F364865

General Info

Members Datasets Scaffolds Average Seq Length
254 147 508 171

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10897151|Ga0157370_108971511
Length 169
Sequence MINDYEAKKPITTDAEPLTDTKTASNDDVISILNGLIETCKDGQEGFQTAAEGIERSDLKSLFYEFSQQRAQFAGELQSLVQTLGGDPENAGSFSGALHRGWINIKNALGGGEKAILDEAERGEDVAVKSFEKALKEDLPADLASIVRRQYDQVKQAHDRVRDLRDSWK

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
68 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
111 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
116 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
117 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
118 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
133 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
134 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
135 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
136 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
137 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
138 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
139 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
140 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
141 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
142 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
143 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
144 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
145 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
146 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
147 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.55
Metatranscriptomes 9.06
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 98.43
Stem 0
Stem Tuber 0
Unclassified 31.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10897151 3300013104 Bacteria 805
2 Ga0007429J51699_1077174 3300003579 Unclassified 612
3 Ga0007429J51699_1132433 3300003579 Unclassified 586
4 Ga0032354_1030418 3300003693 Unclassified 529
5 Ga0065712_10057314 3300005290 Unclassified 674
6 Ga0070676_10304820 3300005328 Bacteria 1081
7 Ga0070683_100561756 3300005329 Bacteria 1091
8 Ga0070670_100045965 3300005331 Unclassified 3754
9 Ga0070670_100652460 3300005331 Unclassified 944
10 Ga0070670_101033449 3300005331 Unclassified 748
11 Ga0070680_100041626 3300005336 Unclassified 3725
12 Ga0070680_100726831 3300005336 Bacteria 854
13 Ga0070660_100036529 3300005339 Bacteria 3721
14 Ga0070660_100232325 3300005339 Bacteria 1501
15 Ga0070687_100769956 3300005343 Bacteria 679
16 Ga0070661_100340493 3300005344 Unclassified 1175
17 Ga0070668_100367701 3300005347 Bacteria 1221
18 Ga0070668_100403661 3300005347 Unclassified 1167
19 Ga0070675_100150605 3300005354 Bacteria 1994
20 Ga0070671_100291384 3300005355 Bacteria 1389
21 Ga0070671_100824452 3300005355 Unclassified 808
22 Ga0070674_100161343 3300005356 Unclassified 1701
23 Ga0070674_100613949 3300005356 Unclassified 920
24 Ga0070674_100676814 3300005356 Unclassified 880
25 Ga0070673_100933424 3300005364 Unclassified 806
26 Ga0070688_100108806 3300005365 Bacteria 1839
27 Ga0070688_100463730 3300005365 Bacteria 949
28 Ga0070659_100009761 3300005366 Bacteria 7055
29 Ga0070667_100013057 3300005367 Bacteria 6866
30 Ga0070667_100060178 3300005367 Unclassified 3214
31 Ga0070667_100814835 3300005367 Bacteria 867
32 Ga0070663_100325171 3300005455 Bacteria 1238
33 Ga0070681_10570089 3300005458 Bacteria 1046
34 Ga0070679_100072270 3300005530 Bacteria 3442
35 Ga0070679_100106980 3300005530 Bacteria 2782
36 Ga0070679_101005659 3300005530 Bacteria 778
37 Ga0068853_100000482 3300005539 Bacteria 27172
38 Ga0070672_100017683 3300005543 Bacteria 5136
39 Ga0070672_100836368 3300005543 Unclassified 811
40 Ga0070686_100364177 3300005544 Bacteria 1090
41 Ga0070695_100141482 3300005545 Bacteria 1669
42 Ga0070696_101119946 3300005546 Unclassified 662
43 Ga0070693_100663918 3300005547 Unclassified 759
44 Ga0070704_100019714 3300005549 Bacteria 4338
45 Ga0068855_100182696 3300005563 Bacteria 2370
46 Ga0068855_100533693 3300005563 Unclassified 1272
47 Ga0070664_100109972 3300005564 Bacteria 2404
48 Ga0070664_100195505 3300005564 Unclassified 1803
49 Ga0070664_100513131 3300005564 Bacteria 1106
50 Ga0068857_100029060 3300005577 Bacteria 4878
51 Ga0068857_100270861 3300005577 Bacteria 1560
52 Ga0068854_100135176 3300005578 Bacteria 1887
53 Ga0068852_100871406 3300005616 Bacteria 917
54 Ga0068859_100016603 3300005617 Bacteria 7391
55 Ga0068859_100038288 3300005617 Bacteria 4811
56 Ga0068859_101027892 3300005617 Unclassified 905
57 Ga0068864_100336587 3300005618 Bacteria 1421
58 Ga0068861_100366069 3300005719 Unclassified 1269
59 Ga0068861_100490835 3300005719 Unclassified 1108
60 Ga0068851_10025327 3300005834 Bacteria 2910
61 Ga0068863_100095830 3300005841 Bacteria 2817
62 Ga0068863_100198381 3300005841 Bacteria 1930
63 Ga0068858_100330137 3300005842 Bacteria 1459
64 Ga0068858_100335589 3300005842 Bacteria 1446
65 Ga0068858_100622185 3300005842 Unclassified 1048
66 Ga0068860_100011583 3300005843 Bacteria 8695
67 Ga0068862_100043044 3300005844 Unclassified 3849
68 Ga0068862_100177787 3300005844 Bacteria 1909
69 Ga0097621_100055322 3300006237 Bacteria 3240
70 Ga0068871_100293543 3300006358 Bacteria 1425
71 Ga0075434_100170965 3300006871 Unclassified 2193
72 Ga0097620_100016603 3300006931 Bacteria 7391
73 Ga0097620_100038288 3300006931 Bacteria 4811
74 Ga0097620_101027848 3300006931 Unclassified 905
75 Ga0105240_10467513 3300009093 Unclassified 1408
76 Ga0105243_10057026 3300009148 Bacteria 3109
77 Ga0105241_10036431 3300009174 Bacteria 3702
78 Ga0105242_10863865 3300009176 Bacteria 901
79 Ga0105237_10077140 3300009545 Bacteria 3322
80 Ga0105238_10482277 3300009551 Unclassified 1239
81 Ga0105238_11037495 3300009551 Bacteria 841
82 Ga0105249_10066311 3300009553 Unclassified 3323
83 Ga0105249_10155613 3300009553 Bacteria 2204
84 Ga0105249_10365587 3300009553 Unclassified 1465
85 Ga0105249_10615649 3300009553 Bacteria 1141
86 Ga0105239_10048493 3300010375 Bacteria 4657
87 Ga0105239_10242934 3300010375 Bacteria 2021
88 Ga0157373_10047263 3300013100 Bacteria 3070
89 Ga0157369_10627445 3300013105 Unclassified 1109
90 Ga0157372_10071867 3300013307 Bacteria 3898
91 Ga0157372_10289086 3300013307 Bacteria 1906
92 Ga0157372_10434590 3300013307 Bacteria 1530
93 Ga0157372_10578750 3300013307 Bacteria 1309
94 Ga0157375_10409834 3300013308 Bacteria 1522
95 Ga0157375_10474062 3300013308 Bacteria 1417
96 Ga0163163_10040099 3300014325 Bacteria 4571
97 Ga0163163_10063411 3300014325 Unclassified 3664
98 Ga0163163_11368801 3300014325 Bacteria 769
99 Ga0157380_10466321 3300014326 Unclassified 1217
100 Ga0157380_10559146 3300014326 Bacteria 1124
101 Ga0157376_10036680 3300014969 Bacteria 3973
102 Ga0157376_10528008 3300014969 Bacteria 1164
103 Ga0163161_10003568 3300017792 Bacteria 10896
104 Ga0206356_10229117 3300020070 Unclassified 713
105 Ga0206351_10634771 3300020077 Unclassified 691
106 Ga0206352_10169742 3300020078 Bacteria 1037
107 Ga0206353_10067419 3300020082 Bacteria 641
108 Ga0213875_10331661 3300021388 Bacteria 722
109 Ga0224712_10420187 3300022467 Bacteria 639
110 Ga0224712_10517080 3300022467 Unclassified 578
111 Ga0207656_10063322 3300025321 Bacteria 1627
112 Ga0207654_10126429 3300025911 Bacteria 1612
113 Ga0207707_10007147 3300025912 Bacteria 9721
114 Ga0207671_10236811 3300025914 Unclassified 1433
115 Ga0207671_10812830 3300025914 Unclassified 741
116 Ga0207657_10267590 3300025919 Bacteria 1359
117 Ga0207652_10932192 3300025921 Bacteria 766
118 Ga0207650_10197946 3300025925 Bacteria 1608
119 Ga0207650_10846527 3300025925 Unclassified 776
120 Ga0207644_10989491 3300025931 Unclassified 706
121 Ga0207669_10135737 3300025937 Unclassified 1699
122 Ga0207669_10599544 3300025937 Unclassified 895
123 Ga0207691_10068269 3300025940 Bacteria 3212
124 Ga0207691_11313953 3300025940 Unclassified 597
125 Ga0207711_10424580 3300025941 Unclassified 1237
126 Ga0207661_10578842 3300025944 Bacteria 1030
127 Ga0207679_10187456 3300025945 Bacteria 1716
128 Ga0207679_10639469 3300025945 Unclassified 961
129 Ga0207679_10944847 3300025945 Unclassified 789
130 Ga0207667_10363685 3300025949 Unclassified 1475
131 Ga0207651_10316248 3300025960 Unclassified 1304
132 Ga0207651_11061018 3300025960 Unclassified 725
133 Ga0207712_10186454 3300025961 Unclassified 1634
134 Ga0207712_10247212 3300025961 Bacteria 1440
135 Ga0207668_10280675 3300025972 Bacteria 1366
136 Ga0207668_10343664 3300025972 Unclassified 1245
137 Ga0207640_10301207 3300025981 Bacteria 1268
138 Ga0207658_10547785 3300025986 Bacteria 1035
139 Ga0207658_10685882 3300025986 Bacteria 925
140 Ga0207703_10151785 3300026035 Bacteria 2021
141 Ga0207703_10705738 3300026035 Unclassified 959
142 Ga0207639_10456832 3300026041 Bacteria 1160
143 Ga0207678_10032955 3300026067 Bacteria 4514
144 Ga0207641_10974395 3300026088 Bacteria 844
145 Ga0207648_10066925 3300026089 Unclassified 3133
146 Ga0207676_10066312 3300026095 Bacteria 2878
147 Ga0207676_10294421 3300026095 Bacteria 1479
148 Ga0207674_10003150 3300026116 Bacteria 20333
149 Ga0207674_10021997 3300026116 Bacteria 6858
150 Ga0207698_10780147 3300026142 Bacteria 956
151 Ga0265327_10006911 3300031251 Bacteria 8921
152 Ga0307513_10036448 3300031456 Bacteria 5486
153 Ga0307408_100006599 3300031548 Bacteria 7695
154 Ga0307408_100072685 3300031548 Bacteria 2547
155 Ga0307408_100080488 3300031548 Bacteria 2433
156 Ga0307408_100346986 3300031548 Unclassified 1258
157 Ga0307408_102487145 3300031548 Bacteria 503
158 Ga0307405_10007172 3300031731 Bacteria 5547
159 Ga0307405_10010291 3300031731 Bacteria 4836
160 Ga0307405_10035239 3300031731 Bacteria 2987
161 Ga0307413_10000758 3300031824 Bacteria 11147
162 Ga0307413_10014165 3300031824 Bacteria 4038
163 Ga0307413_10014682 3300031824 Bacteria 3988
164 Ga0307413_10085214 3300031824 Bacteria 2039
165 Ga0307413_10228421 3300031824 Unclassified 1365
166 Ga0307413_11517836 3300031824 Unclassified 593
167 Ga0307410_10004059 3300031852 Bacteria 7486
168 Ga0307410_10027217 3300031852 Bacteria 3611
169 Ga0307410_11143090 3300031852 Bacteria 676
170 Ga0307406_10002992 3300031901 Bacteria 9203
171 Ga0307406_10005564 3300031901 Bacteria 6894
172 Ga0307406_10007651 3300031901 Bacteria 6000
173 Ga0307406_10322346 3300031901 Unclassified 1196
174 Ga0307407_10000937 3300031903 Bacteria 9895
175 Ga0307407_10048953 3300031903 Bacteria 2409
176 Ga0307407_10932133 3300031903 Bacteria 668
177 Ga0307412_10005740 3300031911 Bacteria 6977
178 Ga0307412_10012789 3300031911 Bacteria 4900
179 Ga0307412_10013554 3300031911 Bacteria 4784
180 Ga0307409_100000215 3300031995 Bacteria 23051
181 Ga0307409_100014672 3300031995 Bacteria 5107
182 Ga0307409_100050163 3300031995 Bacteria 3186
183 Ga0307409_100051316 3300031995 Bacteria 3156
184 Ga0307409_100205688 3300031995 Bacteria 1765
185 Ga0307409_100655019 3300031995 Bacteria 1044
186 Ga0307409_100803082 3300031995 Bacteria 948
187 Ga0307416_100006974 3300032002 Bacteria 7124
188 Ga0307416_100205971 3300032002 Bacteria 1871
189 Ga0307416_101133023 3300032002 Unclassified 887
190 Ga0307414_10013957 3300032004 Bacteria 4798
191 Ga0307414_10036341 3300032004 Bacteria 3288
192 Ga0307414_10310019 3300032004 Bacteria 1339
193 Ga0307414_10677331 3300032004 Unclassified 932
194 Ga0307414_11560751 3300032004 Unclassified 615
195 Ga0307411_10000579 3300032005 Bacteria 13082
196 Ga0307411_10022942 3300032005 Bacteria 3685
197 Ga0307411_10078575 3300032005 Bacteria 2262
198 Ga0307411_10160124 3300032005 Bacteria 1684
199 Ga0307411_10232572 3300032005 Bacteria 1438
200 Ga0307411_11358941 3300032005 Unclassified 649
201 Ga0307411_12238107 3300032005 Bacteria 513
202 Ga0307415_100008847 3300032126 Bacteria 5607
203 Ga0307415_100015061 3300032126 Bacteria 4567
204 Ga0307415_100030052 3300032126 Bacteria 3480
205 Ga0307415_100088043 3300032126 Bacteria 2239
206 Ga0307415_100241773 3300032126 Bacteria 1461
207 Ga0307415_100416834 3300032126 Bacteria 1151
208 Ga0307415_100520083 3300032126 Bacteria 1044
209 Ga0307415_101282252 3300032126 Bacteria 693
210 Ga0373928_0039195 3300035084 Bacteria 1082
211 Ga0373962_0410041 3300035242 Unclassified 500
212 Ga0395899_0506925 3300037312 Unclassified 782
213 Ga0436364_1006179 3300037853 Bacteria 1789
214 Ga0395901_0476384 3300038443 Bacteria 1274
215 Ga0436362_0095885 3300039453 Unclassified 587
216 Ga0436362_0625624 3300039453 Unclassified 1544
217 Ga0451837_1291848 3300041494 Bacteria 4364
218 Ga0495661_0468878 3300046665 Unclassified 604
219 Ga0501306_075972 3300049127 Bacteria 573
220 Ga0501308_068358 3300049128 Unclassified 548
221 Ga0501309_071220 3300049129 Bacteria 572
222 Ga0501310_033054 3300049130 Bacteria 694
223 Ga0501305_103492 3300049161 Bacteria 532
224 Ga0501312_083832 3300049528 Bacteria 580
225 Ga0501316_057096 3300049532 Unclassified 571
226 Ga0501317_077237 3300049533 Unclassified 571
227 Ga0501320_037984 3300049536 Bacteria 622
228 Ga0501321_061316 3300049537 Bacteria 569
229 Ga0501323_066679 3300049539 Bacteria 570
230 Ga0501324_032112 3300049540 Unclassified 576
231 Ga0501330_021818 3300049546 Unclassified 519
232 Ga0501334_16856 3300049550 Bacteria 567
233 Ga0501073_0709977 3300049589 Unclassified 694
234 Ga0501073_0905540 3300049589 Bacteria 607
235 Ga0501202_123532 3300049652 Bacteria 653
236 Ga0501223_024698 3300049663 Bacteria 1169
237 Ga0501223_047133 3300049663 Unclassified 836
238 Ga0501235_009866 3300049669 Bacteria 2089
239 Ga0501239_012009 3300049672 Bacteria 975
240 Ga0501243_064989 3300049675 Unclassified 683
241 Ga0501247_016451 3300049677 Bacteria 930
242 Ga0501249_019957 3300049679 Bacteria 1456
243 Ga0501221_079646 3300049704 Unclassified 786
244 Ga0501225_0036698 3300049705 Bacteria 1351
245 Ga0495601_0016254 3300053077 Unclassified 4509
246 Ga0590071_003004 3300059421 Bacteria 4188
247 Ga0590071_049825 3300059421 Unclassified 1014
248 Ga0590074_000594 3300059423 Bacteria 5452
249 Ga0590074_024891 3300059423 Bacteria 1042
250 Ga0590075_000074 3300059424 Bacteria 25445
251 Ga0590075_002833 3300059424 Bacteria 4139
252 Ga0590077_000056 3300059426 Bacteria 27300
253 Ga0590077_028558 3300059426 Unclassified 1212
254 2910247694 2910245624 Bacteria 6935613
255 Ga0157370_10897151
256 Ga0007429J51699_1077174
257 Ga0007429J51699_1132433
258 Ga0032354_1030418
259 Ga0065712_10057314
260 Ga0070676_10304820
261 Ga0070683_100561756
262 Ga0070670_100045965
263 Ga0070670_100652460
264 Ga0070670_101033449
265 Ga0070680_100041626
266 Ga0070680_100726831
267 Ga0070660_100036529
268 Ga0070660_100232325
269 Ga0070687_100769956
270 Ga0070661_100340493
271 Ga0070668_100367701
272 Ga0070668_100403661
273 Ga0070675_100150605
274 Ga0070671_100291384
275 Ga0070671_100824452
276 Ga0070674_100161343
277 Ga0070674_100613949
278 Ga0070674_100676814
279 Ga0070673_100933424
280 Ga0070688_100108806
281 Ga0070688_100463730
282 Ga0070659_100009761
283 Ga0070667_100013057
284 Ga0070667_100060178
285 Ga0070667_100814835
286 Ga0070663_100325171
287 Ga0070681_10570089
288 Ga0070679_100072270
289 Ga0070679_100106980
290 Ga0070679_101005659
291 Ga0068853_100000482
292 Ga0070672_100017683
293 Ga0070672_100836368
294 Ga0070686_100364177
295 Ga0070695_100141482
296 Ga0070696_101119946
297 Ga0070693_100663918
298 Ga0070704_100019714
299 Ga0068855_100182696
300 Ga0068855_100533693
301 Ga0070664_100109972
302 Ga0070664_100195505
303 Ga0070664_100513131
304 Ga0068857_100029060
305 Ga0068857_100270861
306 Ga0068854_100135176
307 Ga0068852_100871406
308 Ga0068859_100016603
309 Ga0068859_100038288
310 Ga0068859_101027892
311 Ga0068864_100336587
312 Ga0068861_100366069
313 Ga0068861_100490835
314 Ga0068851_10025327
315 Ga0068863_100095830
316 Ga0068863_100198381
317 Ga0068858_100330137
318 Ga0068858_100335589
319 Ga0068858_100622185
320 Ga0068860_100011583
321 Ga0068862_100043044
322 Ga0068862_100177787
323 Ga0097621_100055322
324 Ga0068871_100293543
325 Ga0075434_100170965
326 Ga0097620_100016603
327 Ga0097620_100038288
328 Ga0097620_101027848
329 Ga0105240_10467513
330 Ga0105243_10057026
331 Ga0105241_10036431
332 Ga0105242_10863865
333 Ga0105237_10077140
334 Ga0105238_10482277
335 Ga0105238_11037495
336 Ga0105249_10066311
337 Ga0105249_10155613
338 Ga0105249_10365587
339 Ga0105249_10615649
340 Ga0105239_10048493
341 Ga0105239_10242934
342 Ga0157373_10047263
343 Ga0157369_10627445
344 Ga0157372_10071867
345 Ga0157372_10289086
346 Ga0157372_10434590
347 Ga0157372_10578750
348 Ga0157375_10409834
349 Ga0157375_10474062
350 Ga0163163_10040099
351 Ga0163163_10063411
352 Ga0163163_11368801
353 Ga0157380_10466321
354 Ga0157380_10559146
355 Ga0157376_10036680
356 Ga0157376_10528008
357 Ga0163161_10003568
358 Ga0206356_10229117
359 Ga0206351_10634771
360 Ga0206352_10169742
361 Ga0206353_10067419
362 Ga0213875_10331661
363 Ga0224712_10420187
364 Ga0224712_10517080
365 Ga0207656_10063322
366 Ga0207654_10126429
367 Ga0207707_10007147
368 Ga0207671_10236811
369 Ga0207671_10812830
370 Ga0207657_10267590
371 Ga0207652_10932192
372 Ga0207650_10197946
373 Ga0207650_10846527
374 Ga0207644_10989491
375 Ga0207669_10135737
376 Ga0207669_10599544
377 Ga0207691_10068269
378 Ga0207691_11313953
379 Ga0207711_10424580
380 Ga0207661_10578842
381 Ga0207679_10187456
382 Ga0207679_10639469
383 Ga0207679_10944847
384 Ga0207667_10363685
385 Ga0207651_10316248
386 Ga0207651_11061018
387 Ga0207712_10186454
388 Ga0207712_10247212
389 Ga0207668_10280675
390 Ga0207668_10343664
391 Ga0207640_10301207
392 Ga0207658_10547785
393 Ga0207658_10685882
394 Ga0207703_10151785
395 Ga0207703_10705738
396 Ga0207639_10456832
397 Ga0207678_10032955
398 Ga0207641_10974395
399 Ga0207648_10066925
400 Ga0207676_10066312
401 Ga0207676_10294421
402 Ga0207674_10003150
403 Ga0207674_10021997
404 Ga0207698_10780147
405 Ga0265327_10006911
406 Ga0307513_10036448
407 Ga0307408_100006599
408 Ga0307408_100072685
409 Ga0307408_100080488
410 Ga0307408_100346986
411 Ga0307408_102487145
412 Ga0307405_10007172
413 Ga0307405_10010291
414 Ga0307405_10035239
415 Ga0307413_10000758
416 Ga0307413_10014165
417 Ga0307413_10014682
418 Ga0307413_10085214
419 Ga0307413_10228421
420 Ga0307413_11517836
421 Ga0307410_10004059
422 Ga0307410_10027217
423 Ga0307410_11143090
424 Ga0307406_10002992
425 Ga0307406_10005564
426 Ga0307406_10007651
427 Ga0307406_10322346
428 Ga0307407_10000937
429 Ga0307407_10048953
430 Ga0307407_10932133
431 Ga0307412_10005740
432 Ga0307412_10012789
433 Ga0307412_10013554
434 Ga0307409_100000215
435 Ga0307409_100014672
436 Ga0307409_100050163
437 Ga0307409_100051316
438 Ga0307409_100205688
439 Ga0307409_100655019
440 Ga0307409_100803082
441 Ga0307416_100006974
442 Ga0307416_100205971
443 Ga0307416_101133023
444 Ga0307414_10013957
445 Ga0307414_10036341
446 Ga0307414_10310019
447 Ga0307414_10677331
448 Ga0307414_11560751
449 Ga0307411_10000579
450 Ga0307411_10022942
451 Ga0307411_10078575
452 Ga0307411_10160124
453 Ga0307411_10232572
454 Ga0307411_11358941
455 Ga0307411_12238107
456 Ga0307415_100008847
457 Ga0307415_100015061
458 Ga0307415_100030052
459 Ga0307415_100088043
460 Ga0307415_100241773
461 Ga0307415_100416834
462 Ga0307415_100520083
463 Ga0307415_101282252
464 Ga0373928_0039195
465 Ga0373962_0410041
466 Ga0395899_0506925
467 Ga0436364_1006179
468 Ga0395901_0476384
469 Ga0436362_0095885
470 Ga0436362_0625624
471 Ga0451837_1291848
472 Ga0495661_0468878
473 Ga0501306_075972
474 Ga0501308_068358
475 Ga0501309_071220
476 Ga0501310_033054
477 Ga0501305_103492
478 Ga0501312_083832
479 Ga0501316_057096
480 Ga0501317_077237
481 Ga0501320_037984
482 Ga0501321_061316
483 Ga0501323_066679
484 Ga0501324_032112
485 Ga0501330_021818
486 Ga0501334_16856
487 Ga0501073_0709977
488 Ga0501073_0905540
489 Ga0501202_123532
490 Ga0501223_024698
491 Ga0501223_047133
492 Ga0501235_009866
493 Ga0501239_012009
494 Ga0501243_064989
495 Ga0501247_016451
496 Ga0501249_019957
497 Ga0501221_079646
498 Ga0501225_0036698
499 Ga0495601_0016254
500 Ga0590071_003004
501 Ga0590071_049825
502 Ga0590074_000594
503 Ga0590074_024891
504 Ga0590075_000074
505 Ga0590075_002833
506 Ga0590077_000056
507 Ga0590077_028558
508 2910247694

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09537

DUF2383

Domain of unknown function (DUF2383)

28

137

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4etr-assembly2.cif.gz_B x-ray structure of pa2169 from pseudomonas aeruginosa 0.9585 24 168
4etr-assembly1.cif.gz_A x-ray structure of pa2169 from pseudomonas aeruginosa 0.9581 24 168
4etr-assembly2.cif.gz_B x-ray structure of pa2169 from pseudomonas aeruginosa 0.9434 24 168
4etr-assembly1.cif.gz_A x-ray structure of pa2169 from pseudomonas aeruginosa 0.9428 24 168
3fse-assembly1.cif.gz_A crystal structure of a two-domain protein containing dj-1/thij/pfpi-like and ferritin-like domains (ava_4496) from anabaena variabilis atcc 29413 at 1.90 a resolution 0.9083 22 170
ID Description Score Start End Superfamily
3vkgB03 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Dynein motor heavy chain, linker domain, subdomain 4 0.977 114 165 1.20.58.1120
af_Q9C0G6_1303_1448_1.20.58.1120 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Dynein motor heavy chain, linker domain, subdomain 4 0.9624 112 168 1.20.58.1120
af_Q4CYB4_1172_1308_1.20.58.1120 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Dynein motor heavy chain, linker domain, subdomain 4 0.9624 114 167 1.20.58.1120
4etrB00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9585 24 168 1.20.1260.10
4etrA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9581 24 168 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A0Q8P7M0-F1-model_v4 Aldehyde dehydrogenase 0.9726 23 167
AF-A0A1H4AK67-F1-model_v4 DUF2383 domain-containing protein 0.9596 25 167
AF-A0A6J4KFG6-F1-model_v4 DUF2383 domain-containing protein 0.9584 25 169
AF-A0A7V9DCN8-F1-model_v4 PA2169 family four-helix-bundle protein 0.954 17 174
AF-A0A841EI80-F1-model_v4 Uncharacterized protein (TIGR02284 family) 0.9531 26 174

Map