F364880

General Info

Members Datasets Scaffolds Average Seq Length
254 178 243 296

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10009719|Ga0163163_100097194
Length 323
Sequence MYAEAISVLSDCRSLVNLRKGYNMRVFVTGATGFVGFAVAEELIGAGHQVLGLARSEAGAGSLAAIGAQVHRGDLEDLESLRSGAAMSDGVIHCAFNHDFSKFAANCELDRNAIEVLGSALDGSDRPLIVTSGIGALAKGRAASEQDAPMPSSPSYPRASEQTAVLVAERGVRASVVRLPQVHDPVKQGFVSYLIAVARQKGVSAYVGDGSNRWAAVHRLDAARLYRLALEKTGSDRNSEVARYHAVDEEGVPLKQIAEAIGRGLKVPVIAVPPADALQHFGFLGNFAGIDMPASSALTQQRLGWRPSGPGLISDLEAMRFDA

Samples

Sample ID Description Type Environment
1 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
2 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
3 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
4 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
5 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
6 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
7 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
8 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
9 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
10 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
11 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
12 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
13 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
14 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
19 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
20 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
61 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
62 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
67 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
68 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
70 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
87 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
88 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
91 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
97 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
98 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
99 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
100 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
105 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
106 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
107 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
113 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
114 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
115 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
116 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
117 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
118 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
119 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
120 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
121 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
122 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
123 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
126 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
129 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
130 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
131 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
134 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
135 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
136 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
137 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
138 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
139 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
140 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
141 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
142 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
143 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
144 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
147 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
150 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
151 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
157 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
158 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
159 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
160 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
161 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
162 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
163 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
164 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
169 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
170 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
171 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
172 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
173 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
175 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
176 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
177 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
178 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.88
Metatranscriptomes 0.39
Isolates 4.72

Biome Distribution

Category Percentage (%)
Aerial Root 0.79
Bulb 0
Endosphere 7.09
Nodule 1.97
Rhizoplane 1.57
Rhizosphere 71.65
Stem 0
Stem Tuber 0
Unclassified 16.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000191 3300002704 Bacteria 25991
2 JGI25156J39149_1000430 3300002705 Bacteria 25973
3 JGI25154J39366_1000018 3300002738 Bacteria 251612
4 JGI25157J39369_1000074 3300002741 Bacteria 88240
5 rootH1_10007734 3300003316 Bacteria 4607
6 rootL2_10007895 3300003322 Bacteria 11929
7 rootH1_10035079 3300003323 Bacteria 5013
8 rootH1_10038444 3300003316 Bacteria 1486
9 rootH1_10038444 3300003323 Bacteria 3156
10 rootH1_10183421 3300003323 Bacteria 2024
11 Ga0055539_1002404 3300003752 Bacteria 2883
12 Ga0055533_1000048 3300003756 Bacteria 212106
13 Ga0055533_1000068 3300003756 Bacteria 155215
14 Ga0055535_1000306 3300003761 Bacteria 49813
15 Ga0055529_1000291 3300003763 Bacteria 58444
16 Ga0070667_100100160 3300005367 Bacteria 2502
17 Ga0070709_10182185 3300005434 Bacteria 1476
18 Ga0070714_100282953 3300005435 Bacteria 1541
19 Ga0070713_100135377 3300005436 Bacteria 2176
20 Ga0070711_100019879 3300005439 Bacteria 4318
21 Ga0070708_100012375 3300005445 Bacteria 6961
22 Ga0070663_100106363 3300005455 Bacteria 2101
23 Ga0070698_100030563 3300005471 Bacteria 5584
24 Ga0070697_100018302 3300005536 Bacteria 5522
25 Ga0070665_100033437 3300005548 Bacteria 5173
26 Ga0070704_100221738 3300005549 Bacteria 1538
27 Ga0068855_100038672 3300005563 Bacteria 5668
28 Ga0068855_100089237 3300005563 Bacteria 3560
29 Ga0068855_100133720 3300005563 Bacteria 2830
30 Ga0068852_100589334 3300005616 Bacteria 1115
31 Ga0068859_100285534 3300005617 Bacteria 1743
32 Ga0068859_100448522 3300005617 Bacteria 1386
33 Ga0068860_100080258 3300005843 Bacteria 3103
34 Ga0070717_10098765 3300006028 Unclassified 2475
35 Ga0070716_100176849 3300006173 Bacteria 1398
36 Ga0097620_100285521 3300006931 Bacteria 1743
37 Ga0097620_100448496 3300006931 Bacteria 1386
38 Ga0075435_100195267 3300007076 Bacteria 1714
39 Ga0105240_10016206 3300009093 Bacteria 10101
40 Ga0105240_10037297 3300009093 Bacteria 6248
41 Ga0105240_10047664 3300009093 Bacteria 5421
42 Ga0105240_10074300 3300009093 Bacteria 4197
43 Ga0105240_10081911 3300009093 Bacteria 3964
44 Ga0105240_10422424 3300009093 Bacteria 1497
45 Ga0105245_10345685 3300009098 Bacteria 1472
46 Ga0105241_10240114 3300009174 Bacteria 1531
47 Ga0105241_10535757 3300009174 Bacteria 1049
48 Ga0105248_10023472 3300009177 Bacteria 6851
49 Ga0105237_10011637 3300009545 Bacteria 9312
50 Ga0105237_10175173 3300009545 Bacteria 2145
51 Ga0105237_10469152 3300009545 Bacteria 1265
52 Ga0105238_10024845 3300009551 Bacteria 6107
53 Ga0105239_10261805 3300010375 Bacteria 1944
54 Ga0105239_10330703 3300010375 Bacteria 1719
55 Ga0105239_10342853 3300010375 Bacteria 1686
56 Ga0157370_10002290 3300013104 Bacteria 23204
57 Ga0157369_10012458 3300013105 Bacteria 9647
58 Ga0157369_10122936 3300013105 Bacteria 2753
59 Ga0157369_10357201 3300013105 Bacteria 1517
60 Ga0157378_10018682 3300013297 Bacteria 6094
61 Ga0163162_10015709 3300013306 Bacteria 7398
62 Ga0163162_10121679 3300013306 Bacteria 2714
63 Ga0157372_10558822 3300013307 Bacteria 1334
64 Ga0157375_10154823 3300013308 Bacteria 2430
65 Ga0163163_10009719 3300014325 Bacteria 8609
66 Ga0163163_10129161 3300014325 Bacteria 2567
67 Ga0157379_10045057 3300014968 Bacteria 3938
68 Ga0157376_10003727 3300014969 Bacteria 10528
69 Ga0213872_10000352 3300021361 Bacteria 38861
70 Ga0213872_10011657 3300021361 Bacteria 4157
71 Ga0213872_10051856 3300021361 Bacteria 1862
72 Ga0213872_10126100 3300021361 Unclassified 1130
73 Ga0213876_10002722 3300021384 Bacteria 10297
74 Ga0213875_10006897 3300021388 Bacteria 5920
75 Ga0213871_10022662 3300021441 Bacteria 1576
76 Ga0213871_10042398 3300021441 Unclassified 1225
77 Ga0209435_100044 3300025206 Bacteria 99051
78 Ga0209674_100024 3300025226 Bacteria 535481
79 Ga0209672_102555 3300025228 Bacteria 4365
80 Ga0209563_100101 3300025230 Bacteria 152297
81 Ga0209258_100180 3300025242 Bacteria 137306
82 Ga0209646_1000151 3300025246 Bacteria 99050
83 Ga0209026_1000170 3300025250 Bacteria 99050
84 Ga0209677_100091 3300025253 Bacteria 106743
85 Ga0209677_107548 3300025253 Bacteria 2283
86 Ga0209759_1000186 3300025256 Bacteria 100413
87 Ga0209759_1002222 3300025256 Bacteria 8867
88 Ga0209455_1000144 3300025272 Bacteria 137313
89 Ga0207705_10063913 3300025909 Unclassified 2659
90 Ga0207654_10001730 3300025911 Bacteria 11358
91 Ga0207695_10024432 3300025913 Bacteria 6801
92 Ga0207695_10039845 3300025913 Bacteria 5046
93 Ga0207695_10055230 3300025913 Bacteria 4140
94 Ga0207695_10078357 3300025913 Bacteria 3353
95 Ga0207695_10095126 3300025913 Bacteria 2984
96 Ga0207671_10150659 3300025914 Bacteria 1797
97 Ga0207671_10200955 3300025914 Bacteria 1557
98 Ga0207657_10096531 3300025919 Bacteria 2458
99 Ga0207650_10287076 3300025925 Bacteria 1341
100 Ga0207665_10018083 3300025939 Bacteria 4632
101 Ga0207711_10107873 3300025941 Bacteria 2473
102 Ga0207711_10187877 3300025941 Bacteria 1882
103 Ga0207711_10373044 3300025941 Bacteria 1323
104 Ga0207667_10004177 3300025949 Bacteria 17738
105 Ga0207667_10017187 3300025949 Bacteria 8153
106 Ga0207639_10431097 3300026041 Bacteria 1194
107 Ga0207674_10208685 3300026116 Bacteria 1902
108 Ga0207698_10128180 3300026142 Bacteria 2163
109 Ga0207698_10146987 3300026142 Unclassified 2040
110 Ga0265318_10034487 3300028577 Bacteria 1951
111 Ga0265338_10000529 3300028800 Bacteria 67074
112 Ga0265762_1027044 3300030760 Bacteria 1075
113 Ga0265340_10011204 3300031247 Bacteria 4775
114 Ga0265339_10007283 3300031249 Bacteria 7168
115 Ga0265331_10002766 3300031250 Bacteria 11650
116 Ga0265314_10024977 3300031711 Bacteria 4517
117 Ga0265342_10155520 3300031712 Bacteria 1267
118 Ga0307414_10088963 3300032004 Bacteria 2287
119 Ga0395900_0208947 3300037418 Bacteria 1972
120 Ga0395898_0121368 3300037466 Bacteria 2504
121 Ga0436364_0392948 3300037853 Bacteria 5997
122 Ga0436364_0660405 3300037853 Bacteria 2398
123 Ga0436364_0687495 3300037853 Bacteria 9049
124 Ga0436364_0977931 3300037853 Bacteria 5872
125 Ga0436364_1499487 3300037853 Bacteria 8867
126 Ga0436365_0144671 3300039437 Bacteria 1376
127 Ga0436365_0323393 3300039437 Bacteria 7520
128 Ga0436365_0847526 3300039437 Bacteria 2083
129 Ga0436365_1028915 3300039437 Bacteria 6900
130 Ga0436360_0043287 3300039438 Bacteria 1914
131 Ga0436360_0965667 3300039438 Bacteria 1512
132 Ga0436360_1218577 3300039438 Bacteria 3765
133 Ga0436361_0128555 3300039447 Bacteria 9251
134 Ga0436361_0567140 3300039447 Bacteria 12519
135 Ga0436361_0941172 3300039447 Bacteria 1992
136 Ga0436361_0964227 3300039447 Bacteria 2348
137 Ga0451853_3994339 3300041512 Bacteria 2385
138 Ga0466969_0005365 3300044656 Bacteria 6824
139 Ga0466969_0109348 3300044656 Unclassified 1295
140 Ga0466965_0006770 3300044683 Bacteria 5231
141 Ga0466966_0004451 3300044684 Bacteria 9242
142 Ga0466966_0044686 3300044684 Bacteria 2835
143 Ga0466966_0134586 3300044684 Bacteria 1512
144 Ga0466961_0039026 3300044693 Bacteria 3044
145 Ga0466963_0048096 3300044694 Bacteria 2816
146 Ga0466963_0194426 3300044694 Bacteria 1418
147 Ga0466964_0001155 3300044706 Bacteria 8924
148 Ga0466971_0000173 3300044719 Bacteria 24208
149 Ga0466971_0025598 3300044719 Bacteria 2634
150 Ga0466968_0019284 3300044735 Bacteria 2746
151 Ga0466970_0001909 3300044765 Bacteria 10075
152 Ga0466970_0027611 3300044765 Bacteria 2978
153 Ga0466957_0001833 3300044842 Bacteria 11215
154 Ga0466957_0016059 3300044842 Bacteria 4376
155 Ga0466959_0000553 3300045049 Bacteria 21758
156 Ga0466959_0001275 3300045049 Bacteria 15240
157 Ga0466959_0046414 3300045049 Bacteria 3197
158 Ga0466959_0075920 3300045049 Bacteria 2427
159 Ga0466959_0184247 3300045049 Bacteria 1459
160 Ga0466958_0214104 3300045836 Bacteria 1228
161 Ga0466967_0009193 3300045976 Bacteria 7315
162 Ga0466967_0087553 3300045976 Bacteria 2824
163 Ga0495617_001995 3300046452 Bacteria 8508
164 Ga0495629_0009352 3300046459 Bacteria 7172
165 Ga0495638_0005482 3300046460 Bacteria 9433
166 Ga0495651_0009528 3300046462 Bacteria 7460
167 Ga0495650_0000006 3300046471 Bacteria 721347
168 Ga0495582_0018633 3300046473 Bacteria 3795
169 Ga0495662_0001828 3300046476 Bacteria 10661
170 Ga0495664_0016728 3300046477 Bacteria 4183
171 Ga0495664_0025595 3300046477 Bacteria 3436
172 Ga0495585_0000007 3300046492 Bacteria 288113
173 Ga0495594_0001835 3300046499 Bacteria 11054
174 Ga0495594_0002719 3300046499 Bacteria 9177
175 Ga0495583_0062393 3300046506 Bacteria 1659
176 Ga0495616_0000286 3300046513 Bacteria 40792
177 Ga0495628_0032175 3300046516 Bacteria 4236
178 Ga0495648_0084564 3300046524 Bacteria 1795
179 Ga0495666_0008629 3300046526 Bacteria 5106
180 Ga0495652_0040824 3300046529 Bacteria 4010
181 Ga0495652_0057399 3300046529 Bacteria 3301
182 Ga0495654_0000042 3300046530 Bacteria 164346
183 Ga0495665_0001277 3300046531 Bacteria 13430
184 Ga0495640_0002006 3300046533 Bacteria 16226
185 Ga0495586_0032193 3300046535 Bacteria 2811
186 Ga0495645_0011384 3300046543 Bacteria 6258
187 Ga0495645_0303112 3300046543 Bacteria 1043
188 Ga0495622_0012330 3300046557 Bacteria 3955
189 Ga0495668_0044834 3300046616 Bacteria 2458
190 Ga0495634_0006427 3300046642 Bacteria 8929
191 Ga0495635_0002490 3300046663 Bacteria 12576
192 Ga0495599_0032808 3300046678 Bacteria 3260
193 Ga0495646_0122324 3300046680 Bacteria 1471
194 Ga0495658_0045385 3300046683 Bacteria 2466
195 Ga0495613_0002416 3300046689 Bacteria 14116
196 Ga0495613_0009368 3300046689 Bacteria 7265
197 Ga0495624_0014673 3300046690 Bacteria 5306
198 Ga0495600_0001391 3300046809 Bacteria 13369
199 Ga0495581_0003390 3300047315 Bacteria 9154
200 Ga0495604_0005701 3300047317 Bacteria 9879
201 Ga0495604_0026071 3300047317 Bacteria 4655
202 Ga0495674_0041761 3300047319 Bacteria 4094
203 Ga0495674_0175236 3300047319 Bacteria 1787
204 Ga0495676_0001653 3300047321 Bacteria 19468
205 Ga0495676_0119427 3300047321 Bacteria 1921
206 Ga0495675_0096497 3300047444 Bacteria 1853
207 Ga0495684_0063982 3300047471 Bacteria 2796
208 Ga0495686_0001017 3300047472 Bacteria 33923
209 Ga0495593_0106282 3300047673 Bacteria 1436
210 Ga0495614_0000722 3300048089 Bacteria 13963
211 Ga0496102_0041432 3300048905 Bacteria 4170
212 Ga0496105_0451579 3300048908 Bacteria 1014
213 Ga0496112_0167941 3300048915 Bacteria 2160
214 Ga0496115_0070007 3300048918 Bacteria 2843
215 Ga0496116_0005249 3300048919 Bacteria 12108
216 Ga0496117_0000012 3300048920 Bacteria 608530
217 Ga0496118_0000003 3300048921 Bacteria 773148
218 Ga0496118_0060289 3300048921 Bacteria 2818
219 Ga0496119_0003373 3300048922 Bacteria 16617
220 Ga0496120_0140685 3300048923 Unclassified 1225
221 Ga0496121_0002861 3300048924 Bacteria 25436
222 Ga0496121_0023873 3300048924 Bacteria 5868
223 Ga0496121_0202125 3300048924 Unclassified 1415
224 Ga0496125_0098619 3300048928 Bacteria 2161
225 Ga0496126_0000133 3300048929 Bacteria 170029
226 Ga0496126_0011000 3300048929 Bacteria 9415
227 Ga0496126_0043234 3300048929 Bacteria 4156
228 Ga0496126_0057231 3300048929 Bacteria 3521
229 Ga0496126_0387493 3300048929 Bacteria 1136
230 Ga0501033_0004336 3300049570 Bacteria 11381
231 Ga0501047_0565748 3300049581 Bacteria 960
232 Ga0501083_0012937 3300049744 Bacteria 5830
233 Ga0501044_0243729 3300049823 Bacteria 1740
234 Ga0501044_0504133 3300049823 Bacteria 1111
235 Ga0500635_0000312 3300053080 Bacteria 16996
236 Ga0500595_067498 3300053119 Bacteria 1067
237 Ga0500559_0009365 3300053136 Bacteria 4244
238 Ga0500616_0040268 3300053153 Bacteria 2514
239 Ga0500622_0021616 3300053156 Bacteria 3414
240 Ga0500609_004895 3300053731 Bacteria 1837
241 Ga0501084_0019974 3300054114 Bacteria 5584
242 Ga0501082_0024850 3300060353 Bacteria 5163
243 Ga0466962_0005156 3300061719 Bacteria 6283

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025913 Ga0207695_10024432 Ga0207695_100244329 247
2 3300025919 Ga0207657_10096531 Ga0207657_100965313 251
3 3300046524 Ga0495648_0084564 Ga0495648_0084564_781_1671 268
4 3300046530 Ga0495654_0000042 Ga0495654_0000042_29102_29992 268
5 3300053153 Ga0500616_0040268 Ga0500616_0040268_1213_2103 268
6 3300005563 Ga0068855_100133720 Ga0068855_1001337202 271
7 3300009093 Ga0105240_10016206 Ga0105240_100162062 271
8 3300013104 Ga0157370_10002290 Ga0157370_1000229010 271
9 3300025913 Ga0207695_10078357 Ga0207695_100783575 271
10 3300025949 Ga0207667_10017187 Ga0207667_100171872 271
11 3300009545 Ga0105237_10175173 Ga0105237_101751731 280
12 3300014969 Ga0157376_10003727 Ga0157376_1000372710 280
13 3300046616 Ga0495668_0044834 Ga0495668_0044834_1592_2440 280
14 3300048915 Ga0496112_0167941 Ga0496112_0167941_24_872 280
15 3300021441 Ga0213871_10042398 Ga0213871_100423982 282
16 3300039438 Ga0436360_0965667 Ga0436360_0965667_494_1405 282
17 3300039447 Ga0436361_0941172 Ga0436361_0941172_740_1651 282
18 3300026116 Ga0207674_10208685 Ga0207674_102086853 283
19 iso_pu_bacteria 2984572630 2984574986 286
20 iso_pu_bacteria 2984606641 2984608439 286
21 3300044656 Ga0466969_0005365 Ga0466969_0005365_4884_5792 287
22 3300044683 Ga0466965_0006770 Ga0466965_0006770_1470_2378 287
23 3300044693 Ga0466961_0039026 Ga0466961_0039026_1465_2373 287
24 3300044706 Ga0466964_0001155 Ga0466964_0001155_1079_1987 287
25 3300044719 Ga0466971_0025598 Ga0466971_0025598_1182_2090 287
26 3300044735 Ga0466968_0019284 Ga0466968_0019284_993_1895 287
27 3300044765 Ga0466970_0027611 Ga0466970_0027611_262_1170 287
28 3300044842 Ga0466957_0016059 Ga0466957_0016059_95_1003 287
29 3300045049 Ga0466959_0001275 Ga0466959_0001275_1011_1919 287
30 3300061719 Ga0466962_0005156 Ga0466962_0005156_2168_3076 287
31 3300044694 Ga0466963_0194426 Ga0466963_0194426_204_1154 288
32 3300047472 Ga0495686_0001017 Ga0495686_0001017_16615_17496 289
33 iso_pu_bacteria 2775507266 2778179483 291
34 3300005549 Ga0070704_100221738 Ga0070704_1002217382 292
35 3300005617 Ga0068859_100285534 Ga0068859_1002855342 292
36 3300005843 Ga0068860_100080258 Ga0068860_1000802584 292
37 3300006931 Ga0097620_100285521 Ga0097620_1002855212 292
38 3300009098 Ga0105245_10345685 Ga0105245_103456852 292
39 3300009174 Ga0105241_10535757 Ga0105241_105357571 292
40 3300009545 Ga0105237_10469152 Ga0105237_104691522 292
41 3300010375 Ga0105239_10330703 Ga0105239_103307032 292
42 3300013297 Ga0157378_10018682 Ga0157378_100186824 292
43 3300013306 Ga0163162_10121679 Ga0163162_101216792 292
44 3300028800 Ga0265338_10000529 Ga0265338_1000052947 292
45 3300030760 Ga0265762_1027044 Ga0265762_10270441 292
46 3300031249 Ga0265339_10007283 Ga0265339_100072833 292
47 3300031711 Ga0265314_10024977 Ga0265314_100249772 292
48 3300037853 Ga0436364_0687495 Ga0436364_0687495_3575_4471 292
49 3300039437 Ga0436365_1028915 Ga0436365_1028915_3920_4816 292
50 3300045049 Ga0466959_0046414 Ga0466959_0046414_1700_2581 292
51 iso_pu_bacteria 2524023209 2524458849 292
52 iso_pu_bacteria 2842298080 2842298199 292
53 iso_pu_bacteria 2842357229 2842360201 292
54 3300003316 rootH1_10007734 rootH1_100077346 293
55 3300003323 rootH1_10035079 rootH1_100350793 293
56 3300003323 rootH1_10038444 rootH1_100384444 293
57 3300003761 Ga0055535_1000306 Ga0055535_100030610 293
58 3300003763 Ga0055529_1000291 Ga0055529_10002918 293
59 3300005435 Ga0070714_100282953 Ga0070714_1002829531 293
60 3300005563 Ga0068855_100038672 Ga0068855_1000386724 293
61 3300005616 Ga0068852_100589334 Ga0068852_1005893341 293
62 3300009093 Ga0105240_10074300 Ga0105240_100743004 293
63 3300009093 Ga0105240_10081911 Ga0105240_100819114 293
64 3300009093 Ga0105240_10422424 Ga0105240_104224242 293
65 3300009174 Ga0105241_10240114 Ga0105241_102401142 293
66 3300013105 Ga0157369_10012458 Ga0157369_100124586 293
67 3300013307 Ga0157372_10558822 Ga0157372_105588221 293
68 3300021388 Ga0213875_10006897 Ga0213875_100068973 293
69 3300025228 Ga0209672_102555 Ga0209672_1025554 293
70 3300025242 Ga0209258_100180 Ga0209258_10018076 293
71 3300025253 Ga0209677_107548 Ga0209677_1075482 293
72 3300025256 Ga0209759_1002222 Ga0209759_100222210 293
73 3300025272 Ga0209455_1000144 Ga0209455_100014476 293
74 3300025909 Ga0207705_10063913 Ga0207705_100639134 293
75 3300025911 Ga0207654_10001730 Ga0207654_100017301 293
76 3300025913 Ga0207695_10055230 Ga0207695_100552304 293
77 3300025914 Ga0207671_10150659 Ga0207671_101506592 293
78 3300025949 Ga0207667_10004177 Ga0207667_100041776 293
79 3300026041 Ga0207639_10431097 Ga0207639_104310971 293
80 3300026142 Ga0207698_10146987 Ga0207698_101469872 293
81 3300031712 Ga0265342_10155520 Ga0265342_101555202 293
82 3300037418 Ga0395900_0208947 Ga0395900_0208947_769_1653 293
83 3300037466 Ga0395898_0121368 Ga0395898_0121368_933_1817 293
84 3300037853 Ga0436364_0392948 Ga0436364_0392948_2738_3640 293
85 3300037853 Ga0436364_0977931 Ga0436364_0977931_2475_3359 293
86 3300044694 Ga0466963_0048096 Ga0466963_0048096_889_1773 293
87 3300045049 Ga0466959_0184247 Ga0466959_0184247_477_1361 293
88 3300045976 Ga0466967_0009193 Ga0466967_0009193_4464_5348 293
89 3300048929 Ga0496126_0000133 Ga0496126_0000133_9629_10516 293
90 3300048929 Ga0496126_0011000 Ga0496126_0011000_4075_4959 293
91 3300048929 Ga0496126_0057231 Ga0496126_0057231_1748_2635 293
92 3300049581 Ga0501047_0565748 Ga0501047_0565748_51_941 293
93 3300049823 Ga0501044_0504133 Ga0501044_0504133_111_1001 293
94 3300053080 Ga0500635_0000312 Ga0500635_0000312_3534_4421 293
95 iso_pu_bacteria 2881412998 2881415013 293
96 3300003752 Ga0055539_1002404 Ga0055539_10024042 294
97 3300003756 Ga0055533_1000048 Ga0055533_100004867 294
98 3300003756 Ga0055533_1000068 Ga0055533_100006816 294
99 3300005367 Ga0070667_100100160 Ga0070667_1001001601 294
100 3300005455 Ga0070663_100106363 Ga0070663_1001063631 294
101 3300005548 Ga0070665_100033437 Ga0070665_1000334375 294
102 3300005563 Ga0068855_100089237 Ga0068855_1000892373 294
103 3300009093 Ga0105240_10037297 Ga0105240_100372972 294
104 3300009177 Ga0105248_10023472 Ga0105248_100234723 294
105 3300009551 Ga0105238_10024845 Ga0105238_100248456 294
106 3300010375 Ga0105239_10261805 Ga0105239_102618051 294
107 3300013105 Ga0157369_10122936 Ga0157369_101229362 294
108 3300013105 Ga0157369_10357201 Ga0157369_103572012 294
109 3300013306 Ga0163162_10015709 Ga0163162_100157097 294
110 3300013308 Ga0157375_10154823 Ga0157375_101548231 294
111 3300014325 Ga0163163_10009719 Ga0163163_100097194 294
112 3300014325 Ga0163163_10129161 Ga0163163_101291613 294
113 3300014968 Ga0157379_10045057 Ga0157379_100450574 294
114 3300025226 Ga0209674_100024 Ga0209674_100024363 294
115 3300025230 Ga0209563_100101 Ga0209563_10010117 294
116 3300025253 Ga0209677_100091 Ga0209677_10009195 294
117 3300025913 Ga0207695_10039845 Ga0207695_100398455 294
118 3300025925 Ga0207650_10287076 Ga0207650_102870761 294
119 3300025941 Ga0207711_10187877 Ga0207711_101878772 294
120 3300025941 Ga0207711_10373044 Ga0207711_103730441 294
121 3300026142 Ga0207698_10128180 Ga0207698_101281801 294
122 3300031247 Ga0265340_10011204 Ga0265340_100112044 294
123 3300039437 Ga0436365_0847526 Ga0436365_0847526_402_1307 294
124 3300044656 Ga0466969_0109348 Ga0466969_0109348_188_1093 294
125 3300044684 Ga0466966_0044686 Ga0466966_0044686_1580_2485 294
126 3300044719 Ga0466971_0000173 Ga0466971_0000173_11062_11949 294
127 3300044765 Ga0466970_0001909 Ga0466970_0001909_4485_5372 294
128 3300044842 Ga0466957_0001833 Ga0466957_0001833_9373_10260 294
129 3300045049 Ga0466959_0075920 Ga0466959_0075920_751_1656 294
130 3300046459 Ga0495629_0009352 Ga0495629_0009352_4638_5528 294
131 3300046462 Ga0495651_0009528 Ga0495651_0009528_2934_3824 294
132 3300046471 Ga0495650_0000006 Ga0495650_0000006_212253_213242 294
133 3300046473 Ga0495582_0018633 Ga0495582_0018633_2700_3590 294
134 3300046476 Ga0495662_0001828 Ga0495662_0001828_7944_8834 294
135 3300046477 Ga0495664_0016728 Ga0495664_0016728_2863_3753 294
136 3300046477 Ga0495664_0025595 Ga0495664_0025595_1216_2106 294
137 3300046499 Ga0495594_0001835 Ga0495594_0001835_7296_8186 294
138 3300046499 Ga0495594_0002719 Ga0495594_0002719_3289_4179 294
139 3300046516 Ga0495628_0032175 Ga0495628_0032175_3300_4190 294
140 3300046526 Ga0495666_0008629 Ga0495666_0008629_2078_2968 294
141 3300046529 Ga0495652_0040824 Ga0495652_0040824_188_1078 294
142 3300046529 Ga0495652_0057399 Ga0495652_0057399_711_1601 294
143 3300046531 Ga0495665_0001277 Ga0495665_0001277_5462_6352 294
144 3300046533 Ga0495640_0002006 Ga0495640_0002006_6163_7053 294
145 3300046535 Ga0495586_0032193 Ga0495586_0032193_1382_2272 294
146 3300046543 Ga0495645_0011384 Ga0495645_0011384_2642_3532 294
147 3300046543 Ga0495645_0303112 Ga0495645_0303112_36_926 294
148 3300046557 Ga0495622_0012330 Ga0495622_0012330_892_1782 294
149 3300046642 Ga0495634_0006427 Ga0495634_0006427_732_1622 294
150 3300046663 Ga0495635_0002490 Ga0495635_0002490_6504_7394 294
151 3300046678 Ga0495599_0032808 Ga0495599_0032808_751_1641 294
152 3300046680 Ga0495646_0122324 Ga0495646_0122324_374_1264 294
153 3300046683 Ga0495658_0045385 Ga0495658_0045385_1486_2376 294
154 3300046689 Ga0495613_0002416 Ga0495613_0002416_10134_11024 294
155 3300046689 Ga0495613_0009368 Ga0495613_0009368_236_1126 294
156 3300046690 Ga0495624_0014673 Ga0495624_0014673_2627_3517 294
157 3300046809 Ga0495600_0001391 Ga0495600_0001391_8051_8941 294
158 3300047315 Ga0495581_0003390 Ga0495581_0003390_1953_2843 294
159 3300047317 Ga0495604_0005701 Ga0495604_0005701_2505_3395 294
160 3300047317 Ga0495604_0026071 Ga0495604_0026071_421_1311 294
161 3300047319 Ga0495674_0041761 Ga0495674_0041761_1966_2856 294
162 3300047319 Ga0495674_0175236 Ga0495674_0175236_138_1028 294
163 3300047321 Ga0495676_0001653 Ga0495676_0001653_1135_2025 294
164 3300047321 Ga0495676_0119427 Ga0495676_0119427_419_1309 294
165 3300047444 Ga0495675_0096497 Ga0495675_0096497_176_1066 294
166 3300047471 Ga0495684_0063982 Ga0495684_0063982_303_1193 294
167 3300047673 Ga0495593_0106282 Ga0495593_0106282_383_1273 294
168 3300048089 Ga0495614_0000722 Ga0495614_0000722_4860_5750 294
169 3300048908 Ga0496105_0451579 Ga0496105_0451579_32_922 294
170 3300048918 Ga0496115_0070007 Ga0496115_0070007_457_1347 294
171 iso_pu_bacteria 2617270742 2617380730 294
172 iso_pu_bacteria 2818991448 2819608890 294
173 iso_pu_bacteria 3005416602 3005423314 294
174 iso_pu_bacteria 8005314921 8005315640 294
175 iso_pu_bacteria 8005645114 8005647376 294
176 3300005445 Ga0070708_100012375 Ga0070708_1000123755 295
177 3300005536 Ga0070697_100018302 Ga0070697_1000183022 295
178 3300005617 Ga0068859_100448522 Ga0068859_1004485221 295
179 3300006931 Ga0097620_100448496 Ga0097620_1004484962 295
180 3300007076 Ga0075435_100195267 Ga0075435_1001952672 295
181 3300009093 Ga0105240_10047664 Ga0105240_100476643 295
182 3300009545 Ga0105237_10011637 Ga0105237_100116374 295
183 3300010375 Ga0105239_10342853 Ga0105239_103428532 295
184 3300021361 Ga0213872_10011657 Ga0213872_100116572 295
185 3300025913 Ga0207695_10095126 Ga0207695_100951263 295
186 3300025914 Ga0207671_10200955 Ga0207671_102009552 295
187 3300025941 Ga0207711_10107873 Ga0207711_101078733 295
188 3300028577 Ga0265318_10034487 Ga0265318_100344872 295
189 3300031250 Ga0265331_10002766 Ga0265331_100027669 295
190 3300039437 Ga0436365_0144671 Ga0436365_0144671_53_985 295
191 3300039447 Ga0436361_0567140 Ga0436361_0567140_8078_8971 295
192 3300044684 Ga0466966_0004451 Ga0466966_0004451_5976_6884 295
193 3300045049 Ga0466959_0000553 Ga0466959_0000553_18227_19117 295
194 3300005471 Ga0070698_100030563 Ga0070698_1000305635 296
195 3300021441 Ga0213871_10022662 Ga0213871_100226621 296
196 3300041512 Ga0451853_3994339 Ga0451853_3994339_724_1614 296
197 3300044684 Ga0466966_0134586 Ga0466966_0134586_477_1403 296
198 3300046460 Ga0495638_0005482 Ga0495638_0005482_3910_4800 296
199 3300046513 Ga0495616_0000286 Ga0495616_0000286_35231_36121 296
200 3300048905 Ga0496102_0041432 Ga0496102_0041432_2451_3344 296
201 3300048919 Ga0496116_0005249 Ga0496116_0005249_2385_3278 296
202 3300048920 Ga0496117_0000012 Ga0496117_0000012_151644_152537 296
203 3300048921 Ga0496118_0000003 Ga0496118_0000003_556036_556929 296
204 3300048922 Ga0496119_0003373 Ga0496119_0003373_13527_14420 296
205 3300048923 Ga0496120_0140685 Ga0496120_0140685_15_908 296
206 3300048924 Ga0496121_0023873 Ga0496121_0023873_3218_4111 296
207 3300048924 Ga0496121_0202125 Ga0496121_0202125_94_987 296
208 3300048928 Ga0496125_0098619 Ga0496125_0098619_325_1218 296
209 3300048929 Ga0496126_0043234 Ga0496126_0043234_1368_2261 296
210 3300053136 Ga0500559_0009365 Ga0500559_0009365_2199_3089 296
211 3300053731 Ga0500609_004895 Ga0500609_004895_100_990 296
212 3300021361 Ga0213872_10000352 Ga0213872_1000035240 297
213 3300032004 Ga0307414_10088963 Ga0307414_100889632 297
214 3300037853 Ga0436364_1499487 Ga0436364_1499487_4626_5534 297
215 3300046452 Ga0495617_001995 Ga0495617_001995_5805_6704 297
216 3300046492 Ga0495585_0000007 Ga0495585_0000007_173166_174062 297
217 3300046506 Ga0495583_0062393 Ga0495583_0062393_262_1158 297
218 3300049744 Ga0501083_0012937 Ga0501083_0012937_2121_3014 297
219 3300053156 Ga0500622_0021616 Ga0500622_0021616_1831_2736 297
220 3300054114 Ga0501084_0019974 Ga0501084_0019974_4517_5410 297
221 3300060353 Ga0501082_0024850 Ga0501082_0024850_984_1877 297
222 3300002704 JGI25155J39150_1000191 JGI25155J39150_100019115 298
223 3300002705 JGI25156J39149_1000430 JGI25156J39149_100043016 298
224 3300002738 JGI25154J39366_1000018 JGI25154J39366_1000018247 298
225 3300002741 JGI25157J39369_1000074 JGI25157J39369_100007473 298
226 3300003322 rootL2_10007895 rootL2_100078958 298
227 3300003323 rootH1_10183421 rootH1_101834214 298
228 3300005434 Ga0070709_10182185 Ga0070709_101821852 298
229 3300005436 Ga0070713_100135377 Ga0070713_1001353773 298
230 3300005439 Ga0070711_100019879 Ga0070711_1000198795 298
231 3300006028 Ga0070717_10098765 Ga0070717_100987653 298
232 3300006173 Ga0070716_100176849 Ga0070716_1001768492 298
233 3300021361 Ga0213872_10051856 Ga0213872_100518561 298
234 3300021361 Ga0213872_10126100 Ga0213872_101261001 298
235 3300021384 Ga0213876_10002722 Ga0213876_100027223 298
236 3300025206 Ga0209435_100044 Ga0209435_10004484 298
237 3300025246 Ga0209646_1000151 Ga0209646_100015184 298
238 3300025250 Ga0209026_1000170 Ga0209026_100017084 298
239 3300025256 Ga0209759_1000186 Ga0209759_100018686 298
240 3300025939 Ga0207665_10018083 Ga0207665_100180834 298
241 3300037853 Ga0436364_0660405 Ga0436364_0660405_195_1109 298
242 3300039437 Ga0436365_0323393 Ga0436365_0323393_1845_2756 298
243 3300039438 Ga0436360_0043287 Ga0436360_0043287_495_1406 298
244 3300039438 Ga0436360_1218577 Ga0436360_1218577_2404_3315 298
245 3300039447 Ga0436361_0128555 Ga0436361_0128555_672_1583 298
246 3300039447 Ga0436361_0964227 Ga0436361_0964227_1382_2293 298
247 3300045836 Ga0466958_0214104 Ga0466958_0214104_199_1095 298
248 3300045976 Ga0466967_0087553 Ga0466967_0087553_388_1284 298
249 3300048921 Ga0496118_0060289 Ga0496118_0060289_334_1242 298
250 3300048924 Ga0496121_0002861 Ga0496121_0002861_20846_21754 298
251 3300048929 Ga0496126_0387493 Ga0496126_0387493_101_1009 298
252 3300049570 Ga0501033_0004336 Ga0501033_0004336_562_1458 298
253 3300049823 Ga0501044_0243729 Ga0501044_0243729_784_1680 298
254 3300053119 Ga0500595_067498 Ga0500595_067498_85_993 298

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05368

NmrA

NmrA-like family

26

113

0.9

PF04321

RmlD_sub_bind

RmlD substrate binding domain

24

281

0.84

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

26

242

0.83

PF13460

NAD_binding_10

NAD(P)H-binding

30

209

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6u5n-assembly1.cif.gz_E calcium-bound mthk gating ring state 2 0.8573 2 110
6s2j-assembly1.cif.gz_A square conformation of ktra r16k mutant ring with bound atp 0.8563 2 109
8hye-assembly1.cif.gz_A-2 structure of amino acid dehydrogenase-2752 with ligand 0.8375 2 69
6s7r-assembly2.cif.gz_P non-square conformations of ktra r16a mutant rings with bound adp 0.8363 2 108
6s5e-assembly1.cif.gz_E-4 non-square conformation of ktra a80p mutant ring with bound atp 0.8317 2 108
ID Description Score Start End Superfamily
af_Q9Y7K4_1_260_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9586 1 261 3.40.50.720
af_Q9Y7K4_1_260_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.955 1 261 3.40.50.720
af_Q12177_1_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9475 1 259 3.40.50.720
af_Q12177_1_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9335 1 259 3.40.50.720
af_A0A0P0VRA9_18_110_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9064 2 74 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4Q6CMB8-F1-model_v4 deleted 0.9849 1 83
AF-A0A6M1HX33-F1-model_v4 deleted 0.9791 139 294
AF-A0A366DLH4-F1-model_v4 Nucleoside-diphosphate-sugar epimerase 0.9703 1 295 GO:0004029
GO:0005737
AF-A0A4Y3TQQ8-F1-model_v4 NAD-dependent dehydratase 0.9699 1 293 GO:0004029
GO:0005737
AF-A0A366DLH4-F1-model_v4 Nucleoside-diphosphate-sugar epimerase 0.9671 1 295 GO:0004029
GO:0005737

Feature Viewer

pLDDT pTM Quality
95.22 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map