F364902

General Info

Members Datasets Scaffolds Average Seq Length
254 204 508 331

Family's Representative Sequence

Representative Sequence 3300021361|Ga0213872_10074779|Ga0213872_100747792
Length 389
Sequence MLLAPSPHPSITLPPVPRNPDQNEEPRGDYQQYRKECGQVPKRSHRTGEAYWVIAKQYLGAEVKMSQTVLVTGGAGYIGSHASKVLSLAGHRPVVFDNLSRGHREAVRWGPLVEGELADRERLVAAIREHRISAVMHFAAFAYVGESVADPALYYRNNLSGTLSLLDAMRETGLDKIVFSSTCATYGMPEVVPIPETAPQLPVNPYGETKLAIERALQWYHRAYGLRSMSLRYFNAAGADPEGEIGELHEPETHLIPLILHTALGKRSHVDIYGTDYETPDGTAIRDYIHVEDLAEAHLRALEHLCAGGESAALNLGTGSGHSVREVIAAAEAISGRPIARREVARRPGDAPILVADPGLAAQQLGWCAHCSDLETIIDTAFAWHKRMA

Samples

Sample ID Description Type Environment
1 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
72 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
73 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
74 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
75 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
78 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
104 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
105 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
106 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
107 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
117 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
118 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
119 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
122 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
126 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
130 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
133 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
134 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
135 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
136 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
141 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
142 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
143 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
144 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
152 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
153 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
154 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
157 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
158 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
159 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
165 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
166 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
167 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
170 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
171 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
172 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
173 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
174 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
175 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
176 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
177 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
178 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
179 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
180 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
181 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
182 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
183 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
184 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
185 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
186 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
187 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
188 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
189 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
190 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
191 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
192 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
193 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
194 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
195 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
196 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
197 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
198 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
199 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
200 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
201 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
202 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
203 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
204 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 85.83
Metatranscriptomes 0
Isolates 14.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.12
Nodule 8.27
Rhizoplane 1.57
Rhizosphere 72.44
Stem 0
Stem Tuber 0
Unclassified 1.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213872_10074779 3300021361 Bacteria 1525
2 JGI25153J46596_10029330 3300003215 Bacteria 1891
3 JGI25160J50197_1001827 3300003354 Bacteria 10250
4 JGI25160J50197_1017736 3300003354 Bacteria 2244
5 Ga0065165_1022845 3300005262 Bacteria 2133
6 Ga0065712_10087592 3300005290 Bacteria 2559
7 Ga0065715_10093936 3300005293 Bacteria 4493
8 Ga0068869_100102531 3300005334 Bacteria 2166
9 Ga0070666_10141739 3300005335 Bacteria 1674
10 Ga0070680_100213521 3300005336 Bacteria 1628
11 Ga0068868_100001710 3300005338 Bacteria 15016
12 Ga0070689_100015400 3300005340 Bacteria 5575
13 Ga0070669_100082666 3300005353 Unclassified 2394
14 Ga0070675_100088128 3300005354 Bacteria 2596
15 Ga0070688_100188562 3300005365 Bacteria 1435
16 Ga0070709_10046786 3300005434 Bacteria 2691
17 Ga0070709_10128076 3300005434 Bacteria 1729
18 Ga0070714_100009389 3300005435 Bacteria 7687
19 Ga0070714_100228011 3300005435 Bacteria 1715
20 Ga0070713_100047274 3300005436 Bacteria 3536
21 Ga0070713_100055049 3300005436 Bacteria 3304
22 Ga0070710_10005913 3300005437 Bacteria 5844
23 Ga0070710_10018720 3300005437 Bacteria 3567
24 Ga0070710_10071305 3300005437 Bacteria 2003
25 Ga0070711_100043167 3300005439 Bacteria 3052
26 Ga0070694_100406530 3300005444 Bacteria 1067
27 Ga0070663_100050596 3300005455 Bacteria 2956
28 Ga0070662_100018651 3300005457 Bacteria 4698
29 Ga0070681_10010281 3300005458 Bacteria 9235
30 Ga0070681_10169823 3300005458 Bacteria 2103
31 Ga0070706_100406991 3300005467 Bacteria 1267
32 Ga0070707_100354364 3300005468 Bacteria 1425
33 Ga0070698_100010522 3300005471 Bacteria 9861
34 Ga0070698_100191180 3300005471 Bacteria 1985
35 Ga0070698_100302206 3300005471 Bacteria 1531
36 Ga0070684_100085441 3300005535 Bacteria 2798
37 Ga0070697_100051501 3300005536 Bacteria 3344
38 Ga0070697_100138942 3300005536 Bacteria 2042
39 Ga0068853_100063883 3300005539 Bacteria 3190
40 Ga0068853_100279721 3300005539 Bacteria 1538
41 Ga0070672_100192373 3300005543 Bacteria 1704
42 Ga0070693_100276751 3300005547 Bacteria 1122
43 Ga0070704_100218954 3300005549 Bacteria 1547
44 Ga0068857_100345519 3300005577 Bacteria 1377
45 Ga0068852_100008359 3300005616 Bacteria 7625
46 Ga0068859_100083764 3300005617 Bacteria 3233
47 Ga0068864_100071104 3300005618 Bacteria 3029
48 Ga0068861_100002225 3300005719 Bacteria 12593
49 Ga0068851_10128304 3300005834 Unclassified 1369
50 Ga0068860_100001022 3300005843 Bacteria 30894
51 Ga0081540_1007671 3300005983 Bacteria 7652
52 Ga0070717_10011161 3300006028 Bacteria 6809
53 Ga0075365_10015034 3300006038 Bacteria 4671
54 Ga0075368_10047219 3300006042 Bacteria 1704
55 Ga0075363_100128623 3300006048 Bacteria 1419
56 Ga0075364_10185551 3300006051 Bacteria 1408
57 Ga0070716_100049514 3300006173 Bacteria 2381
58 Ga0070712_100039383 3300006175 Bacteria 3234
59 Ga0070712_100057517 3300006175 Bacteria 2732
60 Ga0075367_10029585 3300006178 Bacteria 3134
61 Ga0075430_100000065 3300006846 Bacteria 56889
62 Ga0075431_100000849 3300006847 Bacteria 26798
63 Ga0075431_100029978 3300006847 Bacteria 5603
64 Ga0075431_100150477 3300006847 Bacteria 2397
65 Ga0075433_10076840 3300006852 Bacteria 2941
66 Ga0075436_100128269 3300006914 Bacteria 1777
67 Ga0097620_100083763 3300006931 Bacteria 3233
68 Ga0099795_10014036 3300007788 Bacteria 2473
69 Ga0099795_10023529 3300007788 Bacteria 2045
70 Ga0099795_10031638 3300007788 Bacteria 1823
71 Ga0111539_10330052 3300009094 Bacteria 1776
72 Ga0105245_10101662 3300009098 Bacteria 2661
73 Ga0114129_10009073 3300009147 Bacteria 14174
74 Ga0114129_10154997 3300009147 Bacteria 3133
75 Ga0105241_10057535 3300009174 Bacteria 2983
76 Ga0105241_10077239 3300009174 Bacteria 2599
77 Ga0105248_10000336 3300009177 Bacteria 55359
78 Ga0105248_10000540 3300009177 Bacteria 43101
79 Ga0099796_10001162 3300010159 Bacteria 5096
80 Ga0105239_10015286 3300010375 Bacteria 8506
81 Ga0105239_10060419 3300010375 Bacteria 4160
82 Ga0157371_10074532 3300013102 Bacteria 2403
83 Ga0157374_10004701 3300013296 Bacteria 11463
84 Ga0163162_10000694 3300013306 Bacteria 31094
85 Ga0163162_10291937 3300013306 Bacteria 1762
86 Ga0157372_10026158 3300013307 Bacteria 6350
87 Ga0182008_10095730 3300014497 Bacteria 1465
88 Ga0157377_10186660 3300014745 Bacteria 1307
89 Ga0157379_10002125 3300014968 Bacteria 16432
90 Ga0157379_10190880 3300014968 Bacteria 1851
91 Ga0157376_10007044 3300014969 Bacteria 7981
92 Ga0163161_10079639 3300017792 Unclassified 2409
93 Ga0214544_1000003 3300021320 Bacteria 643752
94 Ga0214542_1000022 3300021321 Bacteria 193578
95 Ga0214545_1000010 3300021324 Bacteria 193578
96 Ga0214543_1000035 3300021327 Bacteria 183100
97 Ga0213873_10034168 3300021358 Bacteria 1280
98 Ga0213876_10030727 3300021384 Bacteria 2834
99 Ga0213875_10000179 3300021388 Bacteria 64723
100 Ga0213875_10000902 3300021388 Bacteria 21584
101 Ga0207426_1003337 3300025302 Bacteria 8854
102 Ga0207692_10022424 3300025898 Bacteria 2905
103 Ga0207680_10049270 3300025903 Bacteria 2507
104 Ga0207699_10017952 3300025906 Bacteria 3739
105 Ga0207654_10029824 3300025911 Bacteria 2990
106 Ga0207707_10004227 3300025912 Bacteria 12712
107 Ga0207707_10072360 3300025912 Bacteria 3005
108 Ga0207693_10002927 3300025915 Bacteria 14777
109 Ga0207693_10004837 3300025915 Bacteria 11332
110 Ga0207663_10011245 3300025916 Bacteria 4801
111 Ga0207660_10183042 3300025917 Bacteria 1628
112 Ga0207646_10116756 3300025922 Bacteria 2397
113 Ga0207694_10050694 3300025924 Bacteria 3216
114 Ga0207659_10162972 3300025926 Bacteria 1752
115 Ga0207664_10011191 3300025929 Bacteria 6362
116 Ga0207664_10253030 3300025929 Bacteria 1538
117 Ga0207706_10037091 3300025933 Unclassified 4328
118 Ga0207670_10016202 3300025936 Bacteria 4473
119 Ga0207665_10103803 3300025939 Bacteria 1989
120 Ga0207711_10002731 3300025941 Bacteria 15559
121 Ga0207711_10008465 3300025941 Bacteria 8606
122 Ga0207677_10003848 3300026023 Bacteria 7990
123 Ga0207703_10185273 3300026035 Bacteria 1839
124 Ga0207639_10018393 3300026041 Bacteria 4965
125 Ga0207639_10212877 3300026041 Bacteria 1665
126 Ga0207639_10239585 3300026041 Bacteria 1576
127 Ga0207702_10117170 3300026078 Bacteria 2378
128 Ga0207676_10124716 3300026095 Bacteria 2179
129 Ga0207675_100007914 3300026118 Bacteria 10020
130 Ga0209179_1011008 3300027512 Bacteria 1591
131 Ga0268264_10000543 3300028381 Bacteria 47422
132 Ga0265327_10001897 3300031251 Bacteria 24169
133 Ga0316575_10046680 3300031665 Bacteria 1721
134 Ga0316576_10000465 3300031727 Bacteria 18963
135 Ga0316578_10000131 3300031728 Bacteria 18953
136 Ga0316577_10025559 3300031733 Bacteria 3284
137 Ga0307413_10001681 3300031824 Bacteria 8611
138 Ga0307410_10000355 3300031852 Bacteria 17795
139 Ga0307407_10000660 3300031903 Bacteria 11085
140 Ga0307412_10185569 3300031911 Bacteria 1568
141 Ga0307409_100021377 3300031995 Bacteria 4434
142 Ga0307409_100104000 3300031995 Bacteria 2364
143 Ga0307414_10035471 3300032004 Bacteria 3320
144 Ga0307411_10001656 3300032005 Bacteria 9308
145 Ga0307415_100021488 3300032126 Bacteria 3968
146 Ga0316585_10001509 3300032137 Bacteria 6157
147 Ga0316580_10001076 3300032139 Bacteria 6876
148 Ga0373954_0045076 3300035118 Bacteria 2059
149 Ga0373956_0075947 3300035119 Bacteria 1537
150 Ga0373955_0021611 3300035172 Bacteria 3252
151 Ga0373955_0092894 3300035172 Bacteria 1722
152 Ga0373955_0159301 3300035172 Bacteria 1331
153 Ga0373927_0203782 3300035695 Bacteria 1299
154 Ga0373933_0004309 3300035724 Bacteria 7810
155 Ga0373933_0106180 3300035724 Bacteria 1747
156 Ga0373947_0016422 3300035725 Bacteria 4255
157 Ga0373937_0003828 3300036401 Bacteria 12712
158 Ga0373937_0032174 3300036401 Bacteria 4757
159 Ga0373937_0080832 3300036401 Bacteria 3006
160 Ga0316582_0001965 3300036647 Bacteria 9404
161 Ga0316584_0000643 3300036712 Bacteria 18953
162 Ga0395905_0004232 3300037471 Bacteria 15003
163 Ga0436364_0056880 3300037853 Bacteria 87492
164 Ga0436364_0346238 3300037853 Bacteria 35487
165 Ga0436364_0408416 3300037853 Bacteria 1393
166 Ga0436364_0668201 3300037853 Bacteria 105492
167 Ga0436364_1200599 3300037853 Bacteria 4760
168 Ga0400484_17636 3300038725 Bacteria 4346
169 Ga0400483_158347 3300039062 Bacteria 1624
170 Ga0436365_0073543 3300039437 Bacteria 2209
171 Ga0436360_1145109 3300039438 Bacteria 1405
172 Ga0436360_1211623 3300039438 Bacteria 2620
173 Ga0436361_0222321 3300039447 Bacteria 2683
174 Ga0436363_0293244 3300039450 Bacteria 4078
175 Ga0436363_0715482 3300039450 Bacteria 3309
176 Ga0436362_0133393 3300039453 Bacteria 5940
177 Ga0436362_0461699 3300039453 Bacteria 4342
178 Ga0436362_0628802 3300039453 Bacteria 1960
179 Ga0436362_0953233 3300039453 Bacteria 1676
180 Ga0451577_0005532 3300042876 Bacteria 12881
181 Ga0466963_0106879 3300044694 Bacteria 1919
182 Ga0453684_0025832 3300044712 Bacteria 8511
183 Ga0466967_0209078 3300045976 Bacteria 1850
184 Ga0495586_0091363 3300046535 Bacteria 1682
185 Ga0495656_0014344 3300046615 Bacteria 2970
186 Ga0495634_0010939 3300046642 Bacteria 6623
187 Ga0495600_0013583 3300046809 Bacteria 5121
188 Ga0495680_0120358 3300047322 Bacteria 1939
189 Ga0496102_0447418 3300048905 Bacteria 1212
190 Ga0496112_0225108 3300048915 Bacteria 1831
191 Ga0496113_0292691 3300048916 Bacteria 1303
192 Ga0496115_0001626 3300048918 Bacteria 16176
193 Ga0501046_0003114 3300049580 Bacteria 15305
194 Ga0501046_0071565 3300049580 Bacteria 2694
195 Ga0501047_0001024 3300049581 Bacteria 28185
196 Ga0501047_0056356 3300049581 Bacteria 3800
197 Ga0501073_0006462 3300049589 Bacteria 8721
198 Ga0501074_0020680 3300049590 Bacteria 4782
199 Ga0501076_0172509 3300049592 Bacteria 1763
200 Ga0501257_024088 3300049686 Bacteria 1445
201 Ga0501080_0008211 3300049742 Bacteria 9454
202 Ga0501080_0012072 3300049742 Bacteria 7914
203 Ga0501044_0375188 3300049823 Bacteria 1338
204 nmdc:mga03n38_70431_c1 3300050490 Bacteria 1617
205 nmdc:mga06z11_27857_c1 3300050494 Bacteria 2705
206 nmdc:mga04h51_2577_c1 3300050495 Bacteria 4314
207 nmdc:mga05p37_14108_c1 3300050507 Bacteria 9589
208 nmdc:mga05p37_229889_c1 3300050507 Bacteria 2235
209 nmdc:mga0qj67_2454_c1 3300050509 Bacteria 13201
210 nmdc:mga06r32_37688_c1 3300050510 Bacteria 4574
211 nmdc:mga06r32_42580_c1 3300050510 Bacteria 4318
212 nmdc:mga0rr50_169723_c1 3300050513 Bacteria 1777
213 nmdc:mga08x19_34164_c1 3300050514 Bacteria 3213
214 nmdc:mga0a205_45444_c1 3300050515 Bacteria 4234
215 Ga0495601_0030180 3300053077 Bacteria 3365
216 Ga0495619_0002267 3300053085 Bacteria 12707
217 Ga0495619_0037712 3300053085 Bacteria 3151
218 Ga0501084_0070411 3300054114 Bacteria 2929
219 2513874325 2513237139 Bacteria 8737671
220 2514016817 2513237161 Bacteria 8871253
221 2523104961 2522572158 Bacteria 6514390
222 2524438486 2524023205 Bacteria 8918781
223 2617353143 2617270735 Bacteria 9163226
224 2617374529 2617270741 Bacteria 8201522
225 2745078355 2744054633 Bacteria 8678936
226 2793059461 2791355196 Bacteria 7323613
227 2805916092 2802429603 Bacteria 8777136
228 2824604483 2824600985 Bacteria 8488197
229 2824614976 2824609381 Bacteria 8672835
230 2824657501 2824653114 Bacteria 8493680
231 2824674007 2824671348 Bacteria 8369588
232 2824680203 2824679649 Bacteria 8248951
233 2824691250 2824687955 Bacteria 8360029
234 2824700940 2824696289 Bacteria 8335049
235 2824736132 2824732956 Bacteria 7810675
236 2824748007 2824746037 Bacteria 7911610
237 2824778311 2824773399 Bacteria 8360218
238 2838128562 2838122688 Bacteria 8803140
239 2841942418 2841941048 Bacteria 8688029
240 2841953236 2841949485 Bacteria 8680857
241 2841973875 2841966195 Bacteria 8673214
242 2841982940 2841974524 Bacteria 8931498
243 2841984435 2841983080 Bacteria 8395090
244 2847943372 2847939898 Bacteria 8606328
245 2849077095 2849076700 Bacteria 7039503
246 2857514614 2857509624 Bacteria 7472071
247 2874624169 2874620515 Bacteria 8290088
248 2876767595 2876761206 Bacteria 10111113
249 2888426787 2888419890 Bacteria 7857137
250 2904670880 2904666416 Bacteria 8226587
251 2908777009 2908775508 Bacteria 8092255
252 2922393400 2922393267 Bacteria 8285685
253 2941531845 2941531003 Bacteria 7653939
254 3005588854 3005587118 Bacteria 7794411
255 Ga0213872_10074779
256 JGI25153J46596_10029330
257 JGI25160J50197_1001827
258 JGI25160J50197_1017736
259 Ga0065165_1022845
260 Ga0065712_10087592
261 Ga0065715_10093936
262 Ga0068869_100102531
263 Ga0070666_10141739
264 Ga0070680_100213521
265 Ga0068868_100001710
266 Ga0070689_100015400
267 Ga0070669_100082666
268 Ga0070675_100088128
269 Ga0070688_100188562
270 Ga0070709_10046786
271 Ga0070709_10128076
272 Ga0070714_100009389
273 Ga0070714_100228011
274 Ga0070713_100047274
275 Ga0070713_100055049
276 Ga0070710_10005913
277 Ga0070710_10018720
278 Ga0070710_10071305
279 Ga0070711_100043167
280 Ga0070694_100406530
281 Ga0070663_100050596
282 Ga0070662_100018651
283 Ga0070681_10010281
284 Ga0070681_10169823
285 Ga0070706_100406991
286 Ga0070707_100354364
287 Ga0070698_100010522
288 Ga0070698_100191180
289 Ga0070698_100302206
290 Ga0070684_100085441
291 Ga0070697_100051501
292 Ga0070697_100138942
293 Ga0068853_100063883
294 Ga0068853_100279721
295 Ga0070672_100192373
296 Ga0070693_100276751
297 Ga0070704_100218954
298 Ga0068857_100345519
299 Ga0068852_100008359
300 Ga0068859_100083764
301 Ga0068864_100071104
302 Ga0068861_100002225
303 Ga0068851_10128304
304 Ga0068860_100001022
305 Ga0081540_1007671
306 Ga0070717_10011161
307 Ga0075365_10015034
308 Ga0075368_10047219
309 Ga0075363_100128623
310 Ga0075364_10185551
311 Ga0070716_100049514
312 Ga0070712_100039383
313 Ga0070712_100057517
314 Ga0075367_10029585
315 Ga0075430_100000065
316 Ga0075431_100000849
317 Ga0075431_100029978
318 Ga0075431_100150477
319 Ga0075433_10076840
320 Ga0075436_100128269
321 Ga0097620_100083763
322 Ga0099795_10014036
323 Ga0099795_10023529
324 Ga0099795_10031638
325 Ga0111539_10330052
326 Ga0105245_10101662
327 Ga0114129_10009073
328 Ga0114129_10154997
329 Ga0105241_10057535
330 Ga0105241_10077239
331 Ga0105248_10000336
332 Ga0105248_10000540
333 Ga0099796_10001162
334 Ga0105239_10015286
335 Ga0105239_10060419
336 Ga0157371_10074532
337 Ga0157374_10004701
338 Ga0163162_10000694
339 Ga0163162_10291937
340 Ga0157372_10026158
341 Ga0182008_10095730
342 Ga0157377_10186660
343 Ga0157379_10002125
344 Ga0157379_10190880
345 Ga0157376_10007044
346 Ga0163161_10079639
347 Ga0214544_1000003
348 Ga0214542_1000022
349 Ga0214545_1000010
350 Ga0214543_1000035
351 Ga0213873_10034168
352 Ga0213876_10030727
353 Ga0213875_10000179
354 Ga0213875_10000902
355 Ga0207426_1003337
356 Ga0207692_10022424
357 Ga0207680_10049270
358 Ga0207699_10017952
359 Ga0207654_10029824
360 Ga0207707_10004227
361 Ga0207707_10072360
362 Ga0207693_10002927
363 Ga0207693_10004837
364 Ga0207663_10011245
365 Ga0207660_10183042
366 Ga0207646_10116756
367 Ga0207694_10050694
368 Ga0207659_10162972
369 Ga0207664_10011191
370 Ga0207664_10253030
371 Ga0207706_10037091
372 Ga0207670_10016202
373 Ga0207665_10103803
374 Ga0207711_10002731
375 Ga0207711_10008465
376 Ga0207677_10003848
377 Ga0207703_10185273
378 Ga0207639_10018393
379 Ga0207639_10212877
380 Ga0207639_10239585
381 Ga0207702_10117170
382 Ga0207676_10124716
383 Ga0207675_100007914
384 Ga0209179_1011008
385 Ga0268264_10000543
386 Ga0265327_10001897
387 Ga0316575_10046680
388 Ga0316576_10000465
389 Ga0316578_10000131
390 Ga0316577_10025559
391 Ga0307413_10001681
392 Ga0307410_10000355
393 Ga0307407_10000660
394 Ga0307412_10185569
395 Ga0307409_100021377
396 Ga0307409_100104000
397 Ga0307414_10035471
398 Ga0307411_10001656
399 Ga0307415_100021488
400 Ga0316585_10001509
401 Ga0316580_10001076
402 Ga0373954_0045076
403 Ga0373956_0075947
404 Ga0373955_0021611
405 Ga0373955_0092894
406 Ga0373955_0159301
407 Ga0373927_0203782
408 Ga0373933_0004309
409 Ga0373933_0106180
410 Ga0373947_0016422
411 Ga0373937_0003828
412 Ga0373937_0032174
413 Ga0373937_0080832
414 Ga0316582_0001965
415 Ga0316584_0000643
416 Ga0395905_0004232
417 Ga0436364_0056880
418 Ga0436364_0346238
419 Ga0436364_0408416
420 Ga0436364_0668201
421 Ga0436364_1200599
422 Ga0400484_17636
423 Ga0400483_158347
424 Ga0436365_0073543
425 Ga0436360_1145109
426 Ga0436360_1211623
427 Ga0436361_0222321
428 Ga0436363_0293244
429 Ga0436363_0715482
430 Ga0436362_0133393
431 Ga0436362_0461699
432 Ga0436362_0628802
433 Ga0436362_0953233
434 Ga0451577_0005532
435 Ga0466963_0106879
436 Ga0453684_0025832
437 Ga0466967_0209078
438 Ga0495586_0091363
439 Ga0495656_0014344
440 Ga0495634_0010939
441 Ga0495600_0013583
442 Ga0495680_0120358
443 Ga0496102_0447418
444 Ga0496112_0225108
445 Ga0496113_0292691
446 Ga0496115_0001626
447 Ga0501046_0003114
448 Ga0501046_0071565
449 Ga0501047_0001024
450 Ga0501047_0056356
451 Ga0501073_0006462
452 Ga0501074_0020680
453 Ga0501076_0172509
454 Ga0501257_024088
455 Ga0501080_0008211
456 Ga0501080_0012072
457 Ga0501044_0375188
458 nmdc:mga03n38_70431_c1
459 nmdc:mga06z11_27857_c1
460 nmdc:mga04h51_2577_c1
461 nmdc:mga05p37_14108_c1
462 nmdc:mga05p37_229889_c1
463 nmdc:mga0qj67_2454_c1
464 nmdc:mga06r32_37688_c1
465 nmdc:mga06r32_42580_c1
466 nmdc:mga0rr50_169723_c1
467 nmdc:mga08x19_34164_c1
468 nmdc:mga0a205_45444_c1
469 Ga0495601_0030180
470 Ga0495619_0002267
471 Ga0495619_0037712
472 Ga0501084_0070411
473 2513874325
474 2514016817
475 2523104961
476 2524438486
477 2617353143
478 2617374529
479 2745078355
480 2793059461
481 2805916092
482 2824604483
483 2824614976
484 2824657501
485 2824674007
486 2824680203
487 2824691250
488 2824700940
489 2824736132
490 2824748007
491 2824778311
492 2838128562
493 2841942418
494 2841953236
495 2841973875
496 2841982940
497 2841984435
498 2847943372
499 2849077095
500 2857514614
501 2874624169
502 2876767595
503 2888426787
504 2904670880
505 2908777009
506 2922393400
507 2941531845
508 3005588854

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

69

317

0.93

PF04321

RmlD_sub_bind

RmlD substrate binding domain

67

233

0.92

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

70

218

0.81

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

70

380

0.79

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

69

241

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
1hzj-assembly1.cif.gz_B human udp-galactose 4-epimerase: accommodation of udp-n-acetylglucosamine within the active site 0.9632 6 323
2cnb-assembly1.cif.gz_A trypanosoma brucei udp-galactose-4-epimerase in ternary complex with nad and the substrate analogue udp-4-deoxy-4-fluoro-alpha-d-galactose 0.9601 3 326
2cnb-assembly2.cif.gz_C trypanosoma brucei udp-galactose-4-epimerase in ternary complex with nad and the substrate analogue udp-4-deoxy-4-fluoro-alpha-d-galactose 0.9559 3 326
6k0g-assembly1.cif.gz_A crystal structure of udp-glucose 4-epimerase from bifidobacterium longum in complex with nad+ and udp 0.9538 6 323
1gy8-assembly1.cif.gz_A trypanosoma brucei udp-galactose 4' epimerase 0.9535 3 329
ID Description Score Start End Superfamily
4wokA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9667 5 253 3.40.50.720
2c20A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9612 6 253 3.40.50.720
4wokA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9574 5 253 3.40.50.720
2c20A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9519 6 253 3.40.50.720
2p5yA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9392 6 253 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V8WCR2-F1-model_v4 UDP-glucose 4-epimerase (Galactowaldenase) (UDP-galactose 4-epimerase) 0.9953 6 182 GO:0016853
GO:0033499
AF-B0ZTI8-F1-model_v4 UDP-glucose 4-epimerase (Galactowaldenase) (UDP-galactose 4-epimerase) 0.9876 5 193 GO:0016853
GO:0033499
AF-A0A4Q5PI26-F1-model_v4 UDP-glucose 4-epimerase (EC 5.1.3.2) (Galactowaldenase) (UDP-galactose 4-epimerase) 0.9866 62 330 GO:0003978
GO:0033499
AF-A0A6B2XRE7-F1-model_v4 UDP-glucose 4-epimerase (Galactowaldenase) (UDP-galactose 4-epimerase) 0.9862 52 176 GO:0016853
GO:0033499
AF-A0A6G3XIY6-F1-model_v4 UDP-glucose 4-epimerase (Galactowaldenase) (UDP-galactose 4-epimerase) 0.9856 6 114 GO:0016853
GO:0033499

Map