F364198

General Info

Members Datasets Scaffolds Average Seq Length
253 176 506 186

Family's Representative Sequence

Representative Sequence 3300032126|Ga0307415_100100741|Ga0307415_1001007412
Length 226
Sequence MIALGPSTLDKVWRCRPAGVGGANLSTPHTEEKALSKVAGLVLAAGGGRRYGGPKALVRHDDGRLLVERAVAALRDGGCAPILVVVGAEAGRVRAEAALGQVTLVDNPSWKAGMGSSLRAGLAAVGATGAEAVAVLLVDTPGVGPEAVRRVADAFGGPSTLVAASYQGRRGHPVLLGRDHWAGVSVLATADVGARAYLVAHAAEVQTVPCEDIADDTDIDVPPDRE

Samples

Sample ID Description Type Environment
1 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
90 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
91 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
94 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
95 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
96 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
103 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
104 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
105 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
111 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
112 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
113 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
114 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
115 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
118 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
123 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
124 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
125 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
126 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
127 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
139 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
140 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
141 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
146 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
147 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
150 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
151 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
152 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
153 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
156 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
157 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
158 2643221576 Nocardioides sp. Root614 Isolate Unclassified
159 2643221590 Nocardioides sp. Root682 Isolate Unclassified
160 2643221604 Nocardioides sp. Root190 Isolate Unclassified
161 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
162 2643221641 Nocardioides sp. Root122 Isolate Unclassified
163 2739367898 Nocardioides sp. CF479 Isolate Unclassified
164 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
165 2858868258 Micromonospora sp. MH33 Isolate Unclassified
166 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
167 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
168 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
169 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
170 2919069694 Microbacterium sp. 1154 Isolate Unclassified
171 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
172 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
173 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
174 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
175 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
176 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.54
Metatranscriptomes 3.16
Isolates 8.3

Biome Distribution

Category Percentage (%)
Aerial Root 0.4
Bulb 0
Endosphere 2.37
Nodule 0.4
Rhizoplane 8.3
Rhizosphere 77.87
Stem 0
Stem Tuber 0
Unclassified 1.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307415_100100741 3300032126 Bacteria 2118
2 rootH1_10090946 3300003316 Bacteria 2849
3 rootH1_10097555 3300003316 Bacteria 1206
4 rootH2_10019235 3300003320 Bacteria 1938
5 Ga0070658_10015300 3300005327 Bacteria 6140
6 Ga0070683_100012035 3300005329 Bacteria 7505
7 Ga0070683_100046404 3300005329 Bacteria 4013
8 Ga0070670_100094313 3300005331 Bacteria 2574
9 Ga0068869_100003067 3300005334 Bacteria 10162
10 Ga0068869_100130356 3300005334 Bacteria 1932
11 Ga0068869_100137134 3300005334 Bacteria 1886
12 Ga0068869_100912122 3300005334 Bacteria 761
13 Ga0068868_100076591 3300005338 Bacteria 2674
14 Ga0070660_100045301 3300005339 Bacteria 3366
15 Ga0070689_100638154 3300005340 Bacteria 925
16 Ga0070691_10168569 3300005341 Bacteria 1133
17 Ga0070687_100012194 3300005343 Bacteria 3787
18 Ga0070661_100267827 3300005344 Bacteria 1322
19 Ga0070661_100456721 3300005344 Bacteria 1017
20 Ga0070661_100932929 3300005344 Bacteria 718
21 Ga0070668_100020032 3300005347 Bacteria 5045
22 Ga0070675_100004512 3300005354 Bacteria 10637
23 Ga0070659_100177252 3300005366 Bacteria 1748
24 Ga0070659_100270747 3300005366 Bacteria 1411
25 Ga0070667_100002417 3300005367 Bacteria 16337
26 Ga0070714_100025802 3300005435 Bacteria 4854
27 Ga0070713_100107101 3300005436 Bacteria 2431
28 Ga0070678_100278212 3300005456 Bacteria 1414
29 Ga0070662_100368229 3300005457 Bacteria 1180
30 Ga0070681_10222955 3300005458 Bacteria 1800
31 Ga0070679_100024885 3300005530 Bacteria 5868
32 Ga0070684_100006297 3300005535 Bacteria 9170
33 Ga0070684_100053509 3300005535 Bacteria 3514
34 Ga0070664_100017263 3300005564 Bacteria 5928
35 Ga0070664_100090766 3300005564 Bacteria 2644
36 Ga0070664_100442941 3300005564 Bacteria 1192
37 Ga0068857_100004032 3300005577 Bacteria 12367
38 Ga0068857_100085689 3300005577 Bacteria 2816
39 Ga0068857_100193541 3300005577 Bacteria 1852
40 Ga0068854_100186782 3300005578 Bacteria 1622
41 Ga0070702_100100852 3300005615 Bacteria 1770
42 Ga0070702_100405945 3300005615 Bacteria 976
43 Ga0068864_100086261 3300005618 Bacteria 2761
44 Ga0068864_100170386 3300005618 Bacteria 1985
45 Ga0068858_100218004 3300005842 Bacteria 1807
46 Ga0068860_100234173 3300005843 Bacteria 1785
47 Ga0068862_100248631 3300005844 Bacteria 1620
48 Ga0081540_1099215 3300005983 Bacteria 1259
49 Ga0081539_10006158 3300005985 Bacteria 11672
50 Ga0081539_10025449 3300005985 Bacteria 3811
51 Ga0075367_10198954 3300006178 Bacteria 1252
52 Ga0075428_100240187 3300006844 Bacteria 1954
53 Ga0075428_100485094 3300006844 Bacteria 1323
54 Ga0075428_100949842 3300006844 Bacteria 911
55 Ga0075428_101011255 3300006844 Bacteria 880
56 Ga0075430_100003431 3300006846 Bacteria 13250
57 Ga0075430_100205433 3300006846 Bacteria 1635
58 Ga0075431_100196903 3300006847 Bacteria 2063
59 Ga0075431_100249580 3300006847 Bacteria 1803
60 Ga0075434_100285863 3300006871 Bacteria 1669
61 Ga0075429_100226237 3300006880 Bacteria 1638
62 Ga0105244_10100291 3300009036 Bacteria 1417
63 Ga0111539_10000781 3300009094 Bacteria 41382
64 Ga0111539_10212787 3300009094 Bacteria 2252
65 Ga0105245_10106442 3300009098 Bacteria 2602
66 Ga0105247_10255091 3300009101 Bacteria 1200
67 Ga0114129_10001224 3300009147 Bacteria 34117
68 Ga0114129_10097419 3300009147 Bacteria 4072
69 Ga0114129_10217492 3300009147 Bacteria 2580
70 Ga0114129_10850028 3300009147 Bacteria 1160
71 Ga0105243_10437561 3300009148 Bacteria 1224
72 Ga0105248_11454177 3300009177 Unclassified 776
73 Ga0105249_10483875 3300009553 Bacteria 1281
74 Ga0105029_103168 3300009984 Bacteria 1092
75 Ga0157369_10071446 3300013105 Bacteria 3726
76 Ga0157369_10214610 3300013105 Bacteria 2016
77 Ga0163163_10124312 3300014325 Bacteria 2616
78 Ga0157380_10377276 3300014326 Bacteria 1337
79 Ga0157380_10664873 3300014326 Bacteria 1041
80 Ga0157379_10119610 3300014968 Bacteria 2369
81 Ga0157379_10328662 3300014968 Bacteria 1397
82 Ga0197907_10042211 3300020069 Bacteria 1415
83 Ga0206356_10330140 3300020070 Bacteria 1349
84 Ga0206349_1383638 3300020075 Bacteria 1223
85 Ga0206352_10196372 3300020078 Bacteria 1061
86 Ga0206350_11644183 3300020080 Bacteria 1131
87 Ga0206354_11006038 3300020081 Bacteria 739
88 Ga0206353_10608845 3300020082 Bacteria 3386
89 Ga0224712_10139465 3300022467 Bacteria 1066
90 Ga0207699_10281103 3300025906 Bacteria 1156
91 Ga0207705_10240684 3300025909 Bacteria 1378
92 Ga0207662_10059527 3300025918 Bacteria 2289
93 Ga0207657_10103992 3300025919 Bacteria 2353
94 Ga0207649_10085117 3300025920 Bacteria 2057
95 Ga0207649_10146359 3300025920 Bacteria 1622
96 Ga0207652_10200244 3300025921 Bacteria 1797
97 Ga0207650_10084625 3300025925 Bacteria 2411
98 Ga0207659_10040195 3300025926 Bacteria 3268
99 Ga0207690_10253822 3300025932 Bacteria 1359
100 Ga0207690_11029966 3300025932 Bacteria 685
101 Ga0207706_10027817 3300025933 Bacteria 5055
102 Ga0207689_10009299 3300025942 Bacteria 8497
103 Ga0207689_10079462 3300025942 Bacteria 2696
104 Ga0207689_10137198 3300025942 Bacteria 2014
105 Ga0207661_10002062 3300025944 Bacteria 13831
106 Ga0207679_10004808 3300025945 Bacteria 8416
107 Ga0207679_10230016 3300025945 Bacteria 1565
108 Ga0207712_10385040 3300025961 Bacteria 1175
109 Ga0207668_10015443 3300025972 Bacteria 4745
110 Ga0207640_10357101 3300025981 Bacteria 1176
111 Ga0207658_10003045 3300025986 Bacteria 11983
112 Ga0207677_10010046 3300026023 Bacteria 5342
113 Ga0207703_10530940 3300026035 Bacteria 1108
114 Ga0207703_10579027 3300026035 Unclassified 1060
115 Ga0207678_10006027 3300026067 Bacteria 10782
116 Ga0207678_10185899 3300026067 Bacteria 1775
117 Ga0207641_10570582 3300026088 Bacteria 1105
118 Ga0207641_11395986 3300026088 Bacteria 701
119 Ga0207674_10008168 3300026116 Bacteria 12138
120 Ga0207674_10057404 3300026116 Bacteria 3946
121 Ga0207674_10066766 3300026116 Bacteria 3622
122 Ga0207674_10302391 3300026116 Bacteria 1549
123 Ga0207683_10030213 3300026121 Bacteria 4694
124 Ga0207683_10091912 3300026121 Bacteria 2704
125 Ga0207698_10020186 3300026142 Bacteria 4581
126 Ga0207428_10016361 3300027907 Bacteria 6382
127 Ga0268265_10160714 3300028380 Bacteria 1908
128 Ga0268264_10855398 3300028381 Unclassified 911
129 Ga0307515_10019109 3300028794 Bacteria 12357
130 Ga0307512_10006576 3300030522 Bacteria 11746
131 Ga0307512_10008061 3300030522 Bacteria 10324
132 Ga0307513_10011491 3300031456 Bacteria 10999
133 Ga0307513_10034803 3300031456 Bacteria 5645
134 Ga0307408_100075464 3300031548 Bacteria 2505
135 Ga0307408_100317180 3300031548 Bacteria 1312
136 Ga0307508_10024404 3300031616 Bacteria 5487
137 Ga0307516_10071240 3300031730 Bacteria 3337
138 Ga0307405_10006127 3300031731 Bacteria 5888
139 Ga0307413_10195339 3300031824 Bacteria 1456
140 Ga0307413_10340631 3300031824 Bacteria 1153
141 Ga0307410_10078049 3300031852 Bacteria 2317
142 Ga0307410_10091003 3300031852 Bacteria 2165
143 Ga0307406_10018648 3300031901 Bacteria 4057
144 Ga0307406_10140286 3300031901 Bacteria 1710
145 Ga0307407_10028065 3300031903 Bacteria 3004
146 Ga0307409_100003734 3300031995 Bacteria 8364
147 Ga0307409_100027470 3300031995 Bacteria 4034
148 Ga0307409_100290092 3300031995 Bacteria 1517
149 Ga0307409_100438421 3300031995 Bacteria 1258
150 Ga0307416_100014808 3300032002 Bacteria 5361
151 Ga0307416_100036954 3300032002 Bacteria 3753
152 Ga0307416_100210073 3300032002 Bacteria 1856
153 Ga0307416_101432456 3300032002 Bacteria 797
154 Ga0307414_10533821 3300032004 Bacteria 1043
155 Ga0307415_100000043 3300032126 Bacteria 54688
156 Ga0307415_100050308 3300032126 Bacteria 2823
157 Ga0307415_100055597 3300032126 Bacteria 2709
158 Ga0307510_10270697 3300033180 Bacteria 1175
159 Ga0373951_0000156 3300035091 Bacteria 24873
160 Ga0373943_0133254 3300035170 Bacteria 1332
161 Ga0395899_0166202 3300037312 Bacteria 1556
162 Ga0395898_0080495 3300037466 Bacteria 3141
163 Ga0395905_0013066 3300037471 Bacteria 7973
164 Ga0395901_0928282 3300038443 Bacteria 850
165 Ga0466965_0279276 3300044683 Bacteria 902
166 Ga0466970_0046772 3300044765 Bacteria 2305
167 Ga0495638_0034894 3300046460 Bacteria 3210
168 Ga0495632_0019510 3300046519 Bacteria 3691
169 Ga0496100_0130469 3300048903 Bacteria 1770
170 Ga0496100_0332504 3300048903 Bacteria 1144
171 Ga0496101_0853558 3300048904 Bacteria 717
172 Ga0496104_0014428 3300048907 Bacteria 7138
173 Ga0496105_0022550 3300048908 Bacteria 5100
174 Ga0496105_0262145 3300048908 Bacteria 1397
175 Ga0496106_1210495 3300048909 Bacteria 589
176 Ga0496108_0013261 3300048911 Bacteria 6717
177 Ga0496108_0555595 3300048911 Bacteria 1001
178 Ga0496109_0027129 3300048912 Bacteria 5112
179 Ga0496109_0028700 3300048912 Bacteria 4980
180 Ga0496110_0014559 3300048913 Bacteria 6536
181 Ga0496111_0175817 3300048914 Bacteria 1591
182 Ga0496112_0177338 3300048915 Bacteria 2095
183 Ga0496112_0290750 3300048915 Bacteria 1580
184 Ga0496112_1058909 3300048915 Bacteria 730
185 Ga0496113_0007870 3300048916 Bacteria 6893
186 Ga0496114_0075802 3300048917 Bacteria 2833
187 Ga0496114_0248059 3300048917 Bacteria 1566
188 Ga0496114_0647813 3300048917 Bacteria 929
189 Ga0496115_0058963 3300048918 Bacteria 3090
190 Ga0501032_0142925 3300049569 Unclassified 1576
191 Ga0501036_0025558 3300049572 Bacteria 4982
192 Ga0501036_0084231 3300049572 Bacteria 2688
193 Ga0501036_0303400 3300049572 Bacteria 1335
194 Ga0501036_0693958 3300049572 Bacteria 841
195 Ga0501036_1008760 3300049572 Bacteria 681
196 Ga0501038_0002940 3300049574 Bacteria 15892
197 Ga0501038_0124396 3300049574 Bacteria 2124
198 Ga0501039_0028997 3300049575 Bacteria 4262
199 Ga0501039_0033624 3300049575 Bacteria 3954
200 Ga0501042_0010585 3300049578 Bacteria 6193
201 Ga0501043_0003252 3300049579 Bacteria 13392
202 Ga0501046_0612891 3300049580 Bacteria 772
203 Ga0501047_0027968 3300049581 Bacteria 5434
204 Ga0501047_0042142 3300049581 Bacteria 4412
205 Ga0501047_0448182 3300049581 Bacteria 1120
206 Ga0501048_0003088 3300049582 Bacteria 12696
207 Ga0501070_0339144 3300049586 Bacteria 1221
208 Ga0501072_0251874 3300049588 Bacteria 1406
209 Ga0501073_0018635 3300049589 Bacteria 5017
210 Ga0501074_0010934 3300049590 Bacteria 6588
211 Ga0501079_0219843 3300049741 Bacteria 1484
212 Ga0501035_0508713 3300049822 Bacteria 991
213 Ga0501044_0009131 3300049823 Bacteria 10828
214 Ga0501044_0095146 3300049823 Bacteria 3002
215 Ga0501044_0541445 3300049823 Bacteria 1062
216 Ga0501045_0100198 3300049824 Bacteria 2144
217 nmdc:mga05p37_6870_c1 3300050507 Bacteria 13412
218 nmdc:mga09592_298248_c1 3300050508 Bacteria 1397
219 nmdc:mga09592_3997_c1 3300050508 Bacteria 11887
220 nmdc:mga0qj67_5841_c1 3300050509 Bacteria 9011
221 nmdc:mga06r32_238187_c1 3300050510 Bacteria 1807
222 nmdc:mga06r32_3830_c1 3300050510 Bacteria 13464
223 nmdc:mga06r32_83743_c1 3300050510 Bacteria 3108
224 nmdc:mga08y16_18567_c1 3300050511 Bacteria 7327
225 nmdc:mga08y16_212088_c1 3300050511 Bacteria 2005
226 Ga0500641_0238596 3300053096 Bacteria 766
227 Ga0500650_0170967 3300053098 Bacteria 999
228 Ga0500556_0310099 3300053104 Bacteria 616
229 Ga0500621_158454 3300053126 Bacteria 842
230 Ga0500600_0021403 3300053149 Bacteria 3877
231 Ga0501084_0681140 3300054114 Bacteria 867
232 Ga0530510_0014517 3300061734 Bacteria 5557
233 2623589895 2622736626 Bacteria 7181580
234 2643851236 2643221567 Bacteria 4163945
235 2643892372 2643221576 Bacteria 5214352
236 2643961424 2643221590 Bacteria 5214697
237 2644033493 2643221604 Bacteria 5014917
238 2644138107 2643221624 Bacteria 4384879
239 2644229417 2643221641 Bacteria 4490190
240 2740168116 2739367898 Bacteria 4367674
241 2774379174 2773857758 Bacteria 3592392
242 2858871358 2858868258 Bacteria 7683772
243 2867512388 2867507094 Bacteria 6506033
244 2904510614 2904509784 Bacteria 3520416
245 2906803464 2906799679 Bacteria 4031749
246 2908678142 2908678064 Bacteria 3482747
247 2919070450 2919069694 Bacteria 3622919
248 2977230033 2977228692 Bacteria 3450105
249 2977237894 2977236895 Bacteria 3569373
250 2977265242 2977264416 Bacteria 3750737
251 2984544324 2984542743 Bacteria 3569378
252 3003001816 3002998708 Bacteria 11715108
253 8054613679 8054609563 Bacteria 5170090
254 Ga0307415_100100741
255 rootH1_10090946
256 rootH1_10097555
257 rootH2_10019235
258 Ga0070658_10015300
259 Ga0070683_100012035
260 Ga0070683_100046404
261 Ga0070670_100094313
262 Ga0068869_100003067
263 Ga0068869_100130356
264 Ga0068869_100137134
265 Ga0068869_100912122
266 Ga0068868_100076591
267 Ga0070660_100045301
268 Ga0070689_100638154
269 Ga0070691_10168569
270 Ga0070687_100012194
271 Ga0070661_100267827
272 Ga0070661_100456721
273 Ga0070661_100932929
274 Ga0070668_100020032
275 Ga0070675_100004512
276 Ga0070659_100177252
277 Ga0070659_100270747
278 Ga0070667_100002417
279 Ga0070714_100025802
280 Ga0070713_100107101
281 Ga0070678_100278212
282 Ga0070662_100368229
283 Ga0070681_10222955
284 Ga0070679_100024885
285 Ga0070684_100006297
286 Ga0070684_100053509
287 Ga0070664_100017263
288 Ga0070664_100090766
289 Ga0070664_100442941
290 Ga0068857_100004032
291 Ga0068857_100085689
292 Ga0068857_100193541
293 Ga0068854_100186782
294 Ga0070702_100100852
295 Ga0070702_100405945
296 Ga0068864_100086261
297 Ga0068864_100170386
298 Ga0068858_100218004
299 Ga0068860_100234173
300 Ga0068862_100248631
301 Ga0081540_1099215
302 Ga0081539_10006158
303 Ga0081539_10025449
304 Ga0075367_10198954
305 Ga0075428_100240187
306 Ga0075428_100485094
307 Ga0075428_100949842
308 Ga0075428_101011255
309 Ga0075430_100003431
310 Ga0075430_100205433
311 Ga0075431_100196903
312 Ga0075431_100249580
313 Ga0075434_100285863
314 Ga0075429_100226237
315 Ga0105244_10100291
316 Ga0111539_10000781
317 Ga0111539_10212787
318 Ga0105245_10106442
319 Ga0105247_10255091
320 Ga0114129_10001224
321 Ga0114129_10097419
322 Ga0114129_10217492
323 Ga0114129_10850028
324 Ga0105243_10437561
325 Ga0105248_11454177
326 Ga0105249_10483875
327 Ga0105029_103168
328 Ga0157369_10071446
329 Ga0157369_10214610
330 Ga0163163_10124312
331 Ga0157380_10377276
332 Ga0157380_10664873
333 Ga0157379_10119610
334 Ga0157379_10328662
335 Ga0197907_10042211
336 Ga0206356_10330140
337 Ga0206349_1383638
338 Ga0206352_10196372
339 Ga0206350_11644183
340 Ga0206354_11006038
341 Ga0206353_10608845
342 Ga0224712_10139465
343 Ga0207699_10281103
344 Ga0207705_10240684
345 Ga0207662_10059527
346 Ga0207657_10103992
347 Ga0207649_10085117
348 Ga0207649_10146359
349 Ga0207652_10200244
350 Ga0207650_10084625
351 Ga0207659_10040195
352 Ga0207690_10253822
353 Ga0207690_11029966
354 Ga0207706_10027817
355 Ga0207689_10009299
356 Ga0207689_10079462
357 Ga0207689_10137198
358 Ga0207661_10002062
359 Ga0207679_10004808
360 Ga0207679_10230016
361 Ga0207712_10385040
362 Ga0207668_10015443
363 Ga0207640_10357101
364 Ga0207658_10003045
365 Ga0207677_10010046
366 Ga0207703_10530940
367 Ga0207703_10579027
368 Ga0207678_10006027
369 Ga0207678_10185899
370 Ga0207641_10570582
371 Ga0207641_11395986
372 Ga0207674_10008168
373 Ga0207674_10057404
374 Ga0207674_10066766
375 Ga0207674_10302391
376 Ga0207683_10030213
377 Ga0207683_10091912
378 Ga0207698_10020186
379 Ga0207428_10016361
380 Ga0268265_10160714
381 Ga0268264_10855398
382 Ga0307515_10019109
383 Ga0307512_10006576
384 Ga0307512_10008061
385 Ga0307513_10011491
386 Ga0307513_10034803
387 Ga0307408_100075464
388 Ga0307408_100317180
389 Ga0307508_10024404
390 Ga0307516_10071240
391 Ga0307405_10006127
392 Ga0307413_10195339
393 Ga0307413_10340631
394 Ga0307410_10078049
395 Ga0307410_10091003
396 Ga0307406_10018648
397 Ga0307406_10140286
398 Ga0307407_10028065
399 Ga0307409_100003734
400 Ga0307409_100027470
401 Ga0307409_100290092
402 Ga0307409_100438421
403 Ga0307416_100014808
404 Ga0307416_100036954
405 Ga0307416_100210073
406 Ga0307416_101432456
407 Ga0307414_10533821
408 Ga0307415_100000043
409 Ga0307415_100050308
410 Ga0307415_100055597
411 Ga0307510_10270697
412 Ga0373951_0000156
413 Ga0373943_0133254
414 Ga0395899_0166202
415 Ga0395898_0080495
416 Ga0395905_0013066
417 Ga0395901_0928282
418 Ga0466965_0279276
419 Ga0466970_0046772
420 Ga0495638_0034894
421 Ga0495632_0019510
422 Ga0496100_0130469
423 Ga0496100_0332504
424 Ga0496101_0853558
425 Ga0496104_0014428
426 Ga0496105_0022550
427 Ga0496105_0262145
428 Ga0496106_1210495
429 Ga0496108_0013261
430 Ga0496108_0555595
431 Ga0496109_0027129
432 Ga0496109_0028700
433 Ga0496110_0014559
434 Ga0496111_0175817
435 Ga0496112_0177338
436 Ga0496112_0290750
437 Ga0496112_1058909
438 Ga0496113_0007870
439 Ga0496114_0075802
440 Ga0496114_0248059
441 Ga0496114_0647813
442 Ga0496115_0058963
443 Ga0501032_0142925
444 Ga0501036_0025558
445 Ga0501036_0084231
446 Ga0501036_0303400
447 Ga0501036_0693958
448 Ga0501036_1008760
449 Ga0501038_0002940
450 Ga0501038_0124396
451 Ga0501039_0028997
452 Ga0501039_0033624
453 Ga0501042_0010585
454 Ga0501043_0003252
455 Ga0501046_0612891
456 Ga0501047_0027968
457 Ga0501047_0042142
458 Ga0501047_0448182
459 Ga0501048_0003088
460 Ga0501070_0339144
461 Ga0501072_0251874
462 Ga0501073_0018635
463 Ga0501074_0010934
464 Ga0501079_0219843
465 Ga0501035_0508713
466 Ga0501044_0009131
467 Ga0501044_0095146
468 Ga0501044_0541445
469 Ga0501045_0100198
470 nmdc:mga05p37_6870_c1
471 nmdc:mga09592_298248_c1
472 nmdc:mga09592_3997_c1
473 nmdc:mga0qj67_5841_c1
474 nmdc:mga06r32_238187_c1
475 nmdc:mga06r32_3830_c1
476 nmdc:mga06r32_83743_c1
477 nmdc:mga08y16_18567_c1
478 nmdc:mga08y16_212088_c1
479 Ga0500641_0238596
480 Ga0500650_0170967
481 Ga0500556_0310099
482 Ga0500621_158454
483 Ga0500600_0021403
484 Ga0501084_0681140
485 Ga0530510_0014517
486 2623589895
487 2643851236
488 2643892372
489 2643961424
490 2644033493
491 2644138107
492 2644229417
493 2740168116
494 2774379174
495 2858871358
496 2867512388
497 2904510614
498 2906803464
499 2908678142
500 2919070450
501 2977230033
502 2977237894
503 2977265242
504 2984544324
505 3003001816
506 8054613679

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12804

NTP_transf_3

MobA-like NTP transferase domain

40

205

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wee-assembly1.cif.gz_A crystal structure of rv0371c from mycobacterium tuberculosis h37rv 0.8676 2 171
2yes-assembly2.cif.gz_B crystal structure of rv0371c complex with manganese from mycobacterium tuberculosis h37rv 0.8642 2 171
3d5n-assembly4.cif.gz_E crystal structure of the q97w15_sulso protein from sulfolobus solfataricus. nesg target ssr125. 0.8583 3 176
3d5n-assembly4.cif.gz_D crystal structure of the q97w15_sulso protein from sulfolobus solfataricus. nesg target ssr125. 0.8544 1 183
3d5n-assembly4.cif.gz_D crystal structure of the q97w15_sulso protein from sulfolobus solfataricus. nesg target ssr125. 0.85 1 183
ID Description Score Start End Superfamily
af_Q46810_2_188_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8711 2 182 3.90.550.10
2weeA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8676 2 171 3.90.550.10
af_O06296_2_135_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8468 2 116 3.90.550.10
af_Q46810_2_188_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8404 2 182 3.90.550.10
1g97A01 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8218 3 182 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A2T8FFW6-F1-model_v4 Molybdopterin-guanine dinucleotide biosynthesis protein MobA 0.9866 3 183 GO:0016779
AF-A0A3D9UA56-F1-model_v4 deleted 0.9834 3 183
AF-A0A3E0GWU5-F1-model_v4 Nicotine blue oxidoreductase 0.9833 3 182 GO:0016779
AF-A0A5Q0NPY9-F1-model_v4 NTP transferase domain-containing protein 0.9812 4 183 GO:0016779
AF-W0ZC59-F1-model_v4 Uncharacterized MobA-related protein 0.9785 1 182 GO:0016779

Map