F365144
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 254 | 168 | 253 | 491 |
Family's Representative Sequence
| Representative Sequence | 3300046492|Ga0495585_0006000|Ga0495585_0006000_2775_4334 |
| Length | 519 |
| Sequence | MPDLLANRPMKNQVQLITYVDRLSGGGLPELRALLEGPLAGVFGGVHLLPFFDPIDGADAGFDPVDHTSVDARLGSWDDVRAIASVIDVMADVIVNHMSADSPQFKDYLATGRRSRHDGLFLTFDKVFPDGASERDLLAVYRPRPGLPLRTTTFADGERRLLWSTFTSHQVDIDVEHPAGRAYLEGILDRLAASAVRMVRLDAVGYALKTAGTSCFMTPDTFRFIEQFAGDARSRGMEVLVEVHSHYSKQIEIAERVDWVYDFALPPLLLHAFAFGSAEALRQWIEIRPNNSLTVLDTHDGIGIIDIGADAADRDARPGLVPPDELDRLVEIIHENSRGESRRATGAAASNLDLYQVNCTYYDALGRNDVAYLLARAIQLFLPGIPQVYYVGLLAGENDMVLLAETAVGRDINRHRYGPGEAQAALAKPAVRELVRLIRLRNEFPAFSGCFRSAPAEPRRIDLQWSLGAHAARLVVDFRTLDYSLTLDTPEGRHSHRFELAPSAAPTAPEAAAVTDPPF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2786546940 | Opitutaceae bacterium EW11 | Isolate | Unclassified |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 4 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 5 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 44 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 46 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 47 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 49 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 71 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 110 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 111 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 112 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 113 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 114 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 115 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 116 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 117 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 118 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 119 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 120 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 121 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 122 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 123 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 124 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 125 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 126 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 127 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 128 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 129 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 130 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 131 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 132 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 133 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 134 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 135 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 136 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 137 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 138 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 139 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 140 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 141 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 142 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 143 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 144 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 145 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 146 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 147 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 148 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 149 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 150 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 151 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 164 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 165 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 166 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 167 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 168 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.61 |
| Metatranscriptomes | 0 |
| Isolates | 0.39 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.72 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 92.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10004888 | 3300003203 | Bacteria | 6228 |
| 2 | Ga0055539_1000166 | 3300003752 | Bacteria | 59517 |
| 3 | Ga0055533_1000087 | 3300003756 | Bacteria | 122417 |
| 4 | Ga0055525_1000674 | 3300003759 | Bacteria | 13065 |
| 5 | Ga0070683_100018579 | 3300005329 | Bacteria | 6162 |
| 6 | Ga0070690_100000471 | 3300005330 | Bacteria | 20213 |
| 7 | Ga0070666_10001721 | 3300005335 | Bacteria | 13341 |
| 8 | Ga0070680_100001590 | 3300005336 | Bacteria | 16586 |
| 9 | Ga0070680_100010054 | 3300005336 | Bacteria | 7290 |
| 10 | Ga0070680_100024178 | 3300005336 | Bacteria | 4848 |
| 11 | Ga0070680_100060166 | 3300005336 | Bacteria | 3108 |
| 12 | Ga0070680_100063228 | 3300005336 | Bacteria | 3031 |
| 13 | Ga0068868_100005204 | 3300005338 | Bacteria | 9131 |
| 14 | Ga0070689_100042713 | 3300005340 | Bacteria | 3481 |
| 15 | Ga0070691_10000546 | 3300005341 | Bacteria | 14269 |
| 16 | Ga0070661_100016060 | 3300005344 | Bacteria | 5284 |
| 17 | Ga0070675_100002475 | 3300005354 | Bacteria | 13826 |
| 18 | Ga0070671_100050593 | 3300005355 | Bacteria | 3455 |
| 19 | Ga0070667_100004308 | 3300005367 | Bacteria | 12011 |
| 20 | Ga0070667_100018792 | 3300005367 | Bacteria | 5732 |
| 21 | Ga0070709_10002868 | 3300005434 | Bacteria | 9306 |
| 22 | Ga0070705_100021845 | 3300005440 | Bacteria | 3410 |
| 23 | Ga0070694_100132863 | 3300005444 | Bacteria | 1800 |
| 24 | Ga0070681_10000641 | 3300005458 | Bacteria | 28787 |
| 25 | Ga0070681_10040522 | 3300005458 | Bacteria | 4666 |
| 26 | Ga0070681_10053739 | 3300005458 | Bacteria | 4013 |
| 27 | Ga0070681_10136081 | 3300005458 | Bacteria | 2387 |
| 28 | Ga0070706_100001580 | 3300005467 | Bacteria | 23764 |
| 29 | Ga0070707_100000382 | 3300005468 | Bacteria | 43641 |
| 30 | Ga0070707_100055899 | 3300005468 | Bacteria | 3784 |
| 31 | Ga0070698_100000447 | 3300005471 | Bacteria | 43804 |
| 32 | Ga0070679_100002952 | 3300005530 | Bacteria | 15499 |
| 33 | Ga0070679_100009314 | 3300005530 | Bacteria | 9284 |
| 34 | Ga0070679_100038146 | 3300005530 | Bacteria | 4776 |
| 35 | Ga0070684_100028518 | 3300005535 | Bacteria | 4723 |
| 36 | Ga0068853_100057450 | 3300005539 | Bacteria | 3358 |
| 37 | Ga0070672_100022074 | 3300005543 | Bacteria | 4668 |
| 38 | Ga0070686_100011119 | 3300005544 | Bacteria | 5099 |
| 39 | Ga0070696_100004748 | 3300005546 | Bacteria | 9076 |
| 40 | Ga0070693_100034394 | 3300005547 | Bacteria | 2804 |
| 41 | Ga0070665_100021321 | 3300005548 | Bacteria | 6517 |
| 42 | Ga0068855_100001365 | 3300005563 | Bacteria | 30241 |
| 43 | Ga0068855_100001881 | 3300005563 | Bacteria | 26066 |
| 44 | Ga0068855_100008034 | 3300005563 | Bacteria | 12748 |
| 45 | Ga0068855_100107327 | 3300005563 | Unclassified | 3208 |
| 46 | Ga0068855_100147368 | 3300005563 | Bacteria | 2678 |
| 47 | Ga0070664_100012376 | 3300005564 | Bacteria | 6934 |
| 48 | Ga0068857_100003164 | 3300005577 | Bacteria | 13655 |
| 49 | Ga0068856_100027729 | 3300005614 | Bacteria | 5525 |
| 50 | Ga0070702_100070876 | 3300005615 | Bacteria | 2058 |
| 51 | Ga0068852_100098829 | 3300005616 | Unclassified | 2629 |
| 52 | Ga0068859_100013487 | 3300005617 | Bacteria | 8195 |
| 53 | Ga0068864_100004651 | 3300005618 | Bacteria | 11256 |
| 54 | Ga0068863_100019259 | 3300005841 | Bacteria | 6529 |
| 55 | Ga0068863_100041143 | 3300005841 | Bacteria | 4393 |
| 56 | Ga0068863_100086927 | 3300005841 | Bacteria | 2963 |
| 57 | Ga0068858_100007485 | 3300005842 | Bacteria | 10555 |
| 58 | Ga0068860_100007347 | 3300005843 | Bacteria | 11014 |
| 59 | Ga0068860_100070551 | 3300005843 | Bacteria | 3322 |
| 60 | Ga0081539_10000016 | 3300005985 | Bacteria | 381648 |
| 61 | Ga0097621_100001377 | 3300006237 | Bacteria | 16719 |
| 62 | Ga0075370_10005521 | 3300006353 | Bacteria | 6298 |
| 63 | Ga0068871_100002455 | 3300006358 | Bacteria | 12658 |
| 64 | Ga0097620_100013485 | 3300006931 | Bacteria | 8195 |
| 65 | Ga0099794_10007226 | 3300007265 | Bacteria | 4548 |
| 66 | Ga0105240_10000988 | 3300009093 | Bacteria | 50723 |
| 67 | Ga0105240_10005726 | 3300009093 | Bacteria | 18435 |
| 68 | Ga0105240_10037519 | 3300009093 | Bacteria | 6227 |
| 69 | Ga0105240_10082843 | 3300009093 | Bacteria | 3939 |
| 70 | Ga0111539_10016698 | 3300009094 | Bacteria | 9097 |
| 71 | Ga0105245_10001386 | 3300009098 | Bacteria | 21950 |
| 72 | Ga0105245_10165976 | 3300009098 | Bacteria | 2099 |
| 73 | Ga0105241_10043773 | 3300009174 | Bacteria | 3391 |
| 74 | Ga0105242_10016658 | 3300009176 | Bacteria | 5717 |
| 75 | Ga0105248_10000285 | 3300009177 | Bacteria | 59638 |
| 76 | Ga0105248_10002160 | 3300009177 | Bacteria | 21759 |
| 77 | Ga0105248_10002685 | 3300009177 | Bacteria | 19760 |
| 78 | Ga0105237_10004706 | 3300009545 | Bacteria | 15702 |
| 79 | Ga0105238_10000440 | 3300009551 | Bacteria | 43764 |
| 80 | Ga0105238_10023518 | 3300009551 | Bacteria | 6280 |
| 81 | Ga0105238_10034675 | 3300009551 | Bacteria | 5134 |
| 82 | Ga0105238_10059728 | 3300009551 | Bacteria | 3819 |
| 83 | Ga0105238_10068397 | 3300009551 | Unclassified | 3553 |
| 84 | Ga0105249_10030078 | 3300009553 | Bacteria | 4907 |
| 85 | Ga0105249_10068605 | 3300009553 | Unclassified | 3271 |
| 86 | Ga0105239_10047547 | 3300010375 | Bacteria | 4703 |
| 87 | Ga0105239_10083934 | 3300010375 | Unclassified | 3508 |
| 88 | Ga0105246_10013963 | 3300011119 | Bacteria | 5043 |
| 89 | Ga0157370_10001186 | 3300013104 | Bacteria | 32487 |
| 90 | Ga0157370_10007395 | 3300013104 | Bacteria | 11962 |
| 91 | Ga0157369_10003030 | 3300013105 | Bacteria | 20057 |
| 92 | Ga0157369_10028389 | 3300013105 | Bacteria | 6192 |
| 93 | Ga0157369_10032477 | 3300013105 | Bacteria | 5740 |
| 94 | Ga0157369_10051367 | 3300013105 | Bacteria | 4461 |
| 95 | Ga0157369_10173712 | 3300013105 | Bacteria | 2269 |
| 96 | Ga0157369_10270193 | 3300013105 | Bacteria | 1772 |
| 97 | Ga0157374_10245069 | 3300013296 | Bacteria | 1763 |
| 98 | Ga0157378_10192715 | 3300013297 | Bacteria | 1924 |
| 99 | Ga0163162_10004440 | 3300013306 | Bacteria | 13505 |
| 100 | Ga0163162_10018156 | 3300013306 | Bacteria | 6888 |
| 101 | Ga0163162_10054967 | 3300013306 | Bacteria | 4006 |
| 102 | Ga0157372_10021166 | 3300013307 | Bacteria | 7025 |
| 103 | Ga0157372_10029585 | 3300013307 | Bacteria | 5983 |
| 104 | Ga0157375_10001860 | 3300013308 | Bacteria | 18170 |
| 105 | Ga0157375_10034879 | 3300013308 | Bacteria | 4797 |
| 106 | Ga0163163_10001927 | 3300014325 | Bacteria | 17574 |
| 107 | Ga0163163_10005474 | 3300014325 | Bacteria | 10980 |
| 108 | Ga0163163_10011262 | 3300014325 | Bacteria | 8105 |
| 109 | Ga0163163_10017306 | 3300014325 | Bacteria | 6721 |
| 110 | Ga0157380_10003691 | 3300014326 | Bacteria | 10533 |
| 111 | Ga0157376_10002005 | 3300014969 | Bacteria | 13646 |
| 112 | Ga0213872_10000133 | 3300021361 | Bacteria | 67595 |
| 113 | Ga0209674_100088 | 3300025226 | Bacteria | 181554 |
| 114 | Ga0209563_100140 | 3300025230 | Bacteria | 81213 |
| 115 | Ga0209677_100095 | 3300025253 | Bacteria | 100330 |
| 116 | Ga0207680_10004109 | 3300025903 | Bacteria | 6884 |
| 117 | Ga0207684_10001471 | 3300025910 | Bacteria | 25348 |
| 118 | Ga0207654_10008746 | 3300025911 | Bacteria | 5133 |
| 119 | Ga0207707_10001261 | 3300025912 | Bacteria | 23696 |
| 120 | Ga0207707_10002139 | 3300025912 | Bacteria | 17896 |
| 121 | Ga0207707_10010396 | 3300025912 | Bacteria | 8076 |
| 122 | Ga0207707_10047791 | 3300025912 | Bacteria | 3726 |
| 123 | Ga0207695_10015277 | 3300025913 | Bacteria | 9050 |
| 124 | Ga0207695_10024484 | 3300025913 | Bacteria | 6791 |
| 125 | Ga0207695_10038137 | 3300025913 | Bacteria | 5178 |
| 126 | Ga0207695_10090422 | 3300025913 | Unclassified | 3077 |
| 127 | Ga0207660_10063218 | 3300025917 | Bacteria | 2668 |
| 128 | Ga0207657_10117591 | 3300025919 | Bacteria | 2189 |
| 129 | Ga0207649_10009492 | 3300025920 | Bacteria | 5326 |
| 130 | Ga0207652_10005591 | 3300025921 | Bacteria | 10192 |
| 131 | Ga0207652_10013031 | 3300025921 | Bacteria | 6730 |
| 132 | Ga0207652_10036867 | 3300025921 | Bacteria | 4135 |
| 133 | Ga0207646_10000316 | 3300025922 | Bacteria | 65456 |
| 134 | Ga0207646_10016564 | 3300025922 | Bacteria | 6916 |
| 135 | Ga0207694_10009535 | 3300025924 | Bacteria | 7322 |
| 136 | Ga0207694_10023654 | 3300025924 | Unclassified | 4665 |
| 137 | Ga0207694_10027240 | 3300025924 | Bacteria | 4351 |
| 138 | Ga0207694_10089226 | 3300025924 | Bacteria | 2431 |
| 139 | Ga0207650_10014636 | 3300025925 | Bacteria | 5448 |
| 140 | Ga0207659_10008380 | 3300025926 | Bacteria | 6412 |
| 141 | Ga0207659_10028091 | 3300025926 | Bacteria | 3818 |
| 142 | Ga0207659_10063107 | 3300025926 | Unclassified | 2677 |
| 143 | Ga0207687_10000286 | 3300025927 | Bacteria | 34802 |
| 144 | Ga0207687_10001535 | 3300025927 | Bacteria | 15845 |
| 145 | Ga0207700_10013467 | 3300025928 | Bacteria | 5324 |
| 146 | Ga0207644_10005976 | 3300025931 | Bacteria | 7933 |
| 147 | Ga0207706_10003584 | 3300025933 | Bacteria | 14827 |
| 148 | Ga0207670_10004725 | 3300025936 | Bacteria | 7385 |
| 149 | Ga0207691_10120329 | 3300025940 | Bacteria | 2328 |
| 150 | Ga0207711_10001660 | 3300025941 | Bacteria | 20530 |
| 151 | Ga0207711_10053224 | 3300025941 | Bacteria | 3471 |
| 152 | Ga0207711_10065777 | 3300025941 | Bacteria | 3134 |
| 153 | Ga0207689_10090527 | 3300025942 | Bacteria | 2514 |
| 154 | Ga0207661_10004643 | 3300025944 | Bacteria | 9622 |
| 155 | Ga0207661_10016663 | 3300025944 | Bacteria | 5423 |
| 156 | Ga0207679_10006524 | 3300025945 | Bacteria | 7377 |
| 157 | Ga0207667_10005465 | 3300025949 | Bacteria | 15491 |
| 158 | Ga0207667_10021788 | 3300025949 | Bacteria | 7095 |
| 159 | Ga0207667_10070508 | 3300025949 | Unclassified | 3637 |
| 160 | Ga0207651_10041326 | 3300025960 | Bacteria | 3060 |
| 161 | Ga0207658_10007777 | 3300025986 | Bacteria | 7306 |
| 162 | Ga0207677_10006351 | 3300026023 | Bacteria | 6479 |
| 163 | Ga0207677_10018246 | 3300026023 | Bacteria | 4207 |
| 164 | Ga0207703_10015049 | 3300026035 | Bacteria | 6039 |
| 165 | Ga0207639_10117793 | 3300026041 | Bacteria | 2177 |
| 166 | Ga0207708_10059932 | 3300026075 | Bacteria | 2906 |
| 167 | Ga0207641_10036701 | 3300026088 | Bacteria | 4091 |
| 168 | Ga0207676_10006045 | 3300026095 | Bacteria | 8538 |
| 169 | Ga0207674_10001222 | 3300026116 | Bacteria | 33473 |
| 170 | Ga0207698_10131723 | 3300026142 | Unclassified | 2138 |
| 171 | Ga0209974_10000950 | 3300027876 | Bacteria | 10142 |
| 172 | Ga0265334_10004873 | 3300028573 | Bacteria | 5900 |
| 173 | Ga0265336_10000061 | 3300028666 | Bacteria | 102829 |
| 174 | Ga0265336_10000087 | 3300028666 | Bacteria | 72636 |
| 175 | Ga0307515_10000048 | 3300028794 | Bacteria | 288111 |
| 176 | Ga0307515_10000080 | 3300028794 | Bacteria | 224941 |
| 177 | Ga0307515_10001430 | 3300028794 | Bacteria | 53972 |
| 178 | Ga0265338_10021836 | 3300028800 | Bacteria | 6652 |
| 179 | Ga0265325_10001661 | 3300031241 | Bacteria | 15473 |
| 180 | Ga0265340_10019099 | 3300031247 | Unclassified | 3529 |
| 181 | Ga0265339_10034856 | 3300031249 | Bacteria | 2826 |
| 182 | Ga0265313_10001713 | 3300031595 | Bacteria | 20198 |
| 183 | Ga0307508_10000894 | 3300031616 | Bacteria | 34741 |
| 184 | Ga0265314_10006245 | 3300031711 | Bacteria | 10581 |
| 185 | Ga0316576_10018009 | 3300031727 | Bacteria | 4813 |
| 186 | Ga0316576_10028151 | 3300031727 | Bacteria | 3958 |
| 187 | Ga0316578_10066088 | 3300031728 | Bacteria | 2136 |
| 188 | Ga0307516_10000124 | 3300031730 | Bacteria | 90831 |
| 189 | Ga0307516_10001117 | 3300031730 | Bacteria | 37423 |
| 190 | Ga0316577_10039253 | 3300031733 | Bacteria | 2649 |
| 191 | Ga0373934_0002640 | 3300035086 | Bacteria | 6589 |
| 192 | Ga0373939_0000044 | 3300035114 | Bacteria | 44944 |
| 193 | Ga0373960_0001085 | 3300035121 | Bacteria | 5883 |
| 194 | Ga0373962_0005477 | 3300035242 | Bacteria | 3071 |
| 195 | Ga0373931_0001044 | 3300035691 | Bacteria | 11713 |
| 196 | Ga0373933_0009449 | 3300035724 | Bacteria | 5326 |
| 197 | Ga0373933_0014128 | 3300035724 | Unclassified | 4434 |
| 198 | Ga0373937_0005443 | 3300036401 | Bacteria | 10902 |
| 199 | Ga0373937_0101438 | 3300036401 | Bacteria | 2671 |
| 200 | Ga0316584_0019046 | 3300036712 | Bacteria | 4958 |
| 201 | Ga0373925_0027527 | 3300037068 | Bacteria | 4160 |
| 202 | Ga0373925_0112156 | 3300037068 | Bacteria | 2108 |
| 203 | Ga0395905_0035911 | 3300037471 | Bacteria | 4654 |
| 204 | Ga0436361_0213400 | 3300039447 | Bacteria | 127007 |
| 205 | Ga0436361_1129197 | 3300039447 | Bacteria | 10978 |
| 206 | Ga0451577_0003152 | 3300042876 | Bacteria | 18570 |
| 207 | Ga0466969_0000007 | 3300044656 | Bacteria | 152114 |
| 208 | Ga0466969_0006692 | 3300044656 | Bacteria | 6128 |
| 209 | Ga0466972_0003446 | 3300044658 | Bacteria | 7844 |
| 210 | Ga0466965_0000837 | 3300044683 | Bacteria | 11634 |
| 211 | Ga0466965_0004612 | 3300044683 | Bacteria | 6136 |
| 212 | Ga0466966_0002746 | 3300044684 | Bacteria | 11557 |
| 213 | Ga0466966_0033499 | 3300044684 | Bacteria | 3326 |
| 214 | Ga0466961_0009730 | 3300044693 | Bacteria | 6119 |
| 215 | Ga0466961_0075072 | 3300044693 | Bacteria | 2143 |
| 216 | Ga0466963_0021792 | 3300044694 | Bacteria | 4047 |
| 217 | Ga0466964_0011868 | 3300044706 | Bacteria | 3294 |
| 218 | Ga0453684_0014438 | 3300044712 | Bacteria | 12636 |
| 219 | Ga0453684_0016060 | 3300044712 | Bacteria | 11754 |
| 220 | Ga0453684_0018003 | 3300044712 | Bacteria | 10879 |
| 221 | Ga0466968_0038940 | 3300044735 | Bacteria | 1999 |
| 222 | Ga0466970_0007737 | 3300044765 | Bacteria | 5391 |
| 223 | Ga0466957_0007642 | 3300044842 | Bacteria | 6112 |
| 224 | Ga0466957_0015800 | 3300044842 | Bacteria | 4410 |
| 225 | Ga0466960_0006189 | 3300044901 | Bacteria | 4792 |
| 226 | Ga0466959_0000197 | 3300045049 | Bacteria | 39640 |
| 227 | Ga0466959_0003510 | 3300045049 | Bacteria | 10286 |
| 228 | Ga0466959_0128596 | 3300045049 | Bacteria | 1796 |
| 229 | Ga0451576_0022389 | 3300045051 | Bacteria | 6851 |
| 230 | Ga0466958_0000192 | 3300045836 | Bacteria | 22331 |
| 231 | Ga0466958_0016542 | 3300045836 | Bacteria | 4248 |
| 232 | Ga0466967_0070675 | 3300045976 | Bacteria | 3123 |
| 233 | Ga0466967_0089984 | 3300045976 | Bacteria | 2787 |
| 234 | Ga0495585_0006000 | 3300046492 | Bacteria | 7602 |
| 235 | Ga0495586_0016787 | 3300046535 | Bacteria | 3896 |
| 236 | Ga0495587_0000365 | 3300046536 | Bacteria | 32561 |
| 237 | Ga0495587_0000783 | 3300046536 | Bacteria | 21238 |
| 238 | Ga0495623_0069508 | 3300046679 | Unclassified | 2195 |
| 239 | Ga0495649_0021602 | 3300046694 | Bacteria | 3606 |
| 240 | Ga0495604_0049228 | 3300047317 | Bacteria | 3276 |
| 241 | Ga0495636_0022990 | 3300047318 | Bacteria | 2522 |
| 242 | Ga0495674_0119398 | 3300047319 | Bacteria | 2228 |
| 243 | Ga0495675_0002406 | 3300047444 | Bacteria | 11184 |
| 244 | Ga0495684_0035246 | 3300047471 | Unclassified | 3838 |
| 245 | Ga0495602_0000797 | 3300048088 | Bacteria | 30094 |
| 246 | Ga0495602_0001840 | 3300048088 | Bacteria | 21222 |
| 247 | Ga0501072_0071576 | 3300049588 | Bacteria | 2740 |
| 248 | nmdc:mga07m45_2388_c2 | 3300050496 | Bacteria | 7804 |
| 249 | Ga0500583_0017586 | 3300053092 | Bacteria | 2885 |
| 250 | Ga0500641_0016638 | 3300053096 | Bacteria | 2741 |
| 251 | Ga0500616_0000016 | 3300053153 | Bacteria | 627087 |
| 252 | Ga0500622_0007138 | 3300053156 | Bacteria | 6375 |
| 253 | Ga0466962_0006319 | 3300061719 | Bacteria | 5685 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044842 | Ga0466957_0015800 | Ga0466957_0015800_15_1265 | 413 |
| 2 | 3300044693 | Ga0466961_0075072 | Ga0466961_0075072_10_1275 | 418 |
| 3 | 3300005330 | Ga0070690_100000471 | Ga0070690_1000004713 | 430 |
| 4 | 3300005338 | Ga0068868_100005204 | Ga0068868_1000052043 | 430 |
| 5 | 3300005344 | Ga0070661_100016060 | Ga0070661_1000160603 | 430 |
| 6 | 3300005355 | Ga0070671_100050593 | Ga0070671_1000505932 | 430 |
| 7 | 3300005367 | Ga0070667_100004308 | Ga0070667_1000043082 | 430 |
| 8 | 3300005543 | Ga0070672_100022074 | Ga0070672_1000220742 | 430 |
| 9 | 3300005564 | Ga0070664_100012376 | Ga0070664_1000123763 | 430 |
| 10 | 3300005618 | Ga0068864_100004651 | Ga0068864_1000046516 | 430 |
| 11 | 3300005841 | Ga0068863_100041143 | Ga0068863_1000411433 | 430 |
| 12 | 3300025920 | Ga0207649_10009492 | Ga0207649_100094923 | 430 |
| 13 | 3300025925 | Ga0207650_10014636 | Ga0207650_100146362 | 430 |
| 14 | 3300025926 | Ga0207659_10028091 | Ga0207659_100280913 | 430 |
| 15 | 3300025931 | Ga0207644_10005976 | Ga0207644_100059766 | 430 |
| 16 | 3300025940 | Ga0207691_10120329 | Ga0207691_101203292 | 430 |
| 17 | 3300025945 | Ga0207679_10006524 | Ga0207679_100065242 | 430 |
| 18 | 3300025960 | Ga0207651_10041326 | Ga0207651_100413262 | 430 |
| 19 | 3300026023 | Ga0207677_10018246 | Ga0207677_100182463 | 430 |
| 20 | 3300026088 | Ga0207641_10036701 | Ga0207641_100367014 | 430 |
| 21 | 3300026095 | Ga0207676_10006045 | Ga0207676_100060455 | 430 |
| 22 | 3300009177 | Ga0105248_10002685 | Ga0105248_100026856 | 441 |
| 23 | 3300013306 | Ga0163162_10018156 | Ga0163162_100181563 | 441 |
| 24 | 3300013308 | Ga0157375_10001860 | Ga0157375_1000186013 | 441 |
| 25 | 3300014325 | Ga0163163_10017306 | Ga0163163_100173065 | 441 |
| 26 | 3300005444 | Ga0070694_100132863 | Ga0070694_1001328631 | 449 |
| 27 | 3300005615 | Ga0070702_100070876 | Ga0070702_1000708762 | 449 |
| 28 | 3300049588 | Ga0501072_0071576 | Ga0501072_0071576_29_1507 | 456 |
| 29 | 3300014325 | Ga0163163_10001927 | Ga0163163_1000192712 | 458 |
| 30 | 3300005354 | Ga0070675_100002475 | Ga0070675_1000024752 | 465 |
| 31 | 3300005467 | Ga0070706_100001580 | Ga0070706_1000015807 | 465 |
| 32 | 3300005468 | Ga0070707_100000382 | Ga0070707_10000038213 | 465 |
| 33 | 3300005471 | Ga0070698_100000447 | Ga0070698_10000044728 | 465 |
| 34 | 3300025910 | Ga0207684_10001471 | Ga0207684_1000147118 | 465 |
| 35 | 3300025922 | Ga0207646_10000316 | Ga0207646_1000031638 | 465 |
| 36 | 3300025926 | Ga0207659_10008380 | Ga0207659_100083803 | 465 |
| 37 | 3300047319 | Ga0495674_0119398 | Ga0495674_0119398_427_1899 | 473 |
| 38 | 3300031727 | Ga0316576_10018009 | Ga0316576_100180095 | 475 |
| 39 | 3300031727 | Ga0316576_10028151 | Ga0316576_100281512 | 475 |
| 40 | 3300031728 | Ga0316578_10066088 | Ga0316578_100660882 | 475 |
| 41 | 3300031733 | Ga0316577_10039253 | Ga0316577_100392532 | 475 |
| 42 | 3300036712 | Ga0316584_0019046 | Ga0316584_0019046_3444_4886 | 475 |
| 43 | 3300053156 | Ga0500622_0007138 | Ga0500622_0007138_3168_4679 | 477 |
| 44 | iso_pu_bacteria | 2786546940 | 2788435194 | 483 |
| 45 | 3300021361 | Ga0213872_10000133 | Ga0213872_100001332 | 484 |
| 46 | 3300031616 | Ga0307508_10000894 | Ga0307508_1000089412 | 484 |
| 47 | 3300031730 | Ga0307516_10001117 | Ga0307516_1000111723 | 484 |
| 48 | 3300035724 | Ga0373933_0014128 | Ga0373933_0014128_2468_3970 | 484 |
| 49 | 3300036401 | Ga0373937_0005443 | Ga0373937_0005443_1633_3135 | 484 |
| 50 | 3300039447 | Ga0436361_0213400 | Ga0436361_0213400_104572_106080 | 484 |
| 51 | 3300046536 | Ga0495587_0000783 | Ga0495587_0000783_11968_13470 | 484 |
| 52 | 3300046679 | Ga0495623_0069508 | Ga0495623_0069508_382_1884 | 484 |
| 53 | 3300047317 | Ga0495604_0049228 | Ga0495604_0049228_1483_2985 | 484 |
| 54 | 3300047444 | Ga0495675_0002406 | Ga0495675_0002406_6137_7639 | 484 |
| 55 | 3300048088 | Ga0495602_0001840 | Ga0495602_0001840_11968_13470 | 484 |
| 56 | 3300005434 | Ga0070709_10002868 | Ga0070709_100028682 | 485 |
| 57 | 3300005468 | Ga0070707_100055899 | Ga0070707_1000558994 | 485 |
| 58 | 3300007265 | Ga0099794_10007226 | Ga0099794_100072264 | 485 |
| 59 | 3300025922 | Ga0207646_10016564 | Ga0207646_100165647 | 485 |
| 60 | 3300044683 | Ga0466965_0004612 | Ga0466965_0004612_3650_5128 | 485 |
| 61 | 3300044684 | Ga0466966_0002746 | Ga0466966_0002746_1585_3063 | 485 |
| 62 | 3300044694 | Ga0466963_0021792 | Ga0466963_0021792_668_2146 | 485 |
| 63 | 3300044706 | Ga0466964_0011868 | Ga0466964_0011868_1053_2531 | 485 |
| 64 | 3300044712 | Ga0453684_0016060 | Ga0453684_0016060_1394_2887 | 485 |
| 65 | 3300045049 | Ga0466959_0000197 | Ga0466959_0000197_28935_30413 | 485 |
| 66 | 3300045836 | Ga0466958_0000192 | Ga0466958_0000192_10524_11993 | 485 |
| 67 | 3300045976 | Ga0466967_0089984 | Ga0466967_0089984_842_2320 | 485 |
| 68 | 3300005336 | Ga0070680_100001590 | Ga0070680_1000015902 | 486 |
| 69 | 3300005336 | Ga0070680_100010054 | Ga0070680_1000100545 | 486 |
| 70 | 3300005336 | Ga0070680_100063228 | Ga0070680_1000632282 | 486 |
| 71 | 3300005458 | Ga0070681_10000641 | Ga0070681_1000064114 | 486 |
| 72 | 3300005458 | Ga0070681_10053739 | Ga0070681_100537392 | 486 |
| 73 | 3300005458 | Ga0070681_10136081 | Ga0070681_101360812 | 486 |
| 74 | 3300005530 | Ga0070679_100002952 | Ga0070679_1000029524 | 486 |
| 75 | 3300005530 | Ga0070679_100038146 | Ga0070679_1000381464 | 486 |
| 76 | 3300005563 | Ga0068855_100001881 | Ga0068855_10000188120 | 486 |
| 77 | 3300005563 | Ga0068855_100008034 | Ga0068855_1000080344 | 486 |
| 78 | 3300009093 | Ga0105240_10000988 | Ga0105240_1000098816 | 486 |
| 79 | 3300009093 | Ga0105240_10005726 | Ga0105240_100057264 | 486 |
| 80 | 3300009551 | Ga0105238_10000440 | Ga0105238_1000044030 | 486 |
| 81 | 3300009551 | Ga0105238_10023518 | Ga0105238_100235184 | 486 |
| 82 | 3300009551 | Ga0105238_10059728 | Ga0105238_100597283 | 486 |
| 83 | 3300013104 | Ga0157370_10001186 | Ga0157370_100011865 | 486 |
| 84 | 3300013104 | Ga0157370_10007395 | Ga0157370_100073953 | 486 |
| 85 | 3300013105 | Ga0157369_10003030 | Ga0157369_100030307 | 486 |
| 86 | 3300013105 | Ga0157369_10028389 | Ga0157369_100283892 | 486 |
| 87 | 3300013307 | Ga0157372_10021166 | Ga0157372_100211662 | 486 |
| 88 | 3300025912 | Ga0207707_10001261 | Ga0207707_1000126116 | 486 |
| 89 | 3300025912 | Ga0207707_10002139 | Ga0207707_100021398 | 486 |
| 90 | 3300025912 | Ga0207707_10010396 | Ga0207707_100103962 | 486 |
| 91 | 3300025912 | Ga0207707_10047791 | Ga0207707_100477912 | 486 |
| 92 | 3300025913 | Ga0207695_10015277 | Ga0207695_100152773 | 486 |
| 93 | 3300025917 | Ga0207660_10063218 | Ga0207660_100632183 | 486 |
| 94 | 3300025921 | Ga0207652_10013031 | Ga0207652_100130314 | 486 |
| 95 | 3300025921 | Ga0207652_10036867 | Ga0207652_100368674 | 486 |
| 96 | 3300025924 | Ga0207694_10023654 | Ga0207694_100236544 | 486 |
| 97 | 3300025924 | Ga0207694_10089226 | Ga0207694_100892262 | 486 |
| 98 | 3300031711 | Ga0265314_10006245 | Ga0265314_100062455 | 486 |
| 99 | 3300044656 | Ga0466969_0000007 | Ga0466969_0000007_101767_103242 | 486 |
| 100 | 3300044683 | Ga0466965_0000837 | Ga0466965_0000837_477_1985 | 486 |
| 101 | 3300044735 | Ga0466968_0038940 | Ga0466968_0038940_240_1748 | 486 |
| 102 | 3300044765 | Ga0466970_0007737 | Ga0466970_0007737_3860_5368 | 486 |
| 103 | 3300044842 | Ga0466957_0007642 | Ga0466957_0007642_600_2108 | 486 |
| 104 | 3300045049 | Ga0466959_0003510 | Ga0466959_0003510_1008_2516 | 486 |
| 105 | 3300045836 | Ga0466958_0016542 | Ga0466958_0016542_2524_4032 | 486 |
| 106 | 3300046694 | Ga0495649_0021602 | Ga0495649_0021602_1252_2778 | 486 |
| 107 | 3300005329 | Ga0070683_100018579 | Ga0070683_1000185793 | 487 |
| 108 | 3300005335 | Ga0070666_10001721 | Ga0070666_100017215 | 487 |
| 109 | 3300005336 | Ga0070680_100024178 | Ga0070680_1000241782 | 487 |
| 110 | 3300005340 | Ga0070689_100042713 | Ga0070689_1000427131 | 487 |
| 111 | 3300005341 | Ga0070691_10000546 | Ga0070691_100005464 | 487 |
| 112 | 3300005367 | Ga0070667_100018792 | Ga0070667_1000187922 | 487 |
| 113 | 3300005440 | Ga0070705_100021845 | Ga0070705_1000218452 | 487 |
| 114 | 3300005458 | Ga0070681_10040522 | Ga0070681_100405222 | 487 |
| 115 | 3300005530 | Ga0070679_100009314 | Ga0070679_1000093144 | 487 |
| 116 | 3300005535 | Ga0070684_100028518 | Ga0070684_1000285182 | 487 |
| 117 | 3300005539 | Ga0068853_100057450 | Ga0068853_1000574501 | 487 |
| 118 | 3300005544 | Ga0070686_100011119 | Ga0070686_1000111194 | 487 |
| 119 | 3300005546 | Ga0070696_100004748 | Ga0070696_1000047482 | 487 |
| 120 | 3300005547 | Ga0070693_100034394 | Ga0070693_1000343942 | 487 |
| 121 | 3300005548 | Ga0070665_100021321 | Ga0070665_1000213214 | 487 |
| 122 | 3300005563 | Ga0068855_100107327 | Ga0068855_1001073273 | 487 |
| 123 | 3300005563 | Ga0068855_100147368 | Ga0068855_1001473682 | 487 |
| 124 | 3300005577 | Ga0068857_100003164 | Ga0068857_10000316411 | 487 |
| 125 | 3300005614 | Ga0068856_100027729 | Ga0068856_1000277293 | 487 |
| 126 | 3300005616 | Ga0068852_100098829 | Ga0068852_1000988292 | 487 |
| 127 | 3300005617 | Ga0068859_100013487 | Ga0068859_1000134875 | 487 |
| 128 | 3300005841 | Ga0068863_100019259 | Ga0068863_1000192597 | 487 |
| 129 | 3300005841 | Ga0068863_100086927 | Ga0068863_1000869272 | 487 |
| 130 | 3300005842 | Ga0068858_100007485 | Ga0068858_1000074854 | 487 |
| 131 | 3300005843 | Ga0068860_100007347 | Ga0068860_1000073475 | 487 |
| 132 | 3300005843 | Ga0068860_100070551 | Ga0068860_1000705512 | 487 |
| 133 | 3300006237 | Ga0097621_100001377 | Ga0097621_1000013775 | 487 |
| 134 | 3300006358 | Ga0068871_100002455 | Ga0068871_1000024556 | 487 |
| 135 | 3300006931 | Ga0097620_100013485 | Ga0097620_1000134852 | 487 |
| 136 | 3300009093 | Ga0105240_10037519 | Ga0105240_100375193 | 487 |
| 137 | 3300009094 | Ga0111539_10016698 | Ga0111539_100166982 | 487 |
| 138 | 3300009098 | Ga0105245_10001386 | Ga0105245_100013868 | 487 |
| 139 | 3300009098 | Ga0105245_10165976 | Ga0105245_101659762 | 487 |
| 140 | 3300009174 | Ga0105241_10043773 | Ga0105241_100437733 | 487 |
| 141 | 3300009176 | Ga0105242_10016658 | Ga0105242_100166585 | 487 |
| 142 | 3300009177 | Ga0105248_10000285 | Ga0105248_1000028530 | 487 |
| 143 | 3300009177 | Ga0105248_10002160 | Ga0105248_100021607 | 487 |
| 144 | 3300009545 | Ga0105237_10004706 | Ga0105237_1000470615 | 487 |
| 145 | 3300009551 | Ga0105238_10034675 | Ga0105238_100346754 | 487 |
| 146 | 3300009551 | Ga0105238_10068397 | Ga0105238_100683973 | 487 |
| 147 | 3300009553 | Ga0105249_10030078 | Ga0105249_100300782 | 487 |
| 148 | 3300009553 | Ga0105249_10068605 | Ga0105249_100686052 | 487 |
| 149 | 3300010375 | Ga0105239_10047547 | Ga0105239_100475472 | 487 |
| 150 | 3300010375 | Ga0105239_10083934 | Ga0105239_100839342 | 487 |
| 151 | 3300011119 | Ga0105246_10013963 | Ga0105246_100139633 | 487 |
| 152 | 3300013105 | Ga0157369_10032477 | Ga0157369_100324774 | 487 |
| 153 | 3300013105 | Ga0157369_10051367 | Ga0157369_100513673 | 487 |
| 154 | 3300013105 | Ga0157369_10173712 | Ga0157369_101737121 | 487 |
| 155 | 3300013105 | Ga0157369_10270193 | Ga0157369_102701932 | 487 |
| 156 | 3300013296 | Ga0157374_10245069 | Ga0157374_102450692 | 487 |
| 157 | 3300013297 | Ga0157378_10192715 | Ga0157378_101927152 | 487 |
| 158 | 3300013306 | Ga0163162_10004440 | Ga0163162_100044405 | 487 |
| 159 | 3300013306 | Ga0163162_10054967 | Ga0163162_100549673 | 487 |
| 160 | 3300013307 | Ga0157372_10029585 | Ga0157372_100295854 | 487 |
| 161 | 3300013308 | Ga0157375_10034879 | Ga0157375_100348794 | 487 |
| 162 | 3300014325 | Ga0163163_10005474 | Ga0163163_100054748 | 487 |
| 163 | 3300014325 | Ga0163163_10011262 | Ga0163163_100112622 | 487 |
| 164 | 3300014326 | Ga0157380_10003691 | Ga0157380_100036916 | 487 |
| 165 | 3300014969 | Ga0157376_10002005 | Ga0157376_100020058 | 487 |
| 166 | 3300025903 | Ga0207680_10004109 | Ga0207680_100041092 | 487 |
| 167 | 3300025911 | Ga0207654_10008746 | Ga0207654_100087464 | 487 |
| 168 | 3300025913 | Ga0207695_10024484 | Ga0207695_100244843 | 487 |
| 169 | 3300025913 | Ga0207695_10038137 | Ga0207695_100381372 | 487 |
| 170 | 3300025913 | Ga0207695_10090422 | Ga0207695_100904222 | 487 |
| 171 | 3300025919 | Ga0207657_10117591 | Ga0207657_101175912 | 487 |
| 172 | 3300025921 | Ga0207652_10005591 | Ga0207652_100055914 | 487 |
| 173 | 3300025924 | Ga0207694_10009535 | Ga0207694_100095356 | 487 |
| 174 | 3300025924 | Ga0207694_10027240 | Ga0207694_100272404 | 487 |
| 175 | 3300025926 | Ga0207659_10063107 | Ga0207659_100631072 | 487 |
| 176 | 3300025927 | Ga0207687_10000286 | Ga0207687_1000028626 | 487 |
| 177 | 3300025927 | Ga0207687_10001535 | Ga0207687_100015357 | 487 |
| 178 | 3300025928 | Ga0207700_10013467 | Ga0207700_100134674 | 487 |
| 179 | 3300025933 | Ga0207706_10003584 | Ga0207706_100035843 | 487 |
| 180 | 3300025936 | Ga0207670_10004725 | Ga0207670_100047256 | 487 |
| 181 | 3300025941 | Ga0207711_10001660 | Ga0207711_100016602 | 487 |
| 182 | 3300025941 | Ga0207711_10053224 | Ga0207711_100532242 | 487 |
| 183 | 3300025941 | Ga0207711_10065777 | Ga0207711_100657772 | 487 |
| 184 | 3300025942 | Ga0207689_10090527 | Ga0207689_100905272 | 487 |
| 185 | 3300025944 | Ga0207661_10004643 | Ga0207661_100046435 | 487 |
| 186 | 3300025944 | Ga0207661_10016663 | Ga0207661_100166634 | 487 |
| 187 | 3300025949 | Ga0207667_10005465 | Ga0207667_100054657 | 487 |
| 188 | 3300025949 | Ga0207667_10070508 | Ga0207667_100705082 | 487 |
| 189 | 3300025986 | Ga0207658_10007777 | Ga0207658_100077774 | 487 |
| 190 | 3300026023 | Ga0207677_10006351 | Ga0207677_100063515 | 487 |
| 191 | 3300026035 | Ga0207703_10015049 | Ga0207703_100150493 | 487 |
| 192 | 3300026041 | Ga0207639_10117793 | Ga0207639_101177931 | 487 |
| 193 | 3300026075 | Ga0207708_10059932 | Ga0207708_100599322 | 487 |
| 194 | 3300026116 | Ga0207674_10001222 | Ga0207674_1000122230 | 487 |
| 195 | 3300026142 | Ga0207698_10131723 | Ga0207698_101317232 | 487 |
| 196 | 3300027876 | Ga0209974_10000950 | Ga0209974_100009502 | 487 |
| 197 | 3300028573 | Ga0265334_10004873 | Ga0265334_100048734 | 487 |
| 198 | 3300028666 | Ga0265336_10000061 | Ga0265336_1000006188 | 487 |
| 199 | 3300028794 | Ga0307515_10000048 | Ga0307515_1000004831 | 487 |
| 200 | 3300028794 | Ga0307515_10000080 | Ga0307515_10000080177 | 487 |
| 201 | 3300028794 | Ga0307515_10001430 | Ga0307515_1000143020 | 487 |
| 202 | 3300028800 | Ga0265338_10021836 | Ga0265338_100218362 | 487 |
| 203 | 3300031241 | Ga0265325_10001661 | Ga0265325_1000166112 | 487 |
| 204 | 3300031247 | Ga0265340_10019099 | Ga0265340_100190991 | 487 |
| 205 | 3300031249 | Ga0265339_10034856 | Ga0265339_100348562 | 487 |
| 206 | 3300031595 | Ga0265313_10001713 | Ga0265313_100017136 | 487 |
| 207 | 3300031730 | Ga0307516_10000124 | Ga0307516_100001247 | 487 |
| 208 | 3300035086 | Ga0373934_0002640 | Ga0373934_0002640_2508_4004 | 487 |
| 209 | 3300035114 | Ga0373939_0000044 | Ga0373939_0000044_22396_23904 | 487 |
| 210 | 3300035121 | Ga0373960_0001085 | Ga0373960_0001085_1087_2595 | 487 |
| 211 | 3300035242 | Ga0373962_0005477 | Ga0373962_0005477_311_1819 | 487 |
| 212 | 3300035691 | Ga0373931_0001044 | Ga0373931_0001044_4390_5898 | 487 |
| 213 | 3300035724 | Ga0373933_0009449 | Ga0373933_0009449_1621_3120 | 487 |
| 214 | 3300036401 | Ga0373937_0101438 | Ga0373937_0101438_400_1899 | 487 |
| 215 | 3300037068 | Ga0373925_0027527 | Ga0373925_0027527_1808_3307 | 487 |
| 216 | 3300037068 | Ga0373925_0112156 | Ga0373925_0112156_213_1712 | 487 |
| 217 | 3300037471 | Ga0395905_0035911 | Ga0395905_0035911_2337_3812 | 487 |
| 218 | 3300042876 | Ga0451577_0003152 | Ga0451577_0003152_12109_13605 | 487 |
| 219 | 3300044656 | Ga0466969_0006692 | Ga0466969_0006692_3369_4883 | 487 |
| 220 | 3300044658 | Ga0466972_0003446 | Ga0466972_0003446_2999_4501 | 487 |
| 221 | 3300044684 | Ga0466966_0033499 | Ga0466966_0033499_847_2322 | 487 |
| 222 | 3300044693 | Ga0466961_0009730 | Ga0466961_0009730_2514_4028 | 487 |
| 223 | 3300044712 | Ga0453684_0014438 | Ga0453684_0014438_3816_5300 | 487 |
| 224 | 3300044712 | Ga0453684_0018003 | Ga0453684_0018003_5764_7272 | 487 |
| 225 | 3300044901 | Ga0466960_0006189 | Ga0466960_0006189_64_1539 | 487 |
| 226 | 3300045049 | Ga0466959_0128596 | Ga0466959_0128596_114_1589 | 487 |
| 227 | 3300045051 | Ga0451576_0022389 | Ga0451576_0022389_162_1655 | 487 |
| 228 | 3300046535 | Ga0495586_0016787 | Ga0495586_0016787_1787_3286 | 487 |
| 229 | 3300046536 | Ga0495587_0000365 | Ga0495587_0000365_16534_18033 | 487 |
| 230 | 3300047318 | Ga0495636_0022990 | Ga0495636_0022990_727_2229 | 487 |
| 231 | 3300047471 | Ga0495684_0035246 | Ga0495684_0035246_1402_2898 | 487 |
| 232 | 3300048088 | Ga0495602_0000797 | Ga0495602_0000797_27909_29408 | 487 |
| 233 | 3300053092 | Ga0500583_0017586 | Ga0500583_0017586_1270_2760 | 487 |
| 234 | 3300053096 | Ga0500641_0016638 | Ga0500641_0016638_1087_2565 | 487 |
| 235 | 3300053153 | Ga0500616_0000016 | Ga0500616_0000016_464196_465674 | 487 |
| 236 | 3300061719 | Ga0466962_0006319 | Ga0466962_0006319_3117_4631 | 487 |
| 237 | 3300045976 | Ga0466967_0070675 | Ga0466967_0070675_675_2195 | 488 |
| 238 | 3300028666 | Ga0265336_10000087 | Ga0265336_1000008749 | 489 |
| 239 | 3300039447 | Ga0436361_1129197 | Ga0436361_1129197_7953_9506 | 490 |
| 240 | 3300003752 | Ga0055539_1000166 | Ga0055539_100016611 | 491 |
| 241 | 3300003756 | Ga0055533_1000087 | Ga0055533_1000087111 | 491 |
| 242 | 3300003759 | Ga0055525_1000674 | Ga0055525_10006744 | 491 |
| 243 | 3300005336 | Ga0070680_100060166 | Ga0070680_1000601662 | 491 |
| 244 | 3300025226 | Ga0209674_100088 | Ga0209674_10008863 | 491 |
| 245 | 3300025230 | Ga0209563_100140 | Ga0209563_10014011 | 491 |
| 246 | 3300025253 | Ga0209677_100095 | Ga0209677_10009587 | 491 |
| 247 | 3300005563 | Ga0068855_100001365 | Ga0068855_10000136518 | 492 |
| 248 | 3300006353 | Ga0075370_10005521 | Ga0075370_100055213 | 492 |
| 249 | 3300009093 | Ga0105240_10082843 | Ga0105240_100828431 | 492 |
| 250 | 3300025949 | Ga0207667_10021788 | Ga0207667_100217882 | 492 |
| 251 | 3300050496 | nmdc:mga07m45_2388_c2 | nmdc:mga07m45_2388_c2_3230_4759 | 492 |
| 252 | 3300003203 | JGI25406J46586_10004888 | JGI25406J46586_100048885 | 494 |
| 253 | 3300005985 | Ga0081539_10000016 | Ga0081539_10000016282 | 494 |
| 254 | 3300046492 | Ga0495585_0006000 | Ga0495585_0006000_2775_4334 | 494 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5mb2-assembly1.cif.gz_B | structure of sucrose phosphorylase from bifidobacterium adolescentis bound to nigerose | 0.968 | 1 | 488 |
| 5man-assembly1.cif.gz_B | structure of sucrose phosphorylase from bifidobacterium adolescentis bound to nigerose | 0.962 | 1 | 494 |
| 5man-assembly1.cif.gz_B | structure of sucrose phosphorylase from bifidobacterium adolescentis bound to nigerose | 0.9601 | 1 | 494 |
| 2gdu-assembly1.cif.gz_B | e232q mutant of sucrose phosphorylase from bifidobacterium adolescentis in complex with sucrose | 0.9574 | 1 | 492 |
| 1r7a-assembly1.cif.gz_A | sucrose phosphorylase from bifidobacterium adolescentis | 0.9553 | 1 | 492 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5m9xB02 | Alpha Beta;Alpha-Beta Complex;Oligo-1,6-glucosidase; domain 2;Oligo-1,6-glucosidase; Domain 2 | 0.9738 | 85 | 166 | 3.90.400.10 |
| 5m9xB02 | Alpha Beta;Alpha-Beta Complex;Oligo-1,6-glucosidase; domain 2;Oligo-1,6-glucosidase; Domain 2 | 0.9622 | 85 | 166 | 3.90.400.10 |
| 2gdvA01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.9588 | 1 | 433 | 3.20.20.80 |
| 2gdvA01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.9561 | 1 | 433 | 3.20.20.80 |
| af_P76041_133_205_3.20.20.80 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.8496 | 87 | 168 | 3.20.20.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D2CT35-F1-model_v4 | Sucrose phosphorylase | 0.9812 | 1 | 293 |
GO:0005975
GO:0016740 |
| AF-A0A060CGZ2-F1-model_v4 | CAZy families GH13 protein | 0.9807 | 154 | 321 |
|
| AF-A0A060CR62-F1-model_v4 | CAZy families GH13 protein | 0.9802 | 213 | 374 |
|
| AF-A0A3N5PN33-F1-model_v4 | Sucrose phosphorylase | 0.9801 | 1 | 289 |
|
| AF-A0A520BHA1-F1-model_v4 | Sucrose phosphorylase | 0.9787 | 132 | 489 |
GO:0016740
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar