F365144

General Info

Members Datasets Scaffolds Average Seq Length
254 168 253 491

Family's Representative Sequence

Representative Sequence 3300046492|Ga0495585_0006000|Ga0495585_0006000_2775_4334
Length 519
Sequence MPDLLANRPMKNQVQLITYVDRLSGGGLPELRALLEGPLAGVFGGVHLLPFFDPIDGADAGFDPVDHTSVDARLGSWDDVRAIASVIDVMADVIVNHMSADSPQFKDYLATGRRSRHDGLFLTFDKVFPDGASERDLLAVYRPRPGLPLRTTTFADGERRLLWSTFTSHQVDIDVEHPAGRAYLEGILDRLAASAVRMVRLDAVGYALKTAGTSCFMTPDTFRFIEQFAGDARSRGMEVLVEVHSHYSKQIEIAERVDWVYDFALPPLLLHAFAFGSAEALRQWIEIRPNNSLTVLDTHDGIGIIDIGADAADRDARPGLVPPDELDRLVEIIHENSRGESRRATGAAASNLDLYQVNCTYYDALGRNDVAYLLARAIQLFLPGIPQVYYVGLLAGENDMVLLAETAVGRDINRHRYGPGEAQAALAKPAVRELVRLIRLRNEFPAFSGCFRSAPAEPRRIDLQWSLGAHAARLVVDFRTLDYSLTLDTPEGRHSHRFELAPSAAPTAPEAAAVTDPPF

Samples

Sample ID Description Type Environment
1 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
4 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
5 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
71 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
110 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
111 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
114 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
115 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
116 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
117 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
120 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
121 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
122 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
123 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
124 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
125 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
126 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
127 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
128 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
134 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
135 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
136 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
137 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
141 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
144 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
145 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
146 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
147 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
152 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
155 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
164 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
165 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
166 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
167 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
168 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.72
Nodule 0
Rhizoplane 0
Rhizosphere 92.52
Stem 0
Stem Tuber 0
Unclassified 2.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10004888 3300003203 Bacteria 6228
2 Ga0055539_1000166 3300003752 Bacteria 59517
3 Ga0055533_1000087 3300003756 Bacteria 122417
4 Ga0055525_1000674 3300003759 Bacteria 13065
5 Ga0070683_100018579 3300005329 Bacteria 6162
6 Ga0070690_100000471 3300005330 Bacteria 20213
7 Ga0070666_10001721 3300005335 Bacteria 13341
8 Ga0070680_100001590 3300005336 Bacteria 16586
9 Ga0070680_100010054 3300005336 Bacteria 7290
10 Ga0070680_100024178 3300005336 Bacteria 4848
11 Ga0070680_100060166 3300005336 Bacteria 3108
12 Ga0070680_100063228 3300005336 Bacteria 3031
13 Ga0068868_100005204 3300005338 Bacteria 9131
14 Ga0070689_100042713 3300005340 Bacteria 3481
15 Ga0070691_10000546 3300005341 Bacteria 14269
16 Ga0070661_100016060 3300005344 Bacteria 5284
17 Ga0070675_100002475 3300005354 Bacteria 13826
18 Ga0070671_100050593 3300005355 Bacteria 3455
19 Ga0070667_100004308 3300005367 Bacteria 12011
20 Ga0070667_100018792 3300005367 Bacteria 5732
21 Ga0070709_10002868 3300005434 Bacteria 9306
22 Ga0070705_100021845 3300005440 Bacteria 3410
23 Ga0070694_100132863 3300005444 Bacteria 1800
24 Ga0070681_10000641 3300005458 Bacteria 28787
25 Ga0070681_10040522 3300005458 Bacteria 4666
26 Ga0070681_10053739 3300005458 Bacteria 4013
27 Ga0070681_10136081 3300005458 Bacteria 2387
28 Ga0070706_100001580 3300005467 Bacteria 23764
29 Ga0070707_100000382 3300005468 Bacteria 43641
30 Ga0070707_100055899 3300005468 Bacteria 3784
31 Ga0070698_100000447 3300005471 Bacteria 43804
32 Ga0070679_100002952 3300005530 Bacteria 15499
33 Ga0070679_100009314 3300005530 Bacteria 9284
34 Ga0070679_100038146 3300005530 Bacteria 4776
35 Ga0070684_100028518 3300005535 Bacteria 4723
36 Ga0068853_100057450 3300005539 Bacteria 3358
37 Ga0070672_100022074 3300005543 Bacteria 4668
38 Ga0070686_100011119 3300005544 Bacteria 5099
39 Ga0070696_100004748 3300005546 Bacteria 9076
40 Ga0070693_100034394 3300005547 Bacteria 2804
41 Ga0070665_100021321 3300005548 Bacteria 6517
42 Ga0068855_100001365 3300005563 Bacteria 30241
43 Ga0068855_100001881 3300005563 Bacteria 26066
44 Ga0068855_100008034 3300005563 Bacteria 12748
45 Ga0068855_100107327 3300005563 Unclassified 3208
46 Ga0068855_100147368 3300005563 Bacteria 2678
47 Ga0070664_100012376 3300005564 Bacteria 6934
48 Ga0068857_100003164 3300005577 Bacteria 13655
49 Ga0068856_100027729 3300005614 Bacteria 5525
50 Ga0070702_100070876 3300005615 Bacteria 2058
51 Ga0068852_100098829 3300005616 Unclassified 2629
52 Ga0068859_100013487 3300005617 Bacteria 8195
53 Ga0068864_100004651 3300005618 Bacteria 11256
54 Ga0068863_100019259 3300005841 Bacteria 6529
55 Ga0068863_100041143 3300005841 Bacteria 4393
56 Ga0068863_100086927 3300005841 Bacteria 2963
57 Ga0068858_100007485 3300005842 Bacteria 10555
58 Ga0068860_100007347 3300005843 Bacteria 11014
59 Ga0068860_100070551 3300005843 Bacteria 3322
60 Ga0081539_10000016 3300005985 Bacteria 381648
61 Ga0097621_100001377 3300006237 Bacteria 16719
62 Ga0075370_10005521 3300006353 Bacteria 6298
63 Ga0068871_100002455 3300006358 Bacteria 12658
64 Ga0097620_100013485 3300006931 Bacteria 8195
65 Ga0099794_10007226 3300007265 Bacteria 4548
66 Ga0105240_10000988 3300009093 Bacteria 50723
67 Ga0105240_10005726 3300009093 Bacteria 18435
68 Ga0105240_10037519 3300009093 Bacteria 6227
69 Ga0105240_10082843 3300009093 Bacteria 3939
70 Ga0111539_10016698 3300009094 Bacteria 9097
71 Ga0105245_10001386 3300009098 Bacteria 21950
72 Ga0105245_10165976 3300009098 Bacteria 2099
73 Ga0105241_10043773 3300009174 Bacteria 3391
74 Ga0105242_10016658 3300009176 Bacteria 5717
75 Ga0105248_10000285 3300009177 Bacteria 59638
76 Ga0105248_10002160 3300009177 Bacteria 21759
77 Ga0105248_10002685 3300009177 Bacteria 19760
78 Ga0105237_10004706 3300009545 Bacteria 15702
79 Ga0105238_10000440 3300009551 Bacteria 43764
80 Ga0105238_10023518 3300009551 Bacteria 6280
81 Ga0105238_10034675 3300009551 Bacteria 5134
82 Ga0105238_10059728 3300009551 Bacteria 3819
83 Ga0105238_10068397 3300009551 Unclassified 3553
84 Ga0105249_10030078 3300009553 Bacteria 4907
85 Ga0105249_10068605 3300009553 Unclassified 3271
86 Ga0105239_10047547 3300010375 Bacteria 4703
87 Ga0105239_10083934 3300010375 Unclassified 3508
88 Ga0105246_10013963 3300011119 Bacteria 5043
89 Ga0157370_10001186 3300013104 Bacteria 32487
90 Ga0157370_10007395 3300013104 Bacteria 11962
91 Ga0157369_10003030 3300013105 Bacteria 20057
92 Ga0157369_10028389 3300013105 Bacteria 6192
93 Ga0157369_10032477 3300013105 Bacteria 5740
94 Ga0157369_10051367 3300013105 Bacteria 4461
95 Ga0157369_10173712 3300013105 Bacteria 2269
96 Ga0157369_10270193 3300013105 Bacteria 1772
97 Ga0157374_10245069 3300013296 Bacteria 1763
98 Ga0157378_10192715 3300013297 Bacteria 1924
99 Ga0163162_10004440 3300013306 Bacteria 13505
100 Ga0163162_10018156 3300013306 Bacteria 6888
101 Ga0163162_10054967 3300013306 Bacteria 4006
102 Ga0157372_10021166 3300013307 Bacteria 7025
103 Ga0157372_10029585 3300013307 Bacteria 5983
104 Ga0157375_10001860 3300013308 Bacteria 18170
105 Ga0157375_10034879 3300013308 Bacteria 4797
106 Ga0163163_10001927 3300014325 Bacteria 17574
107 Ga0163163_10005474 3300014325 Bacteria 10980
108 Ga0163163_10011262 3300014325 Bacteria 8105
109 Ga0163163_10017306 3300014325 Bacteria 6721
110 Ga0157380_10003691 3300014326 Bacteria 10533
111 Ga0157376_10002005 3300014969 Bacteria 13646
112 Ga0213872_10000133 3300021361 Bacteria 67595
113 Ga0209674_100088 3300025226 Bacteria 181554
114 Ga0209563_100140 3300025230 Bacteria 81213
115 Ga0209677_100095 3300025253 Bacteria 100330
116 Ga0207680_10004109 3300025903 Bacteria 6884
117 Ga0207684_10001471 3300025910 Bacteria 25348
118 Ga0207654_10008746 3300025911 Bacteria 5133
119 Ga0207707_10001261 3300025912 Bacteria 23696
120 Ga0207707_10002139 3300025912 Bacteria 17896
121 Ga0207707_10010396 3300025912 Bacteria 8076
122 Ga0207707_10047791 3300025912 Bacteria 3726
123 Ga0207695_10015277 3300025913 Bacteria 9050
124 Ga0207695_10024484 3300025913 Bacteria 6791
125 Ga0207695_10038137 3300025913 Bacteria 5178
126 Ga0207695_10090422 3300025913 Unclassified 3077
127 Ga0207660_10063218 3300025917 Bacteria 2668
128 Ga0207657_10117591 3300025919 Bacteria 2189
129 Ga0207649_10009492 3300025920 Bacteria 5326
130 Ga0207652_10005591 3300025921 Bacteria 10192
131 Ga0207652_10013031 3300025921 Bacteria 6730
132 Ga0207652_10036867 3300025921 Bacteria 4135
133 Ga0207646_10000316 3300025922 Bacteria 65456
134 Ga0207646_10016564 3300025922 Bacteria 6916
135 Ga0207694_10009535 3300025924 Bacteria 7322
136 Ga0207694_10023654 3300025924 Unclassified 4665
137 Ga0207694_10027240 3300025924 Bacteria 4351
138 Ga0207694_10089226 3300025924 Bacteria 2431
139 Ga0207650_10014636 3300025925 Bacteria 5448
140 Ga0207659_10008380 3300025926 Bacteria 6412
141 Ga0207659_10028091 3300025926 Bacteria 3818
142 Ga0207659_10063107 3300025926 Unclassified 2677
143 Ga0207687_10000286 3300025927 Bacteria 34802
144 Ga0207687_10001535 3300025927 Bacteria 15845
145 Ga0207700_10013467 3300025928 Bacteria 5324
146 Ga0207644_10005976 3300025931 Bacteria 7933
147 Ga0207706_10003584 3300025933 Bacteria 14827
148 Ga0207670_10004725 3300025936 Bacteria 7385
149 Ga0207691_10120329 3300025940 Bacteria 2328
150 Ga0207711_10001660 3300025941 Bacteria 20530
151 Ga0207711_10053224 3300025941 Bacteria 3471
152 Ga0207711_10065777 3300025941 Bacteria 3134
153 Ga0207689_10090527 3300025942 Bacteria 2514
154 Ga0207661_10004643 3300025944 Bacteria 9622
155 Ga0207661_10016663 3300025944 Bacteria 5423
156 Ga0207679_10006524 3300025945 Bacteria 7377
157 Ga0207667_10005465 3300025949 Bacteria 15491
158 Ga0207667_10021788 3300025949 Bacteria 7095
159 Ga0207667_10070508 3300025949 Unclassified 3637
160 Ga0207651_10041326 3300025960 Bacteria 3060
161 Ga0207658_10007777 3300025986 Bacteria 7306
162 Ga0207677_10006351 3300026023 Bacteria 6479
163 Ga0207677_10018246 3300026023 Bacteria 4207
164 Ga0207703_10015049 3300026035 Bacteria 6039
165 Ga0207639_10117793 3300026041 Bacteria 2177
166 Ga0207708_10059932 3300026075 Bacteria 2906
167 Ga0207641_10036701 3300026088 Bacteria 4091
168 Ga0207676_10006045 3300026095 Bacteria 8538
169 Ga0207674_10001222 3300026116 Bacteria 33473
170 Ga0207698_10131723 3300026142 Unclassified 2138
171 Ga0209974_10000950 3300027876 Bacteria 10142
172 Ga0265334_10004873 3300028573 Bacteria 5900
173 Ga0265336_10000061 3300028666 Bacteria 102829
174 Ga0265336_10000087 3300028666 Bacteria 72636
175 Ga0307515_10000048 3300028794 Bacteria 288111
176 Ga0307515_10000080 3300028794 Bacteria 224941
177 Ga0307515_10001430 3300028794 Bacteria 53972
178 Ga0265338_10021836 3300028800 Bacteria 6652
179 Ga0265325_10001661 3300031241 Bacteria 15473
180 Ga0265340_10019099 3300031247 Unclassified 3529
181 Ga0265339_10034856 3300031249 Bacteria 2826
182 Ga0265313_10001713 3300031595 Bacteria 20198
183 Ga0307508_10000894 3300031616 Bacteria 34741
184 Ga0265314_10006245 3300031711 Bacteria 10581
185 Ga0316576_10018009 3300031727 Bacteria 4813
186 Ga0316576_10028151 3300031727 Bacteria 3958
187 Ga0316578_10066088 3300031728 Bacteria 2136
188 Ga0307516_10000124 3300031730 Bacteria 90831
189 Ga0307516_10001117 3300031730 Bacteria 37423
190 Ga0316577_10039253 3300031733 Bacteria 2649
191 Ga0373934_0002640 3300035086 Bacteria 6589
192 Ga0373939_0000044 3300035114 Bacteria 44944
193 Ga0373960_0001085 3300035121 Bacteria 5883
194 Ga0373962_0005477 3300035242 Bacteria 3071
195 Ga0373931_0001044 3300035691 Bacteria 11713
196 Ga0373933_0009449 3300035724 Bacteria 5326
197 Ga0373933_0014128 3300035724 Unclassified 4434
198 Ga0373937_0005443 3300036401 Bacteria 10902
199 Ga0373937_0101438 3300036401 Bacteria 2671
200 Ga0316584_0019046 3300036712 Bacteria 4958
201 Ga0373925_0027527 3300037068 Bacteria 4160
202 Ga0373925_0112156 3300037068 Bacteria 2108
203 Ga0395905_0035911 3300037471 Bacteria 4654
204 Ga0436361_0213400 3300039447 Bacteria 127007
205 Ga0436361_1129197 3300039447 Bacteria 10978
206 Ga0451577_0003152 3300042876 Bacteria 18570
207 Ga0466969_0000007 3300044656 Bacteria 152114
208 Ga0466969_0006692 3300044656 Bacteria 6128
209 Ga0466972_0003446 3300044658 Bacteria 7844
210 Ga0466965_0000837 3300044683 Bacteria 11634
211 Ga0466965_0004612 3300044683 Bacteria 6136
212 Ga0466966_0002746 3300044684 Bacteria 11557
213 Ga0466966_0033499 3300044684 Bacteria 3326
214 Ga0466961_0009730 3300044693 Bacteria 6119
215 Ga0466961_0075072 3300044693 Bacteria 2143
216 Ga0466963_0021792 3300044694 Bacteria 4047
217 Ga0466964_0011868 3300044706 Bacteria 3294
218 Ga0453684_0014438 3300044712 Bacteria 12636
219 Ga0453684_0016060 3300044712 Bacteria 11754
220 Ga0453684_0018003 3300044712 Bacteria 10879
221 Ga0466968_0038940 3300044735 Bacteria 1999
222 Ga0466970_0007737 3300044765 Bacteria 5391
223 Ga0466957_0007642 3300044842 Bacteria 6112
224 Ga0466957_0015800 3300044842 Bacteria 4410
225 Ga0466960_0006189 3300044901 Bacteria 4792
226 Ga0466959_0000197 3300045049 Bacteria 39640
227 Ga0466959_0003510 3300045049 Bacteria 10286
228 Ga0466959_0128596 3300045049 Bacteria 1796
229 Ga0451576_0022389 3300045051 Bacteria 6851
230 Ga0466958_0000192 3300045836 Bacteria 22331
231 Ga0466958_0016542 3300045836 Bacteria 4248
232 Ga0466967_0070675 3300045976 Bacteria 3123
233 Ga0466967_0089984 3300045976 Bacteria 2787
234 Ga0495585_0006000 3300046492 Bacteria 7602
235 Ga0495586_0016787 3300046535 Bacteria 3896
236 Ga0495587_0000365 3300046536 Bacteria 32561
237 Ga0495587_0000783 3300046536 Bacteria 21238
238 Ga0495623_0069508 3300046679 Unclassified 2195
239 Ga0495649_0021602 3300046694 Bacteria 3606
240 Ga0495604_0049228 3300047317 Bacteria 3276
241 Ga0495636_0022990 3300047318 Bacteria 2522
242 Ga0495674_0119398 3300047319 Bacteria 2228
243 Ga0495675_0002406 3300047444 Bacteria 11184
244 Ga0495684_0035246 3300047471 Unclassified 3838
245 Ga0495602_0000797 3300048088 Bacteria 30094
246 Ga0495602_0001840 3300048088 Bacteria 21222
247 Ga0501072_0071576 3300049588 Bacteria 2740
248 nmdc:mga07m45_2388_c2 3300050496 Bacteria 7804
249 Ga0500583_0017586 3300053092 Bacteria 2885
250 Ga0500641_0016638 3300053096 Bacteria 2741
251 Ga0500616_0000016 3300053153 Bacteria 627087
252 Ga0500622_0007138 3300053156 Bacteria 6375
253 Ga0466962_0006319 3300061719 Bacteria 5685

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044842 Ga0466957_0015800 Ga0466957_0015800_15_1265 413
2 3300044693 Ga0466961_0075072 Ga0466961_0075072_10_1275 418
3 3300005330 Ga0070690_100000471 Ga0070690_1000004713 430
4 3300005338 Ga0068868_100005204 Ga0068868_1000052043 430
5 3300005344 Ga0070661_100016060 Ga0070661_1000160603 430
6 3300005355 Ga0070671_100050593 Ga0070671_1000505932 430
7 3300005367 Ga0070667_100004308 Ga0070667_1000043082 430
8 3300005543 Ga0070672_100022074 Ga0070672_1000220742 430
9 3300005564 Ga0070664_100012376 Ga0070664_1000123763 430
10 3300005618 Ga0068864_100004651 Ga0068864_1000046516 430
11 3300005841 Ga0068863_100041143 Ga0068863_1000411433 430
12 3300025920 Ga0207649_10009492 Ga0207649_100094923 430
13 3300025925 Ga0207650_10014636 Ga0207650_100146362 430
14 3300025926 Ga0207659_10028091 Ga0207659_100280913 430
15 3300025931 Ga0207644_10005976 Ga0207644_100059766 430
16 3300025940 Ga0207691_10120329 Ga0207691_101203292 430
17 3300025945 Ga0207679_10006524 Ga0207679_100065242 430
18 3300025960 Ga0207651_10041326 Ga0207651_100413262 430
19 3300026023 Ga0207677_10018246 Ga0207677_100182463 430
20 3300026088 Ga0207641_10036701 Ga0207641_100367014 430
21 3300026095 Ga0207676_10006045 Ga0207676_100060455 430
22 3300009177 Ga0105248_10002685 Ga0105248_100026856 441
23 3300013306 Ga0163162_10018156 Ga0163162_100181563 441
24 3300013308 Ga0157375_10001860 Ga0157375_1000186013 441
25 3300014325 Ga0163163_10017306 Ga0163163_100173065 441
26 3300005444 Ga0070694_100132863 Ga0070694_1001328631 449
27 3300005615 Ga0070702_100070876 Ga0070702_1000708762 449
28 3300049588 Ga0501072_0071576 Ga0501072_0071576_29_1507 456
29 3300014325 Ga0163163_10001927 Ga0163163_1000192712 458
30 3300005354 Ga0070675_100002475 Ga0070675_1000024752 465
31 3300005467 Ga0070706_100001580 Ga0070706_1000015807 465
32 3300005468 Ga0070707_100000382 Ga0070707_10000038213 465
33 3300005471 Ga0070698_100000447 Ga0070698_10000044728 465
34 3300025910 Ga0207684_10001471 Ga0207684_1000147118 465
35 3300025922 Ga0207646_10000316 Ga0207646_1000031638 465
36 3300025926 Ga0207659_10008380 Ga0207659_100083803 465
37 3300047319 Ga0495674_0119398 Ga0495674_0119398_427_1899 473
38 3300031727 Ga0316576_10018009 Ga0316576_100180095 475
39 3300031727 Ga0316576_10028151 Ga0316576_100281512 475
40 3300031728 Ga0316578_10066088 Ga0316578_100660882 475
41 3300031733 Ga0316577_10039253 Ga0316577_100392532 475
42 3300036712 Ga0316584_0019046 Ga0316584_0019046_3444_4886 475
43 3300053156 Ga0500622_0007138 Ga0500622_0007138_3168_4679 477
44 iso_pu_bacteria 2786546940 2788435194 483
45 3300021361 Ga0213872_10000133 Ga0213872_100001332 484
46 3300031616 Ga0307508_10000894 Ga0307508_1000089412 484
47 3300031730 Ga0307516_10001117 Ga0307516_1000111723 484
48 3300035724 Ga0373933_0014128 Ga0373933_0014128_2468_3970 484
49 3300036401 Ga0373937_0005443 Ga0373937_0005443_1633_3135 484
50 3300039447 Ga0436361_0213400 Ga0436361_0213400_104572_106080 484
51 3300046536 Ga0495587_0000783 Ga0495587_0000783_11968_13470 484
52 3300046679 Ga0495623_0069508 Ga0495623_0069508_382_1884 484
53 3300047317 Ga0495604_0049228 Ga0495604_0049228_1483_2985 484
54 3300047444 Ga0495675_0002406 Ga0495675_0002406_6137_7639 484
55 3300048088 Ga0495602_0001840 Ga0495602_0001840_11968_13470 484
56 3300005434 Ga0070709_10002868 Ga0070709_100028682 485
57 3300005468 Ga0070707_100055899 Ga0070707_1000558994 485
58 3300007265 Ga0099794_10007226 Ga0099794_100072264 485
59 3300025922 Ga0207646_10016564 Ga0207646_100165647 485
60 3300044683 Ga0466965_0004612 Ga0466965_0004612_3650_5128 485
61 3300044684 Ga0466966_0002746 Ga0466966_0002746_1585_3063 485
62 3300044694 Ga0466963_0021792 Ga0466963_0021792_668_2146 485
63 3300044706 Ga0466964_0011868 Ga0466964_0011868_1053_2531 485
64 3300044712 Ga0453684_0016060 Ga0453684_0016060_1394_2887 485
65 3300045049 Ga0466959_0000197 Ga0466959_0000197_28935_30413 485
66 3300045836 Ga0466958_0000192 Ga0466958_0000192_10524_11993 485
67 3300045976 Ga0466967_0089984 Ga0466967_0089984_842_2320 485
68 3300005336 Ga0070680_100001590 Ga0070680_1000015902 486
69 3300005336 Ga0070680_100010054 Ga0070680_1000100545 486
70 3300005336 Ga0070680_100063228 Ga0070680_1000632282 486
71 3300005458 Ga0070681_10000641 Ga0070681_1000064114 486
72 3300005458 Ga0070681_10053739 Ga0070681_100537392 486
73 3300005458 Ga0070681_10136081 Ga0070681_101360812 486
74 3300005530 Ga0070679_100002952 Ga0070679_1000029524 486
75 3300005530 Ga0070679_100038146 Ga0070679_1000381464 486
76 3300005563 Ga0068855_100001881 Ga0068855_10000188120 486
77 3300005563 Ga0068855_100008034 Ga0068855_1000080344 486
78 3300009093 Ga0105240_10000988 Ga0105240_1000098816 486
79 3300009093 Ga0105240_10005726 Ga0105240_100057264 486
80 3300009551 Ga0105238_10000440 Ga0105238_1000044030 486
81 3300009551 Ga0105238_10023518 Ga0105238_100235184 486
82 3300009551 Ga0105238_10059728 Ga0105238_100597283 486
83 3300013104 Ga0157370_10001186 Ga0157370_100011865 486
84 3300013104 Ga0157370_10007395 Ga0157370_100073953 486
85 3300013105 Ga0157369_10003030 Ga0157369_100030307 486
86 3300013105 Ga0157369_10028389 Ga0157369_100283892 486
87 3300013307 Ga0157372_10021166 Ga0157372_100211662 486
88 3300025912 Ga0207707_10001261 Ga0207707_1000126116 486
89 3300025912 Ga0207707_10002139 Ga0207707_100021398 486
90 3300025912 Ga0207707_10010396 Ga0207707_100103962 486
91 3300025912 Ga0207707_10047791 Ga0207707_100477912 486
92 3300025913 Ga0207695_10015277 Ga0207695_100152773 486
93 3300025917 Ga0207660_10063218 Ga0207660_100632183 486
94 3300025921 Ga0207652_10013031 Ga0207652_100130314 486
95 3300025921 Ga0207652_10036867 Ga0207652_100368674 486
96 3300025924 Ga0207694_10023654 Ga0207694_100236544 486
97 3300025924 Ga0207694_10089226 Ga0207694_100892262 486
98 3300031711 Ga0265314_10006245 Ga0265314_100062455 486
99 3300044656 Ga0466969_0000007 Ga0466969_0000007_101767_103242 486
100 3300044683 Ga0466965_0000837 Ga0466965_0000837_477_1985 486
101 3300044735 Ga0466968_0038940 Ga0466968_0038940_240_1748 486
102 3300044765 Ga0466970_0007737 Ga0466970_0007737_3860_5368 486
103 3300044842 Ga0466957_0007642 Ga0466957_0007642_600_2108 486
104 3300045049 Ga0466959_0003510 Ga0466959_0003510_1008_2516 486
105 3300045836 Ga0466958_0016542 Ga0466958_0016542_2524_4032 486
106 3300046694 Ga0495649_0021602 Ga0495649_0021602_1252_2778 486
107 3300005329 Ga0070683_100018579 Ga0070683_1000185793 487
108 3300005335 Ga0070666_10001721 Ga0070666_100017215 487
109 3300005336 Ga0070680_100024178 Ga0070680_1000241782 487
110 3300005340 Ga0070689_100042713 Ga0070689_1000427131 487
111 3300005341 Ga0070691_10000546 Ga0070691_100005464 487
112 3300005367 Ga0070667_100018792 Ga0070667_1000187922 487
113 3300005440 Ga0070705_100021845 Ga0070705_1000218452 487
114 3300005458 Ga0070681_10040522 Ga0070681_100405222 487
115 3300005530 Ga0070679_100009314 Ga0070679_1000093144 487
116 3300005535 Ga0070684_100028518 Ga0070684_1000285182 487
117 3300005539 Ga0068853_100057450 Ga0068853_1000574501 487
118 3300005544 Ga0070686_100011119 Ga0070686_1000111194 487
119 3300005546 Ga0070696_100004748 Ga0070696_1000047482 487
120 3300005547 Ga0070693_100034394 Ga0070693_1000343942 487
121 3300005548 Ga0070665_100021321 Ga0070665_1000213214 487
122 3300005563 Ga0068855_100107327 Ga0068855_1001073273 487
123 3300005563 Ga0068855_100147368 Ga0068855_1001473682 487
124 3300005577 Ga0068857_100003164 Ga0068857_10000316411 487
125 3300005614 Ga0068856_100027729 Ga0068856_1000277293 487
126 3300005616 Ga0068852_100098829 Ga0068852_1000988292 487
127 3300005617 Ga0068859_100013487 Ga0068859_1000134875 487
128 3300005841 Ga0068863_100019259 Ga0068863_1000192597 487
129 3300005841 Ga0068863_100086927 Ga0068863_1000869272 487
130 3300005842 Ga0068858_100007485 Ga0068858_1000074854 487
131 3300005843 Ga0068860_100007347 Ga0068860_1000073475 487
132 3300005843 Ga0068860_100070551 Ga0068860_1000705512 487
133 3300006237 Ga0097621_100001377 Ga0097621_1000013775 487
134 3300006358 Ga0068871_100002455 Ga0068871_1000024556 487
135 3300006931 Ga0097620_100013485 Ga0097620_1000134852 487
136 3300009093 Ga0105240_10037519 Ga0105240_100375193 487
137 3300009094 Ga0111539_10016698 Ga0111539_100166982 487
138 3300009098 Ga0105245_10001386 Ga0105245_100013868 487
139 3300009098 Ga0105245_10165976 Ga0105245_101659762 487
140 3300009174 Ga0105241_10043773 Ga0105241_100437733 487
141 3300009176 Ga0105242_10016658 Ga0105242_100166585 487
142 3300009177 Ga0105248_10000285 Ga0105248_1000028530 487
143 3300009177 Ga0105248_10002160 Ga0105248_100021607 487
144 3300009545 Ga0105237_10004706 Ga0105237_1000470615 487
145 3300009551 Ga0105238_10034675 Ga0105238_100346754 487
146 3300009551 Ga0105238_10068397 Ga0105238_100683973 487
147 3300009553 Ga0105249_10030078 Ga0105249_100300782 487
148 3300009553 Ga0105249_10068605 Ga0105249_100686052 487
149 3300010375 Ga0105239_10047547 Ga0105239_100475472 487
150 3300010375 Ga0105239_10083934 Ga0105239_100839342 487
151 3300011119 Ga0105246_10013963 Ga0105246_100139633 487
152 3300013105 Ga0157369_10032477 Ga0157369_100324774 487
153 3300013105 Ga0157369_10051367 Ga0157369_100513673 487
154 3300013105 Ga0157369_10173712 Ga0157369_101737121 487
155 3300013105 Ga0157369_10270193 Ga0157369_102701932 487
156 3300013296 Ga0157374_10245069 Ga0157374_102450692 487
157 3300013297 Ga0157378_10192715 Ga0157378_101927152 487
158 3300013306 Ga0163162_10004440 Ga0163162_100044405 487
159 3300013306 Ga0163162_10054967 Ga0163162_100549673 487
160 3300013307 Ga0157372_10029585 Ga0157372_100295854 487
161 3300013308 Ga0157375_10034879 Ga0157375_100348794 487
162 3300014325 Ga0163163_10005474 Ga0163163_100054748 487
163 3300014325 Ga0163163_10011262 Ga0163163_100112622 487
164 3300014326 Ga0157380_10003691 Ga0157380_100036916 487
165 3300014969 Ga0157376_10002005 Ga0157376_100020058 487
166 3300025903 Ga0207680_10004109 Ga0207680_100041092 487
167 3300025911 Ga0207654_10008746 Ga0207654_100087464 487
168 3300025913 Ga0207695_10024484 Ga0207695_100244843 487
169 3300025913 Ga0207695_10038137 Ga0207695_100381372 487
170 3300025913 Ga0207695_10090422 Ga0207695_100904222 487
171 3300025919 Ga0207657_10117591 Ga0207657_101175912 487
172 3300025921 Ga0207652_10005591 Ga0207652_100055914 487
173 3300025924 Ga0207694_10009535 Ga0207694_100095356 487
174 3300025924 Ga0207694_10027240 Ga0207694_100272404 487
175 3300025926 Ga0207659_10063107 Ga0207659_100631072 487
176 3300025927 Ga0207687_10000286 Ga0207687_1000028626 487
177 3300025927 Ga0207687_10001535 Ga0207687_100015357 487
178 3300025928 Ga0207700_10013467 Ga0207700_100134674 487
179 3300025933 Ga0207706_10003584 Ga0207706_100035843 487
180 3300025936 Ga0207670_10004725 Ga0207670_100047256 487
181 3300025941 Ga0207711_10001660 Ga0207711_100016602 487
182 3300025941 Ga0207711_10053224 Ga0207711_100532242 487
183 3300025941 Ga0207711_10065777 Ga0207711_100657772 487
184 3300025942 Ga0207689_10090527 Ga0207689_100905272 487
185 3300025944 Ga0207661_10004643 Ga0207661_100046435 487
186 3300025944 Ga0207661_10016663 Ga0207661_100166634 487
187 3300025949 Ga0207667_10005465 Ga0207667_100054657 487
188 3300025949 Ga0207667_10070508 Ga0207667_100705082 487
189 3300025986 Ga0207658_10007777 Ga0207658_100077774 487
190 3300026023 Ga0207677_10006351 Ga0207677_100063515 487
191 3300026035 Ga0207703_10015049 Ga0207703_100150493 487
192 3300026041 Ga0207639_10117793 Ga0207639_101177931 487
193 3300026075 Ga0207708_10059932 Ga0207708_100599322 487
194 3300026116 Ga0207674_10001222 Ga0207674_1000122230 487
195 3300026142 Ga0207698_10131723 Ga0207698_101317232 487
196 3300027876 Ga0209974_10000950 Ga0209974_100009502 487
197 3300028573 Ga0265334_10004873 Ga0265334_100048734 487
198 3300028666 Ga0265336_10000061 Ga0265336_1000006188 487
199 3300028794 Ga0307515_10000048 Ga0307515_1000004831 487
200 3300028794 Ga0307515_10000080 Ga0307515_10000080177 487
201 3300028794 Ga0307515_10001430 Ga0307515_1000143020 487
202 3300028800 Ga0265338_10021836 Ga0265338_100218362 487
203 3300031241 Ga0265325_10001661 Ga0265325_1000166112 487
204 3300031247 Ga0265340_10019099 Ga0265340_100190991 487
205 3300031249 Ga0265339_10034856 Ga0265339_100348562 487
206 3300031595 Ga0265313_10001713 Ga0265313_100017136 487
207 3300031730 Ga0307516_10000124 Ga0307516_100001247 487
208 3300035086 Ga0373934_0002640 Ga0373934_0002640_2508_4004 487
209 3300035114 Ga0373939_0000044 Ga0373939_0000044_22396_23904 487
210 3300035121 Ga0373960_0001085 Ga0373960_0001085_1087_2595 487
211 3300035242 Ga0373962_0005477 Ga0373962_0005477_311_1819 487
212 3300035691 Ga0373931_0001044 Ga0373931_0001044_4390_5898 487
213 3300035724 Ga0373933_0009449 Ga0373933_0009449_1621_3120 487
214 3300036401 Ga0373937_0101438 Ga0373937_0101438_400_1899 487
215 3300037068 Ga0373925_0027527 Ga0373925_0027527_1808_3307 487
216 3300037068 Ga0373925_0112156 Ga0373925_0112156_213_1712 487
217 3300037471 Ga0395905_0035911 Ga0395905_0035911_2337_3812 487
218 3300042876 Ga0451577_0003152 Ga0451577_0003152_12109_13605 487
219 3300044656 Ga0466969_0006692 Ga0466969_0006692_3369_4883 487
220 3300044658 Ga0466972_0003446 Ga0466972_0003446_2999_4501 487
221 3300044684 Ga0466966_0033499 Ga0466966_0033499_847_2322 487
222 3300044693 Ga0466961_0009730 Ga0466961_0009730_2514_4028 487
223 3300044712 Ga0453684_0014438 Ga0453684_0014438_3816_5300 487
224 3300044712 Ga0453684_0018003 Ga0453684_0018003_5764_7272 487
225 3300044901 Ga0466960_0006189 Ga0466960_0006189_64_1539 487
226 3300045049 Ga0466959_0128596 Ga0466959_0128596_114_1589 487
227 3300045051 Ga0451576_0022389 Ga0451576_0022389_162_1655 487
228 3300046535 Ga0495586_0016787 Ga0495586_0016787_1787_3286 487
229 3300046536 Ga0495587_0000365 Ga0495587_0000365_16534_18033 487
230 3300047318 Ga0495636_0022990 Ga0495636_0022990_727_2229 487
231 3300047471 Ga0495684_0035246 Ga0495684_0035246_1402_2898 487
232 3300048088 Ga0495602_0000797 Ga0495602_0000797_27909_29408 487
233 3300053092 Ga0500583_0017586 Ga0500583_0017586_1270_2760 487
234 3300053096 Ga0500641_0016638 Ga0500641_0016638_1087_2565 487
235 3300053153 Ga0500616_0000016 Ga0500616_0000016_464196_465674 487
236 3300061719 Ga0466962_0006319 Ga0466962_0006319_3117_4631 487
237 3300045976 Ga0466967_0070675 Ga0466967_0070675_675_2195 488
238 3300028666 Ga0265336_10000087 Ga0265336_1000008749 489
239 3300039447 Ga0436361_1129197 Ga0436361_1129197_7953_9506 490
240 3300003752 Ga0055539_1000166 Ga0055539_100016611 491
241 3300003756 Ga0055533_1000087 Ga0055533_1000087111 491
242 3300003759 Ga0055525_1000674 Ga0055525_10006744 491
243 3300005336 Ga0070680_100060166 Ga0070680_1000601662 491
244 3300025226 Ga0209674_100088 Ga0209674_10008863 491
245 3300025230 Ga0209563_100140 Ga0209563_10014011 491
246 3300025253 Ga0209677_100095 Ga0209677_10009587 491
247 3300005563 Ga0068855_100001365 Ga0068855_10000136518 492
248 3300006353 Ga0075370_10005521 Ga0075370_100055213 492
249 3300009093 Ga0105240_10082843 Ga0105240_100828431 492
250 3300025949 Ga0207667_10021788 Ga0207667_100217882 492
251 3300050496 nmdc:mga07m45_2388_c2 nmdc:mga07m45_2388_c2_3230_4759 492
252 3300003203 JGI25406J46586_10004888 JGI25406J46586_100048885 494
253 3300005985 Ga0081539_10000016 Ga0081539_10000016282 494
254 3300046492 Ga0495585_0006000 Ga0495585_0006000_2775_4334 494

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00128

Alpha-amylase

Alpha amylase, catalytic domain

42

257

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mb2-assembly1.cif.gz_B structure of sucrose phosphorylase from bifidobacterium adolescentis bound to nigerose 0.968 1 488
5man-assembly1.cif.gz_B structure of sucrose phosphorylase from bifidobacterium adolescentis bound to nigerose 0.962 1 494
5man-assembly1.cif.gz_B structure of sucrose phosphorylase from bifidobacterium adolescentis bound to nigerose 0.9601 1 494
2gdu-assembly1.cif.gz_B e232q mutant of sucrose phosphorylase from bifidobacterium adolescentis in complex with sucrose 0.9574 1 492
1r7a-assembly1.cif.gz_A sucrose phosphorylase from bifidobacterium adolescentis 0.9553 1 492
ID Description Score Start End Superfamily
5m9xB02 Alpha Beta;Alpha-Beta Complex;Oligo-1,6-glucosidase; domain 2;Oligo-1,6-glucosidase; Domain 2 0.9738 85 166 3.90.400.10
5m9xB02 Alpha Beta;Alpha-Beta Complex;Oligo-1,6-glucosidase; domain 2;Oligo-1,6-glucosidase; Domain 2 0.9622 85 166 3.90.400.10
2gdvA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9588 1 433 3.20.20.80
2gdvA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9561 1 433 3.20.20.80
af_P76041_133_205_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.8496 87 168 3.20.20.80
ID Description Score Start End GO Terms
AF-A0A3D2CT35-F1-model_v4 Sucrose phosphorylase 0.9812 1 293 GO:0005975
GO:0016740
AF-A0A060CGZ2-F1-model_v4 CAZy families GH13 protein 0.9807 154 321
AF-A0A060CR62-F1-model_v4 CAZy families GH13 protein 0.9802 213 374
AF-A0A3N5PN33-F1-model_v4 Sucrose phosphorylase 0.9801 1 289
AF-A0A520BHA1-F1-model_v4 Sucrose phosphorylase 0.9787 132 489 GO:0016740

Feature Viewer

pLDDT pTM Quality
91.17 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map