F364701

General Info

Members Datasets Scaffolds Average Seq Length
254 163 508 239

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100179316|Ga0070707_1001793162
Length 254
Sequence VKPFPPHLPLSGEPDNTVTDVSKSPDRIASMFDAIAGRYDLLNHLLSVGIDRRWRKRAIRSLQLTGRERVLDLCTGTGDLAIAAMRARPPARRVVGVDFAGAMLRVGRDKLQRERLDDRIALVRGDAVRVPVADASIDAVTIAFGIRNVEHVALACAEMQRVLAPGGRLAILEFAVPTTPCLSALYLWYLRHVLPKIGGAVSRHSAAYGYLPASIGAFATPDEFVKILRQAGFSEIAATRLTFGSVILYTARRD

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
96 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
99 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
100 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
101 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
102 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
103 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
104 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
105 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
107 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
108 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
109 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
110 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
111 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
114 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
117 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
118 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
121 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
122 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
123 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
124 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
125 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
126 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
127 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
128 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
129 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
140 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
143 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
144 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
147 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
148 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
149 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
150 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
151 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
152 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
153 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
154 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
155 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
156 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
157 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
158 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
159 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
160 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
161 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
162 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.51
Nodule 0
Rhizoplane 1.97
Rhizosphere 88.58
Stem 0
Stem Tuber 0
Unclassified 13.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100179316 3300005468 Bacteria 2065
2 rootH1_10131190 3300003323 Bacteria 10470
3 Ga0070658_10234025 3300005327 Bacteria 1556
4 Ga0070683_100114355 3300005329 Bacteria 2547
5 Ga0070690_100020555 3300005330 Bacteria 4023
6 Ga0070670_100682785 3300005331 Bacteria 923
7 Ga0070677_10036427 3300005333 Bacteria 1914
8 Ga0068869_100104990 3300005334 Bacteria 2142
9 Ga0068869_100305487 3300005334 Bacteria 1286
10 Ga0068869_100578057 3300005334 Bacteria 947
11 Ga0070666_10008944 3300005335 Bacteria 6236
12 Ga0070666_10045661 3300005335 Bacteria 2937
13 Ga0070666_10374930 3300005335 Unclassified 1021
14 Ga0070666_10424549 3300005335 Bacteria 958
15 Ga0070689_100047696 3300005340 Bacteria 3303
16 Ga0070687_100008392 3300005343 Bacteria 4375
17 Ga0070692_10084777 3300005345 Bacteria 1713
18 Ga0070669_100006383 3300005353 Bacteria 8492
19 Ga0070671_100018548 3300005355 Bacteria 5652
20 Ga0070674_100008928 3300005356 Bacteria 5987
21 Ga0070673_100064084 3300005364 Bacteria 2927
22 Ga0070673_100120304 3300005364 Bacteria 2190
23 Ga0070688_100067106 3300005365 Bacteria 2284
24 Ga0070659_100224377 3300005366 Bacteria 1552
25 Ga0070667_100092483 3300005367 Unclassified 2602
26 Ga0070667_100740167 3300005367 Bacteria 911
27 Ga0070701_10246528 3300005438 Bacteria 1077
28 Ga0070705_100056522 3300005440 Unclassified 2311
29 Ga0068867_100187878 3300005459 Bacteria 1647
30 Ga0068867_100688066 3300005459 Unclassified 901
31 Ga0070685_10255228 3300005466 Unclassified 1163
32 Ga0070699_100180710 3300005518 Bacteria 1872
33 Ga0070684_100845328 3300005535 Bacteria 857
34 Ga0070697_100398469 3300005536 Bacteria 1194
35 Ga0070672_100194519 3300005543 Bacteria 1694
36 Ga0070672_100250390 3300005543 Bacteria 1492
37 Ga0070686_100140026 3300005544 Bacteria 1683
38 Ga0070686_100342319 3300005544 Bacteria 1121
39 Ga0070695_100112614 3300005545 Unclassified 1849
40 Ga0070665_100003106 3300005548 Bacteria 17884
41 Ga0070665_100010290 3300005548 Bacteria 9465
42 Ga0070665_100070519 3300005548 Bacteria 3502
43 Ga0068856_100015771 3300005614 Bacteria 7307
44 Ga0068852_100168778 3300005616 Bacteria 2049
45 Ga0068859_100137407 3300005617 Unclassified 2518
46 Ga0068859_100349597 3300005617 Bacteria 1573
47 Ga0068859_100558691 3300005617 Unclassified 1239
48 Ga0068864_100554853 3300005618 Bacteria 1111
49 Ga0068863_100019803 3300005841 Bacteria 6435
50 Ga0068863_100426076 3300005841 Bacteria 1300
51 Ga0068863_100858535 3300005841 Bacteria 907
52 Ga0068858_100003783 3300005842 Bacteria 14961
53 Ga0068858_100061854 3300005842 Bacteria 3462
54 Ga0068860_100147840 3300005843 Bacteria 2262
55 Ga0068860_100369878 3300005843 Unclassified 1413
56 Ga0068862_100017064 3300005844 Bacteria 6041
57 Ga0081455_10058504 3300005937 Bacteria 3260
58 Ga0070716_100246256 3300006173 Bacteria 1215
59 Ga0070716_100541462 3300006173 Unclassified 866
60 Ga0097621_100200591 3300006237 Bacteria 1732
61 Ga0097621_100230750 3300006237 Bacteria 1616
62 Ga0097621_100722003 3300006237 Unclassified 919
63 Ga0068871_100006536 3300006358 Bacteria 8258
64 Ga0068871_100301996 3300006358 Bacteria 1405
65 Ga0068871_100364962 3300006358 Bacteria 1280
66 Ga0075428_100590512 3300006844 Bacteria 1186
67 Ga0075434_100006547 3300006871 Bacteria 10682
68 Ga0075434_100007593 3300006871 Bacteria 10040
69 Ga0075434_100023585 3300006871 Bacteria 5999
70 Ga0075429_100102981 3300006880 Unclassified 2493
71 Ga0068865_100005679 3300006881 Bacteria 7578
72 Ga0075436_100007129 3300006914 Bacteria 7650
73 Ga0075436_100104387 3300006914 Bacteria 1975
74 Ga0097620_100137411 3300006931 Unclassified 2518
75 Ga0097620_100349628 3300006931 Bacteria 1573
76 Ga0097620_100558712 3300006931 Unclassified 1239
77 Ga0075435_100000213 3300007076 Bacteria 35518
78 Ga0075435_100036152 3300007076 Bacteria 3923
79 Ga0075435_100372764 3300007076 Bacteria 1225
80 Ga0111539_10088028 3300009094 Bacteria 3649
81 Ga0111539_11131019 3300009094 Bacteria 910
82 Ga0105245_10001155 3300009098 Bacteria 23872
83 Ga0105247_10016930 3300009101 Bacteria 4372
84 Ga0114129_10002018 3300009147 Bacteria 27827
85 Ga0114129_10061872 3300009147 Bacteria 5232
86 Ga0114129_10274055 3300009147 Bacteria 2256
87 Ga0105242_10014024 3300009176 Bacteria 6202
88 Ga0105242_10213323 3300009176 Unclassified 1722
89 Ga0105248_10003314 3300009177 Bacteria 17875
90 Ga0105248_10010492 3300009177 Bacteria 10204
91 Ga0105248_10060438 3300009177 Bacteria 4254
92 Ga0105248_10428078 3300009177 Bacteria 1491
93 Ga0105238_10165183 3300009551 Bacteria 2189
94 Ga0105249_10956243 3300009553 Bacteria 925
95 Ga0157374_10048603 3300013296 Bacteria 3936
96 Ga0157378_10072918 3300013297 Unclassified 3086
97 Ga0163162_10019071 3300013306 Bacteria 6728
98 Ga0163162_10371634 3300013306 Bacteria 1563
99 Ga0157375_10357046 3300013308 Bacteria 1627
100 Ga0157375_10390523 3300013308 Unclassified 1558
101 Ga0157375_10763585 3300013308 Bacteria 1117
102 Ga0163163_10072561 3300014325 Bacteria 3432
103 Ga0163163_10082589 3300014325 Bacteria 3217
104 Ga0163163_10206588 3300014325 Bacteria 2012
105 Ga0157379_10058187 3300014968 Unclassified 3455
106 Ga0157379_10105928 3300014968 Bacteria 2524
107 Ga0157376_10111784 3300014969 Bacteria 2406
108 Ga0157376_10403962 3300014969 Bacteria 1322
109 Ga0157376_10404812 3300014969 Bacteria 1320
110 Ga0207697_10152106 3300025315 Unclassified 1007
111 Ga0207682_10032524 3300025893 Bacteria 2097
112 Ga0207680_10038653 3300025903 Bacteria 2763
113 Ga0207680_10058304 3300025903 Bacteria 2340
114 Ga0207662_10030405 3300025918 Bacteria 3134
115 Ga0207681_10016752 3300025923 Bacteria 4592
116 Ga0207687_10000465 3300025927 Bacteria 27650
117 Ga0207687_10092242 3300025927 Bacteria 2211
118 Ga0207706_10302293 3300025933 Bacteria 1394
119 Ga0207686_10088548 3300025934 Bacteria 2038
120 Ga0207686_10173742 3300025934 Bacteria 1522
121 Ga0207670_10037448 3300025936 Bacteria 3161
122 Ga0207670_10250881 3300025936 Bacteria 1368
123 Ga0207669_10008211 3300025937 Bacteria 4891
124 Ga0207665_10117830 3300025939 Bacteria 1873
125 Ga0207691_10067277 3300025940 Bacteria 3239
126 Ga0207691_10069766 3300025940 Unclassified 3174
127 Ga0207691_10202523 3300025940 Bacteria 1727
128 Ga0207711_10123564 3300025941 Bacteria 2313
129 Ga0207711_10427956 3300025941 Bacteria 1231
130 Ga0207711_10460805 3300025941 Bacteria 1184
131 Ga0207689_10084382 3300025942 Archaea 2611
132 Ga0207689_10233608 3300025942 Bacteria 1520
133 Ga0207667_10007875 3300025949 Bacteria 12720
134 Ga0207651_10100365 3300025960 Bacteria 2146
135 Ga0207677_10107764 3300026023 Bacteria 2067
136 Ga0207677_10535857 3300026023 Bacteria 1018
137 Ga0207703_10011640 3300026035 Bacteria 6841
138 Ga0207703_10018091 3300026035 Bacteria 5504
139 Ga0207703_10156682 3300026035 Bacteria 1991
140 Ga0207703_10237492 3300026035 Bacteria 1637
141 Ga0207708_10048131 3300026075 Bacteria 3245
142 Ga0207702_10037968 3300026078 Bacteria 4034
143 Ga0207641_10014705 3300026088 Bacteria 6417
144 Ga0207641_10384386 3300026088 Bacteria 1345
145 Ga0207648_10953001 3300026089 Bacteria 803
146 Ga0207676_10111491 3300026095 Bacteria 2290
147 Ga0207683_10017391 3300026121 Bacteria 6128
148 Ga0207428_10038622 3300027907 Bacteria 3880
149 Ga0268266_10011481 3300028379 Bacteria 7694
150 Ga0268266_10015827 3300028379 Bacteria 6458
151 Ga0268266_10477656 3300028379 Bacteria 1188
152 Ga0268265_10012041 3300028380 Bacteria 5855
153 Ga0268264_10192806 3300028381 Unclassified 1859
154 Ga0307515_10019292 3300028794 Bacteria 12290
155 Ga0265338_10228440 3300028800 Bacteria 1385
156 Ga0265332_10008478 3300031238 Bacteria 4620
157 Ga0265316_10123165 3300031344 Bacteria 1957
158 Ga0307513_10005020 3300031456 Bacteria 17532
159 Ga0307513_10251441 3300031456 Bacteria 1564
160 Ga0307509_10000197 3300031507 Bacteria 95722
161 Ga0307508_10001652 3300031616 Bacteria 24831
162 Ga0307508_10014174 3300031616 Bacteria 7271
163 Ga0307508_10314191 3300031616 Bacteria 1159
164 Ga0265342_10112747 3300031712 Bacteria 1538
165 Ga0316576_10132751 3300031727 Unclassified 1873
166 Ga0307516_10086793 3300031730 Bacteria 2964
167 Ga0307516_10143175 3300031730 Bacteria 2158
168 Ga0373938_0031573 3300034957 Unclassified 1137
169 Ga0373949_0000055 3300035090 Bacteria 42961
170 Ga0373936_0000005 3300035113 Bacteria 325848
171 Ga0373941_0002943 3300035115 Bacteria 3805
172 Ga0373960_0036265 3300035121 Bacteria 1404
173 Ga0373961_0000141 3300035241 Bacteria 35831
174 Ga0373962_0018115 3300035242 Bacteria 1830
175 Ga0373924_0056833 3300035410 Unclassified 1631
176 Ga0373931_0220718 3300035691 Bacteria 1141
177 Ga0373937_0265587 3300036401 Unclassified 1619
178 Ga0316582_0082576 3300036647 Unclassified 2101
179 Ga0316584_0012342 3300036712 Bacteria 6024
180 Ga0373925_0113036 3300037068 Bacteria 2100
181 Ga0451577_0060808 3300042876 Bacteria 3368
182 Ga0453683_0013207 3300044673 Bacteria 5398
183 Ga0453683_0114652 3300044673 Bacteria 1695
184 Ga0453683_0599096 3300044673 Bacteria 718
185 Ga0453684_0059282 3300044712 Bacteria 4936
186 Ga0453684_0080843 3300044712 Bacteria 4056
187 Ga0453684_0123649 3300044712 Unclassified 3118
188 Ga0453684_0220770 3300044712 Unclassified 2196
189 Ga0453684_0877008 3300044712 Bacteria 962
190 Ga0451576_0006215 3300045051 Bacteria 14706
191 Ga0451576_0104441 3300045051 Bacteria 2947
192 Ga0451576_0108394 3300045051 Bacteria 2890
193 Ga0451576_0244641 3300045051 Bacteria 1874
194 Ga0495638_0098033 3300046460 Bacteria 1757
195 Ga0495651_0241130 3300046462 Bacteria 1240
196 Ga0495580_0484270 3300046472 Unclassified 827
197 Ga0495621_0142819 3300046539 Bacteria 938
198 Ga0495635_0121155 3300046663 Bacteria 1784
199 Ga0495647_0217064 3300046681 Bacteria 843
200 Ga0495658_0124275 3300046683 Bacteria 1564
201 Ga0495658_0383715 3300046683 Unclassified 895
202 Ga0495613_0464555 3300046689 Unclassified 856
203 Ga0495649_0071767 3300046694 Bacteria 1856
204 Ga0495684_0104125 3300047471 Unclassified 2145
205 Ga0496100_0275365 3300048903 Bacteria 1253
206 Ga0496108_0277073 3300048911 Bacteria 1460
207 Ga0496109_0241847 3300048912 Bacteria 1699
208 Ga0496111_0556404 3300048914 Bacteria 842
209 Ga0496112_0242815 3300048915 Bacteria 1753
210 Ga0501034_0015356 3300049571 Bacteria 7870
211 Ga0501047_0009177 3300049581 Bacteria 9339
212 Ga0501069_0068738 3300049585 Bacteria 1982
213 Ga0501070_0017475 3300049586 Bacteria 6021
214 Ga0501070_0075471 3300049586 Bacteria 2791
215 Ga0501071_0111474 3300049587 Bacteria 2022
216 Ga0501073_0305384 3300049589 Bacteria 1098
217 Ga0501083_0045266 3300049744 Bacteria 2977
218 Ga0501044_0015396 3300049823 Bacteria 8237
219 nmdc:mga05p37_15661_c1 3300050507 Bacteria 9114
220 nmdc:mga05p37_5252_c1 3300050507 Bacteria 15201
221 nmdc:mga05p37_7353_c1 3300050507 Bacteria 12986
222 nmdc:mga09592_30544_c1 3300050508 Bacteria 4484
223 nmdc:mga08y16_111355_c1 3300050511 Bacteria 2850
224 nmdc:mga0n895_173_c1 3300050512 Bacteria 39986
225 nmdc:mga0n895_236053_c1 3300050512 Bacteria 1856
226 nmdc:mga0n895_370293_c1 3300050512 Bacteria 1450
227 nmdc:mga0n895_5460_c1 3300050512 Bacteria 10633
228 nmdc:mga0rr50_15225_c1 3300050513 Bacteria 5072
229 nmdc:mga0rr50_16018_c1 3300050513 Bacteria 4965
230 nmdc:mga0rr50_2_c1 3300050513 Bacteria 373938
231 nmdc:mga0rr50_88561_c1 3300050513 Bacteria 2405
232 nmdc:mga08x19_16760_c1 3300050514 Bacteria 4474
233 nmdc:mga08x19_331582_c1 3300050514 Bacteria 1060
234 nmdc:mga08x19_452_c1 3300050514 Bacteria 27982
235 nmdc:mga0a205_204918_c1 3300050515 Unclassified 1862
236 Ga0500635_0163420 3300053080 Bacteria 855
237 Ga0495595_0058173 3300053084 Bacteria 1805
238 Ga0495595_0177104 3300053084 Unclassified 1057
239 Ga0495619_0192570 3300053085 Unclassified 1411
240 Ga0495619_0242527 3300053085 Bacteria 1249
241 Ga0500583_0216537 3300053092 Bacteria 950
242 Ga0500583_0221231 3300053092 Bacteria 939
243 Ga0500566_0007149 3300053094 Bacteria 6614
244 Ga0500566_0087535 3300053094 Bacteria 1725
245 Ga0500640_063049 3300053095 Bacteria 1603
246 Ga0500554_043710 3300053102 Bacteria 1385
247 Ga0500554_104703 3300053102 Bacteria 948
248 Ga0500595_000455 3300053119 Bacteria 25454
249 Ga0500597_116585 3300053120 Bacteria 1158
250 Ga0500614_000122 3300053123 Bacteria 18751
251 Ga0500559_0021429 3300053136 Bacteria 2739
252 Ga0500568_0018717 3300053139 Bacteria 3023
253 Ga0500639_169553 3300053163 Bacteria 981
254 Ga0501082_0528361 3300060353 Bacteria 1031
255 Ga0070707_100179316
256 rootH1_10131190
257 Ga0070658_10234025
258 Ga0070683_100114355
259 Ga0070690_100020555
260 Ga0070670_100682785
261 Ga0070677_10036427
262 Ga0068869_100104990
263 Ga0068869_100305487
264 Ga0068869_100578057
265 Ga0070666_10008944
266 Ga0070666_10045661
267 Ga0070666_10374930
268 Ga0070666_10424549
269 Ga0070689_100047696
270 Ga0070687_100008392
271 Ga0070692_10084777
272 Ga0070669_100006383
273 Ga0070671_100018548
274 Ga0070674_100008928
275 Ga0070673_100064084
276 Ga0070673_100120304
277 Ga0070688_100067106
278 Ga0070659_100224377
279 Ga0070667_100092483
280 Ga0070667_100740167
281 Ga0070701_10246528
282 Ga0070705_100056522
283 Ga0068867_100187878
284 Ga0068867_100688066
285 Ga0070685_10255228
286 Ga0070699_100180710
287 Ga0070684_100845328
288 Ga0070697_100398469
289 Ga0070672_100194519
290 Ga0070672_100250390
291 Ga0070686_100140026
292 Ga0070686_100342319
293 Ga0070695_100112614
294 Ga0070665_100003106
295 Ga0070665_100010290
296 Ga0070665_100070519
297 Ga0068856_100015771
298 Ga0068852_100168778
299 Ga0068859_100137407
300 Ga0068859_100349597
301 Ga0068859_100558691
302 Ga0068864_100554853
303 Ga0068863_100019803
304 Ga0068863_100426076
305 Ga0068863_100858535
306 Ga0068858_100003783
307 Ga0068858_100061854
308 Ga0068860_100147840
309 Ga0068860_100369878
310 Ga0068862_100017064
311 Ga0081455_10058504
312 Ga0070716_100246256
313 Ga0070716_100541462
314 Ga0097621_100200591
315 Ga0097621_100230750
316 Ga0097621_100722003
317 Ga0068871_100006536
318 Ga0068871_100301996
319 Ga0068871_100364962
320 Ga0075428_100590512
321 Ga0075434_100006547
322 Ga0075434_100007593
323 Ga0075434_100023585
324 Ga0075429_100102981
325 Ga0068865_100005679
326 Ga0075436_100007129
327 Ga0075436_100104387
328 Ga0097620_100137411
329 Ga0097620_100349628
330 Ga0097620_100558712
331 Ga0075435_100000213
332 Ga0075435_100036152
333 Ga0075435_100372764
334 Ga0111539_10088028
335 Ga0111539_11131019
336 Ga0105245_10001155
337 Ga0105247_10016930
338 Ga0114129_10002018
339 Ga0114129_10061872
340 Ga0114129_10274055
341 Ga0105242_10014024
342 Ga0105242_10213323
343 Ga0105248_10003314
344 Ga0105248_10010492
345 Ga0105248_10060438
346 Ga0105248_10428078
347 Ga0105238_10165183
348 Ga0105249_10956243
349 Ga0157374_10048603
350 Ga0157378_10072918
351 Ga0163162_10019071
352 Ga0163162_10371634
353 Ga0157375_10357046
354 Ga0157375_10390523
355 Ga0157375_10763585
356 Ga0163163_10072561
357 Ga0163163_10082589
358 Ga0163163_10206588
359 Ga0157379_10058187
360 Ga0157379_10105928
361 Ga0157376_10111784
362 Ga0157376_10403962
363 Ga0157376_10404812
364 Ga0207697_10152106
365 Ga0207682_10032524
366 Ga0207680_10038653
367 Ga0207680_10058304
368 Ga0207662_10030405
369 Ga0207681_10016752
370 Ga0207687_10000465
371 Ga0207687_10092242
372 Ga0207706_10302293
373 Ga0207686_10088548
374 Ga0207686_10173742
375 Ga0207670_10037448
376 Ga0207670_10250881
377 Ga0207669_10008211
378 Ga0207665_10117830
379 Ga0207691_10067277
380 Ga0207691_10069766
381 Ga0207691_10202523
382 Ga0207711_10123564
383 Ga0207711_10427956
384 Ga0207711_10460805
385 Ga0207689_10084382
386 Ga0207689_10233608
387 Ga0207667_10007875
388 Ga0207651_10100365
389 Ga0207677_10107764
390 Ga0207677_10535857
391 Ga0207703_10011640
392 Ga0207703_10018091
393 Ga0207703_10156682
394 Ga0207703_10237492
395 Ga0207708_10048131
396 Ga0207702_10037968
397 Ga0207641_10014705
398 Ga0207641_10384386
399 Ga0207648_10953001
400 Ga0207676_10111491
401 Ga0207683_10017391
402 Ga0207428_10038622
403 Ga0268266_10011481
404 Ga0268266_10015827
405 Ga0268266_10477656
406 Ga0268265_10012041
407 Ga0268264_10192806
408 Ga0307515_10019292
409 Ga0265338_10228440
410 Ga0265332_10008478
411 Ga0265316_10123165
412 Ga0307513_10005020
413 Ga0307513_10251441
414 Ga0307509_10000197
415 Ga0307508_10001652
416 Ga0307508_10014174
417 Ga0307508_10314191
418 Ga0265342_10112747
419 Ga0316576_10132751
420 Ga0307516_10086793
421 Ga0307516_10143175
422 Ga0373938_0031573
423 Ga0373949_0000055
424 Ga0373936_0000005
425 Ga0373941_0002943
426 Ga0373960_0036265
427 Ga0373961_0000141
428 Ga0373962_0018115
429 Ga0373924_0056833
430 Ga0373931_0220718
431 Ga0373937_0265587
432 Ga0316582_0082576
433 Ga0316584_0012342
434 Ga0373925_0113036
435 Ga0451577_0060808
436 Ga0453683_0013207
437 Ga0453683_0114652
438 Ga0453683_0599096
439 Ga0453684_0059282
440 Ga0453684_0080843
441 Ga0453684_0123649
442 Ga0453684_0220770
443 Ga0453684_0877008
444 Ga0451576_0006215
445 Ga0451576_0104441
446 Ga0451576_0108394
447 Ga0451576_0244641
448 Ga0495638_0098033
449 Ga0495651_0241130
450 Ga0495580_0484270
451 Ga0495621_0142819
452 Ga0495635_0121155
453 Ga0495647_0217064
454 Ga0495658_0124275
455 Ga0495658_0383715
456 Ga0495613_0464555
457 Ga0495649_0071767
458 Ga0495684_0104125
459 Ga0496100_0275365
460 Ga0496108_0277073
461 Ga0496109_0241847
462 Ga0496111_0556404
463 Ga0496112_0242815
464 Ga0501034_0015356
465 Ga0501047_0009177
466 Ga0501069_0068738
467 Ga0501070_0017475
468 Ga0501070_0075471
469 Ga0501071_0111474
470 Ga0501073_0305384
471 Ga0501083_0045266
472 Ga0501044_0015396
473 nmdc:mga05p37_15661_c1
474 nmdc:mga05p37_5252_c1
475 nmdc:mga05p37_7353_c1
476 nmdc:mga09592_30544_c1
477 nmdc:mga08y16_111355_c1
478 nmdc:mga0n895_173_c1
479 nmdc:mga0n895_236053_c1
480 nmdc:mga0n895_370293_c1
481 nmdc:mga0n895_5460_c1
482 nmdc:mga0rr50_15225_c1
483 nmdc:mga0rr50_16018_c1
484 nmdc:mga0rr50_2_c1
485 nmdc:mga0rr50_88561_c1
486 nmdc:mga08x19_16760_c1
487 nmdc:mga08x19_331582_c1
488 nmdc:mga08x19_452_c1
489 nmdc:mga0a205_204918_c1
490 Ga0500635_0163420
491 Ga0495595_0058173
492 Ga0495595_0177104
493 Ga0495619_0192570
494 Ga0495619_0242527
495 Ga0500583_0216537
496 Ga0500583_0221231
497 Ga0500566_0007149
498 Ga0500566_0087535
499 Ga0500640_063049
500 Ga0500554_043710
501 Ga0500554_104703
502 Ga0500595_000455
503 Ga0500597_116585
504 Ga0500614_000122
505 Ga0500559_0021429
506 Ga0500568_0018717
507 Ga0500639_169553
508 Ga0501082_0528361

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

19

253

0.96

PF08241

Methyltransf_11

Methyltransferase domain

71

171

0.95

PF13649

Methyltransf_25

Methyltransferase domain

70

167

0.93

PF08242

Methyltransf_12

Methyltransferase domain

71

169

0.91

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

54

172

0.83

PF13847

Methyltransf_31

Methyltransferase domain

64

232

0.83

PF13489

Methyltransf_23

Methyltransferase domain

46

238

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.9245 30 246
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.8535 30 246
3dh0-assembly1.cif.gz_A crystal structure of a sam dependent methyltransferase from aquifex aeolicus 0.8424 60 244
5fhr-assembly1.cif.gz_B crystal structure of y200l mutant of rat catechol-o-methyltransferase in complex with adomet and 3,5-dinitrocatechol 0.8339 54 136
3tm4-assembly2.cif.gz_B crystal structure of trm14 from pyrococcus furiosus in complex with s-adenosylmethionine 0.8324 50 250
ID Description Score Start End Superfamily
af_P0A887_31_251_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9482 30 246 3.40.50.150
af_P9WFR3_19_228_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9403 31 246 3.40.50.150
af_Q59ZE2_70_306_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9395 30 246 3.40.50.150
af_Q4CMB6_37_161_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9367 50 119 3.40.50.150
af_Q9VYF8_68_301_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9286 30 246 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A0F9HYM6-F1-model_v4 Methyltransferase domain-containing protein 0.9703 24 196 GO:0008168
GO:0032259
GO:0042181
AF-X1LPE2-F1-model_v4 peptide chain release factor N(5)-glutamine methyltransferase (EC 2.1.1.297) 0.9585 60 120 GO:0003676
GO:0008276
GO:0032259
GO:0102559
AF-R5UJ79-F1-model_v4 deleted 0.957 45 244
AF-A0A1Z8X935-F1-model_v4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) 0.9549 24 246 GO:0008425
GO:0009060
GO:0009234
GO:0032259
GO:0043770
AF-A0A660TX35-F1-model_v4 Bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE 0.9541 24 247 GO:0008168
GO:0032259
GO:0042181

Map