacteria 1052
221 Ga0500644_0215220 3300053088 Bacteria 799
222 Ga0500646_0002440 3300053090 Bacteria 4832
223 Ga0500573_0005933 3300053140 Bacteria 6572
224 Ga0500573_0081392 3300053140 Bacteria 1840
225 Ga0500577_0005905 3300053142 Bacteria 3335
226 Ga0500600_0200611 3300053149 Bacteria 940
227 Ga0500616_0006605 3300053153 Bacteria 7562
228 Ga0500656_043166 3300053732 Bacteria 637
229 2619857845 2619618881 Bacteria 7521104
230 2644262188 2643221647 Bacteria 10741251
231 2671834713 2671180195 Bacteria 9757215
232 2676478657 2675903058 Bacteria 6822861
233 2689957877 2687453737 Bacteria 11203906
234 2753074611 2751185734 Bacteria 8863695
235 2774852869 2773857922 Bacteria 9757215
236 2795783117 2795385470 Bacteria 8317180
237 2819699451 2818991463 Bacteria 7948711
238 2819742967 2818991472 Bacteria 10089953
239 2827631749 2827628540 Bacteria 6858585
240 2852636255 2852635781 Bacteria 8251373
241 2862706916 2862705112 Bacteria 6563286
242 2867430320 2867428634 Bacteria 9590268
243 2870725493 2870721527 Bacteria 9689237
244 2891402923 2891395885 Bacteria 9251614
245 2891554748 2891554331 Bacteria 8812224
246 2895881573 2895880812 Bacteria 11255272
247 2954697008 2954691527 Bacteria 10720516
248 2954705125 2954701450 Bacteria 10834262
249 2997455637 2997451912 Bacteria 8492419
250 2997601325 2997600082 Bacteria 9896405
251 3006325368 3006321560 Bacteria 8247479
252 8008486337 8008485437 Bacteria 7198341
253 8025528116 8025524527 Bacteria 7197316
254 8054916124 8054913762 Bacteria 7713009
255 Ga0501039_0055819
256 JGI24740J21852_10020427
257 JGI24735J21928_10052033
258 JGI25406J46586_10017172
259 rootH2_10047215
260 Ga0006562J51391_1027297
261 Ga0070680_101367324
262 Ga0070682_100654425
263 Ga0070668_100000709
264 Ga0070668_100204487
265 Ga0070667_100211682
266 Ga0070709_11580720
267 Ga0070714_100058863
268 Ga0070714_100165273
269 Ga0070714_100566069
270 Ga0070714_101970128
271 Ga0070713_100019825
272 Ga0070713_100177942
273 Ga0070700_100303551
274 Ga0070663_100002468
275 Ga0070678_100758677
276 Ga0070679_100253611
277 Ga0070665_100136809
278 Ga0070704_101717573
279 Ga0081539_10000197
280 Ga0081539_10000436
281 Ga0081539_10346528
282 Ga0070717_10022085
283 Ga0070717_10190701
284 Ga0075365_10247248
285 Ga0075363_100003944
286 Ga0075363_100855156
287 Ga0075364_10000301
288 Ga0070712_100025015
289 Ga0075362_10065609
290 Ga0075369_10014071
291 Ga0075370_10073427
292 Ga0105250_10009507
293 Ga0105238_11213167
294 Ga0105249_10639219
295 Ga0105032_120066
296 Ga0105029_100439
297 Ga0105035_116828
298 Ga0157372_10086827
299 Ga0157515_137799
300 Ga0163163_10643262
301 Ga0157379_10777077
302 Ga0183367_1004
303 Ga0207680_10708404
304 Ga0207685_10099160
305 Ga0207699_10056622
306 Ga0207693_10033910
307 Ga0207663_10381065
308 Ga0207660_11217116
309 Ga0207681_10060200
310 Ga0207694_11248003
311 Ga0207700_10014888
312 Ga0207700_10165274
313 Ga0207664_10029212
314 Ga0207664_10958973
315 Ga0207665_10957103
316 Ga0207712_11336348
317 Ga0207668_10002144
318 Ga0207668_10512802
319 Ga0207678_10001184
320 Ga0207708_10340943
321 Ga0209371_1045201
322 Ga0268266_10125127
323 Ga0268265_10596549
324 Ga0307515_10000592
325 Ga0307515_10048533
326 Ga0307515_10115947
327 Ga0307515_10774455
328 Ga0268256_1094263
329 Ga0307512_10030317
330 Ga0307512_10236445
331 Ga0307512_10241861
332 Ga0307513_10001973
333 Ga0307513_10089546
334 Ga0307509_10270332
335 Ga0307408_100399933
336 Ga0307508_10002311
337 Ga0307508_10166017
338 Ga0307514_10030105
339 Ga0307405_10829549
340 Ga0307410_10480808
341 Ga0307406_11245115
342 Ga0307409_100895273
343 Ga0307507_10164526
344 Ga0307507_10214881
345 Ga0307510_10392936
346 Ga0307510_10452167
347 Ga0373956_0011746
348 Ga0373927_0287078
349 Ga0372808_006288
350 Ga0395901_0962069
351 Ga0439439_0000277
352 Ga0451837_1342296
353 Ga0451853_2844610
354 Ga0439433_0011653
355 Ga0439449_0005064
356 Ga0439457_001875
357 Ga0450900_005889
358 Ga0450903_006525
359 Ga0450908_078172
360 Ga0466969_0028235
361 Ga0466969_0088234
362 Ga0466972_0002046
363 Ga0466972_0197836
364 Ga0466965_0009743
365 Ga0466966_0005013
366 Ga0466966_0008617
367 Ga0466966_0021138
368 Ga0466966_0064050
369 Ga0466961_0003792
370 Ga0466961_0016386
371 Ga0466961_0118182
372 Ga0466971_0215429
373 Ga0466968_0054161
374 Ga0466968_0224086
375 Ga0466970_0032744
376 Ga0466970_0045507
377 Ga0466970_0075031
378 Ga0466957_0138382
379 Ga0466957_0754111
380 Ga0466960_0005760
381 Ga0466960_0025929
382 Ga0466960_0542863
383 Ga0466959_0001390
384 Ga0466959_0001463
385 Ga0495629_0059621
386 Ga0495594_0017558
387 Ga0495594_0187843
388 Ga0495606_0179687
389 Ga0495630_0296960
390 Ga0495645_0151632
391 Ga0495622_0221789
392 Ga0495668_0000640
393 Ga0495625_0000446
394 Ga0495588_0086428
395 Ga0495599_0286147
396 Ga0495670_0277406
397 Ga0495581_0212759
398 Ga0495604_0044195
399 Ga0495636_0001260
400 Ga0495636_0237060
401 Ga0495683_0104297
402 Ga0495685_161683
403 Ga0495615_0177622
404 Ga0495626_0000163
405 Ga0496105_0428726
406 Ga0496108_0137312
407 Ga0496109_0140908
408 Ga0496111_0712638
409 Ga0496112_1210732
410 Ga0496121_0279422
411 Ga0496126_0227278
412 Ga0501031_0295542
413 Ga0501031_0628219
414 Ga0501032_0004345
415 Ga0501033_0054976
416 Ga0501034_0013467
417 Ga0501034_0055621
418 Ga0501036_0007059
419 Ga0501036_0435404
420 Ga0501037_0026850
421 Ga0501037_0124180
422 Ga0501037_0141180
423 Ga0501037_0354143
424 Ga0501037_0526331
425 Ga0501038_0005379
426 Ga0501038_0017807
427 Ga0501038_0058599
428 Ga0501038_0066709
429 Ga0501039_0050705
430 Ga0501042_0541407
431 Ga0501043_0026388
432 Ga0501043_0085627
433 Ga0501043_0131049
434 Ga0501046_0048796
435 Ga0501046_0476407
436 Ga0501047_0001008
437 Ga0501047_0033310
438 Ga0501047_0036100
439 Ga0501047_0124124
440 Ga0501047_0206566
441 Ga0501047_0255812
442 Ga0501047_0330132
443 Ga0501047_0423531
444 Ga0501047_0681009
445 Ga0501048_0133547
446 Ga0501068_0268615
447 Ga0501069_0731320
448 Ga0501070_0006352
449 Ga0501070_0138470
450 Ga0501073_0038740
451 Ga0501073_0767292
452 Ga0501074_0125809
453 Ga0501083_0306106
454 Ga0501276_007260
455 Ga0501035_0007370
456 Ga0501035_0216356
457 Ga0501035_0217324
458 Ga0501035_1115827
459 Ga0501035_1254198
460 Ga0501044_0016700
461 Ga0501044_0017103
462 Ga0501044_0028163
463 Ga0501044_0071208
464 Ga0501044_0139578
465 Ga0501044_0394913
466 nmdc:mga03683_117504_c1
467 nmdc:mga03n38_12768_c1
468 nmdc:mga03n38_22947_c1
469 nmdc:mga00v17_939_c1
470 nmdc:mga0yw44_404772_c1
471 nmdc:mga07m45_195338_c1
472 nmdc:mga0sz30_2780_c1
473 Ga0495655_0246754
474 Ga0500644_0111977
475 Ga0500644_0215220
476 Ga0500646_0002440
477 Ga0500573_0005933
478 Ga0500573_0081392
479 Ga0500577_0005905
480 Ga0500600_0200611
481 Ga0500616_0006605
482 Ga0500656_043166
483 2619857845
484 2644262188
485 2671834713
486 2676478657
487 2689957877
488 2753074611
489 2774852869
490 2795783117
491 2819699451
492 2819742967
493 2827631749
494 2852636255
495 2862706916
496 2867430320
497 2870725493
498 2891402923
499 2891554748
500 2895881573
501 2954697008
502 2954705125
503 2997455637
504 2997601325
505 3006325368
506 8008486337
507 8025528116
508 8054916124

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01638

HxlR

HxlR-like helix-turn-helix

43

134

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.9482 40 100
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9367 40 100
5hs9-assembly1.cif.gz_A crystal structure of the quinone-bound yodb from b. subtilis 0.9297 25 118
5hs9-assembly1.cif.gz_B crystal structure of the quinone-bound yodb from b. subtilis 0.9231 25 118
7bze-assembly1.cif.gz_A-2 structure of bacillus subtilis hxlr, k13a mutant 0.9119 25 124
ID Description Score Start End Superfamily
5j6xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9482 40 100 1.10.10.10
4lb5B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9367 40 100 1.10.10.10
5hs9A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9297 25 118 1.10.10.10
5hs7B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9287 25 119 1.10.10.10
5hs9B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9231 25 118 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A5Q0LP99-F1-model_v4 Transcriptional regulator 0.9505 27 133 GO:0003677
AF-A0A6L7IDQ0-F1-model_v4 Transcriptional regulator 0.9467 25 120 GO:0003677
GO:0005737
AF-A0A037ZJZ1-F1-model_v4 Transcriptional regulator 0.9416 24 119 GO:0003677
AF-A0A2U3BWN6-F1-model_v4 Transcriptional regulator 0.9379 24 120 GO:0003677
AF-A0A7C9VS79-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9374 24 131 GO:0003677

Map