F364068

General Info

Members Datasets Scaffolds Average Seq Length
253 194 193 326

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10353528|Ga0157375_103535282
Length 347
Sequence MVPVTREPEMSALEEMMPPVQRAQVNGIEMAYYEAGPREGVPIVLCHGFPEIAFSWRHQIKALGEAGRWVIAPDQRGYGLTSRPEAVTDYDMEHLTGDMVALLDHLGVEKAIFCGHDWGGIIVWQMPLLHPTRVAGVIGLNTPFMARAPADPIALMRRRFGDDMYIVHFQKPGEADAVLDGDVGKAMGFFMRRPMPEAPAATGGLSGNFTGKPEDAPPEANFALIKILQIFDAAFDPRPELLTQQEMAVFVETFERTGFTGGINWYRNFTRNWEKAEGVDQQVRAPSLMVMAEKDAVLPPSAADGMEAYVADLEKALIKDSGHWTQQEKPQEVNRVILDWLDRRFPK

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
4 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
5 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
6 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
7 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
8 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
9 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
10 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
11 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
12 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
13 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
14 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
15 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
16 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
17 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
18 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
19 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
20 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
21 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
22 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
23 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
24 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
25 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
26 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
27 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
28 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
29 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
30 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
31 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
32 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
33 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
34 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
35 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
36 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
37 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
38 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
39 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
40 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
41 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
42 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
43 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
44 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
45 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
46 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
47 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
48 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
49 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
50 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
51 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
52 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
53 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
54 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
55 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
56 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
87 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
88 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
89 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
90 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
91 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
93 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
95 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
98 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
118 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
119 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
120 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
125 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
126 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
134 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
135 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
139 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
142 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
143 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
144 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
145 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
148 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
149 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
150 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
151 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
152 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
153 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
154 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
164 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
172 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
173 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
174 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
175 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
176 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
177 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
178 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
179 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
180 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
181 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
182 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
183 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
184 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
185 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
186 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
187 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
188 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
189 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
190 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
191 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
192 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
193 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
194 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 76.28
Metatranscriptomes 0
Isolates 23.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.42
Nodule 17.39
Rhizoplane 5.14
Rhizosphere 51.38
Stem 0
Stem Tuber 0
Unclassified 10.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1005586 3300003214 Bacteria 2393
2 JGI25153J46596_10002029 3300003215 Bacteria 11938
3 JGI25153J46596_10006414 3300003215 Bacteria 5953
4 JGI25160J50197_1026075 3300003354 Bacteria 1619
5 Ga0055530_10000397 3300003791 Bacteria 38939
6 Ga0055531_10002958 3300003794 Bacteria 11045
7 Ga0055531_10009026 3300003794 Bacteria 5154
8 Ga0055543_1016493 3300004625 Bacteria 1405
9 Ga0065165_1000103 3300005262 Bacteria 140705
10 Ga0065165_1001202 3300005262 Bacteria 29912
11 Ga0065165_1001214 3300005262 Bacteria 29682
12 Ga0065165_1005805 3300005262 Bacteria 6735
13 Ga0065165_1013848 3300005262 Bacteria 3172
14 Ga0070658_10026992 3300005327 Bacteria 4610
15 Ga0068869_100093769 3300005334 Bacteria 2262
16 Ga0070680_100005231 3300005336 Bacteria 9818
17 Ga0070680_100022118 3300005336 Bacteria 5058
18 Ga0068868_100216558 3300005338 Bacteria 1602
19 Ga0070671_100045388 3300005355 Bacteria 3653
20 Ga0070671_100147729 3300005355 Bacteria 1985
21 Ga0070673_100377276 3300005364 Bacteria 1264
22 Ga0070659_100000136 3300005366 Bacteria 56558
23 Ga0070678_100092320 3300005456 Bacteria 2325
24 Ga0070662_100081668 3300005457 Bacteria 2409
25 Ga0070662_100271314 3300005457 Bacteria 1370
26 Ga0070681_10034019 3300005458 Bacteria 5118
27 Ga0070681_10040173 3300005458 Bacteria 4690
28 Ga0070681_10049166 3300005458 Bacteria 4212
29 Ga0070679_100023704 3300005530 Bacteria 6013
30 Ga0068853_100155345 3300005539 Bacteria 2061
31 Ga0070665_100019125 3300005548 Bacteria 6872
32 Ga0068855_100093375 3300005563 Bacteria 3470
33 Ga0068855_100127620 3300005563 Bacteria 2907
34 Ga0068855_100194981 3300005563 Bacteria 2282
35 Ga0068855_100369252 3300005563 Bacteria 1578
36 Ga0068864_100042415 3300005618 Bacteria 3893
37 Ga0068864_100044035 3300005618 Bacteria 3824
38 Ga0068863_100287066 3300005841 Bacteria 1595
39 Ga0068862_100091032 3300005844 Bacteria 2656
40 Ga0068862_100329125 3300005844 Bacteria 1412
41 Ga0081455_10078198 3300005937 Bacteria 2719
42 Ga0075363_100139157 3300006048 Bacteria 1366
43 Ga0097621_100216089 3300006237 Bacteria 1669
44 Ga0075370_10038535 3300006353 Bacteria 2690
45 Ga0068865_100000737 3300006881 Bacteria 18382
46 Ga0068865_100331494 3300006881 Bacteria 1227
47 Ga0105240_10008310 3300009093 Bacteria 14853
48 Ga0105240_10050690 3300009093 Bacteria 5231
49 Ga0105245_10453238 3300009098 Bacteria 1292
50 Ga0105241_10147098 3300009174 Bacteria 1924
51 Ga0105248_10000570 3300009177 Bacteria 41892
52 Ga0105248_10047342 3300009177 Bacteria 4822
53 Ga0105248_10452285 3300009177 Bacteria 1447
54 Ga0105237_10202880 3300009545 Bacteria 1983
55 Ga0105237_10211810 3300009545 Bacteria 1938
56 Ga0105238_10165309 3300009551 Bacteria 2188
57 Ga0105238_10223778 3300009551 Bacteria 1858
58 Ga0105239_10115463 3300010375 Bacteria 2978
59 Ga0157370_10123419 3300013104 Bacteria 2418
60 Ga0163162_10195029 3300013306 Bacteria 2154
61 Ga0157375_10353528 3300013308 Bacteria 1635
62 Ga0163163_10106969 3300014325 Bacteria 2823
63 Ga0157379_10075626 3300014968 Bacteria 3015
64 Ga0157379_10334857 3300014968 Bacteria 1383
65 Ga0214544_1000001 3300021320 Bacteria 783667
66 Ga0214542_1000037 3300021321 Bacteria 159256
67 Ga0214545_1000003 3300021324 Bacteria 720274
68 Ga0207425_1012378 3300025245 Bacteria 2004
69 Ga0209026_1002710 3300025250 Bacteria 6383
70 Ga0209148_1009690 3300025254 Bacteria 1860
71 Ga0209233_1005004 3300025261 Bacteria 4452
72 Ga0209564_1015118 3300025295 Bacteria 3159
73 Ga0209758_1000011 3300025297 Bacteria 1049685
74 Ga0209758_1000133 3300025297 Bacteria 182442
75 Ga0209758_1001516 3300025297 Bacteria 26921
76 Ga0209050_1000038 3300025298 Bacteria 412635
77 Ga0209256_1006977 3300025299 Bacteria 5748
78 Ga0209256_1011635 3300025299 Bacteria 3491
79 Ga0207426_1000800 3300025302 Bacteria 34038
80 Ga0207426_1004959 3300025302 Bacteria 6274
81 Ga0209257_1000138 3300025304 Bacteria 204131
82 Ga0209257_1002053 3300025304 Bacteria 21366
83 Ga0209257_1004185 3300025304 Bacteria 11443
84 Ga0209257_1026045 3300025304 Bacteria 1982
85 Ga0207705_10008841 3300025909 Bacteria 7341
86 Ga0207654_10265133 3300025911 Bacteria 1157
87 Ga0207707_10041573 3300025912 Bacteria 4014
88 Ga0207695_10000397 3300025913 Bacteria 98044
89 Ga0207695_10006769 3300025913 Bacteria 14779
90 Ga0207695_10007932 3300025913 Bacteria 13398
91 Ga0207695_10052567 3300025913 Bacteria 4266
92 Ga0207657_10024980 3300025919 Bacteria 5520
93 Ga0207652_10046703 3300025921 Bacteria 3696
94 Ga0207694_10325184 3300025924 Bacteria 1270
95 Ga0207644_10035971 3300025931 Bacteria 3474
96 Ga0207690_10000153 3300025932 Bacteria 54709
97 Ga0207704_10000293 3300025938 Bacteria 23694
98 Ga0207711_10005279 3300025941 Bacteria 10952
99 Ga0207689_10045891 3300025942 Bacteria 3613
100 Ga0207667_10069625 3300025949 Bacteria 3662
101 Ga0207667_10356897 3300025949 Bacteria 1491
102 Ga0207667_10477210 3300025949 Bacteria 1266
103 Ga0207639_10035913 3300026041 Bacteria 3670
104 Ga0207676_10061039 3300026095 Bacteria 2984
105 Ga0207698_10021022 3300026142 Bacteria 4507
106 Ga0207698_10065340 3300026142 Bacteria 2857
107 Ga0268266_10000005 3300028379 Bacteria 1448194
108 Ga0268266_10047350 3300028379 Bacteria 3683
109 Ga0268265_10145128 3300028380 Bacteria 1993
110 Ga0268265_10315499 3300028380 Bacteria 1413
111 Ga0307517_10002892 3300028786 Bacteria 27201
112 Ga0307517_10044492 3300028786 Bacteria 4693
113 Ga0307511_10028223 3300030521 Bacteria 5103
114 Ga0265327_10000359 3300031251 Bacteria 86745
115 Ga0307513_10002371 3300031456 Bacteria 26186
116 Ga0307513_10002607 3300031456 Bacteria 24912
117 Ga0307513_10009922 3300031456 Bacteria 12012
118 Ga0265314_10004882 3300031711 Bacteria 12260
119 Ga0265342_10007168 3300031712 Bacteria 8206
120 Ga0307414_10187571 3300032004 Bacteria 1670
121 Ga0307510_10016927 3300033180 Bacteria 8599
122 Ga0373928_0043736 3300035084 Bacteria 1037
123 Ga0373944_0038557 3300035089 Bacteria 1468
124 Ga0373925_0131690 3300037068 Bacteria 1950
125 Ga0395899_0000664 3300037312 Bacteria 34982
126 Ga0395899_0061241 3300037312 Bacteria 2772
127 Ga0395900_0000006 3300037418 Bacteria 495364
128 Ga0395900_0025218 3300037418 Bacteria 6087
129 Ga0395900_0187423 3300037418 Bacteria 2100
130 Ga0395900_0248112 3300037418 Bacteria 1782
131 Ga0395898_0002742 3300037466 Bacteria 20323
132 Ga0395898_0051663 3300037466 Bacteria 4019
133 Ga0395905_0023377 3300037471 Bacteria 5841
134 Ga0395905_0041355 3300037471 Bacteria 4325
135 Ga0395901_0000001 3300038443 Bacteria 800383
136 Ga0436360_0068581 3300039438 Bacteria 2385
137 Ga0466972_0002813 3300044658 Bacteria 8621
138 Ga0466960_0007894 3300044901 Bacteria 4342
139 Ga0466960_0104626 3300044901 Bacteria 1462
140 Ga0495592_0026966 3300046454 Bacteria 4356
141 Ga0495651_0004240 3300046462 Bacteria 10992
142 Ga0495664_0018925 3300046477 Bacteria 3953
143 Ga0495583_0032787 3300046506 Bacteria 2505
144 Ga0495652_0048131 3300046529 Bacteria 3655
145 Ga0495640_0163437 3300046533 Bacteria 1425
146 Ga0495587_0185535 3300046536 Bacteria 1178
147 Ga0495621_0034159 3300046539 Bacteria 1756
148 Ga0495668_0179500 3300046616 Bacteria 1160
149 Ga0495611_0009004 3300046648 Bacteria 4221
150 Ga0495625_0079122 3300046660 Bacteria 2293
151 Ga0495625_0104299 3300046660 Bacteria 1944
152 Ga0495625_0200274 3300046660 Bacteria 1318
153 Ga0495635_0067139 3300046663 Bacteria 2460
154 Ga0495657_0008941 3300046675 Bacteria 7622
155 Ga0495623_0064138 3300046679 Bacteria 2299
156 Ga0495669_0032410 3300046684 Bacteria 2297
157 Ga0495604_0055668 3300047317 Bacteria 3048
158 Ga0495636_0039453 3300047318 Bacteria 1956
159 Ga0495672_0018086 3300047320 Bacteria 4692
160 Ga0495672_0043573 3300047320 Bacteria 2697
161 Ga0495602_0104551 3300048088 Bacteria 2316
162 Ga0496101_0051143 3300048904 Bacteria 2976
163 Ga0496105_0027577 3300048908 Bacteria 4641
164 Ga0496109_0072768 3300048912 Bacteria 3158
165 Ga0496109_0188142 3300048912 Bacteria 1939
166 Ga0496110_0022925 3300048913 Bacteria 5306
167 Ga0496111_0303289 3300048914 Bacteria 1184
168 Ga0496112_0032959 3300048915 Bacteria 5031
169 Ga0496112_0033030 3300048915 Bacteria 5026
170 Ga0496112_0195538 3300048915 Bacteria 1983
171 Ga0496113_0301634 3300048916 Bacteria 1283
172 Ga0496115_0001088 3300048918 Bacteria 19656
173 Ga0496115_0009084 3300048918 Bacteria 7376
174 Ga0496115_0041925 3300048918 Bacteria 3645
175 Ga0496118_0059677 3300048921 Bacteria 2838
176 Ga0501033_0026603 3300049570 Bacteria 4352
177 Ga0501047_0011962 3300049581 Bacteria 8212
178 Ga0501047_0079004 3300049581 Bacteria 3164
179 Ga0501047_0312089 3300049581 Bacteria 1413
180 Ga0501048_0054462 3300049582 Bacteria 2842
181 Ga0501072_0012094 3300049588 Bacteria 6594
182 Ga0501080_0028825 3300049742 Bacteria 5168
183 Ga0501083_0031839 3300049744 Bacteria 3618
184 Ga0501083_0128854 3300049744 Bacteria 1659
185 Ga0501044_0004906 3300049823 Bacteria 14951
186 Ga0500566_0000608 3300053094 Bacteria 20128
187 Ga0500641_0012303 3300053096 Bacteria 3124
188 Ga0500557_000003 3300053105 Bacteria 228429
189 Ga0500562_024675 3300053108 Bacteria 1572
190 Ga0500595_002319 3300053119 Bacteria 9525
191 Ga0500642_0000051 3300053130 Bacteria 77123
192 Ga0500636_0000166 3300053177 Bacteria 34574
193 Ga0500645_002763 3300053730 Bacteria 7600

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8019538911 8019546111 270
2 3300009098 Ga0105245_10453238 Ga0105245_104532382 272
3 3300009545 Ga0105237_10202880 Ga0105237_102028802 272
4 3300014968 Ga0157379_10075626 Ga0157379_100756263 272
5 3300009177 Ga0105248_10452285 Ga0105248_104522852 283
6 iso_pu_bacteria 8016622563 8016625538 290
7 3300035084 Ga0373928_0043736 Ga0373928_0043736_70_1017 298
8 3300005262 Ga0065165_1013848 Ga0065165_10138482 301
9 3300053730 Ga0500645_002763 Ga0500645_002763_6186_7169 301
10 3300046660 Ga0495625_0104299 Ga0495625_0104299_951_1934 302
11 3300025942 Ga0207689_10045891 Ga0207689_100458912 304
12 3300005336 Ga0070680_100005231 Ga0070680_1000052318 306
13 3300005458 Ga0070681_10040173 Ga0070681_100401735 306
14 3300005539 Ga0068853_100155345 Ga0068853_1001553452 306
15 3300005563 Ga0068855_100127620 Ga0068855_1001276203 306
16 3300025909 Ga0207705_10008841 Ga0207705_100088417 306
17 3300025919 Ga0207657_10024980 Ga0207657_100249804 306
18 3300025921 Ga0207652_10046703 Ga0207652_100467034 306
19 3300048918 Ga0496115_0001088 Ga0496115_0001088_17776_18756 306
20 3300006881 Ga0068865_100331494 Ga0068865_1003314942 309
21 3300009551 Ga0105238_10223778 Ga0105238_102237782 309
22 3300025924 Ga0207694_10325184 Ga0207694_103251841 309
23 3300009093 Ga0105240_10008310 Ga0105240_100083106 312
24 3300025913 Ga0207695_10006769 Ga0207695_100067696 312
25 3300010375 Ga0105239_10115463 Ga0105239_101154632 314
26 3300013306 Ga0163162_10195029 Ga0163162_101950292 314
27 3300035089 Ga0373944_0038557 Ga0373944_0038557_161_1156 314
28 3300048908 Ga0496105_0027577 Ga0496105_0027577_1608_2603 314
29 3300048912 Ga0496109_0188142 Ga0496109_0188142_658_1653 314
30 3300048913 Ga0496110_0022925 Ga0496110_0022925_2879_3874 314
31 3300048918 Ga0496115_0009084 Ga0496115_0009084_51_1046 314
32 3300005355 Ga0070671_100147729 Ga0070671_1001477292 315
33 3300005457 Ga0070662_100271314 Ga0070662_1002713141 315
34 3300005618 Ga0068864_100042415 Ga0068864_1000424154 315
35 3300005841 Ga0068863_100287066 Ga0068863_1002870662 315
36 3300006237 Ga0097621_100216089 Ga0097621_1002160891 315
37 3300009177 Ga0105248_10047342 Ga0105248_100473424 315
38 3300014325 Ga0163163_10106969 Ga0163163_101069693 315
39 3300048912 Ga0496109_0072768 Ga0496109_0072768_1277_2293 315
40 3300048915 Ga0496112_0033030 Ga0496112_0033030_1229_2245 315
41 3300048915 Ga0496112_0195538 Ga0496112_0195538_652_1668 315
42 3300048916 Ga0496113_0301634 Ga0496113_0301634_134_1150 315
43 3300005338 Ga0068868_100216558 Ga0068868_1002165581 316
44 3300005456 Ga0070678_100092320 Ga0070678_1000923202 316
45 3300037418 Ga0395900_0187423 Ga0395900_0187423_492_1487 316
46 3300047320 Ga0495672_0018086 Ga0495672_0018086_2031_2999 316
47 3300009545 Ga0105237_10211810 Ga0105237_102118102 317
48 3300013104 Ga0157370_10123419 Ga0157370_101234192 317
49 3300026142 Ga0207698_10065340 Ga0207698_100653402 317
50 3300031711 Ga0265314_10004882 Ga0265314_100048824 317
51 3300031712 Ga0265342_10007168 Ga0265342_100071684 317
52 3300048904 Ga0496101_0051143 Ga0496101_0051143_786_1781 317
53 3300048915 Ga0496112_0032959 Ga0496112_0032959_2857_3852 317
54 3300046616 Ga0495668_0179500 Ga0495668_0179500_54_1016 318
55 iso_pu_bacteria 2643221598 2643999238 318
56 3300005327 Ga0070658_10026992 Ga0070658_100269924 319
57 3300025254 Ga0209148_1009690 Ga0209148_10096902 319
58 iso_pu_bacteria 2643221614 2644085651 319
59 iso_pu_bacteria 2643221661 2644343202 319
60 iso_pu_bacteria 2643221666 2644366502 319
61 3300005334 Ga0068869_100093769 Ga0068869_1000937692 320
62 3300005336 Ga0070680_100022118 Ga0070680_1000221183 320
63 3300005366 Ga0070659_100000136 Ga0070659_10000013626 320
64 3300005458 Ga0070681_10049166 Ga0070681_100491661 320
65 3300005563 Ga0068855_100093375 Ga0068855_1000933753 320
66 3300005563 Ga0068855_100194981 Ga0068855_1001949813 320
67 3300005618 Ga0068864_100044035 Ga0068864_1000440354 320
68 3300005844 Ga0068862_100329125 Ga0068862_1003291252 320
69 3300006353 Ga0075370_10038535 Ga0075370_100385351 320
70 3300006881 Ga0068865_100000737 Ga0068865_1000007373 320
71 3300009093 Ga0105240_10050690 Ga0105240_100506904 320
72 3300009174 Ga0105241_10147098 Ga0105241_101470982 320
73 3300009177 Ga0105248_10000570 Ga0105248_1000057011 320
74 3300009551 Ga0105238_10165309 Ga0105238_101653092 320
75 3300025911 Ga0207654_10265133 Ga0207654_102651331 320
76 3300025912 Ga0207707_10041573 Ga0207707_100415735 320
77 3300025913 Ga0207695_10007932 Ga0207695_100079323 320
78 3300025913 Ga0207695_10052567 Ga0207695_100525674 320
79 3300025932 Ga0207690_10000153 Ga0207690_1000015330 320
80 3300025938 Ga0207704_10000293 Ga0207704_1000029322 320
81 3300025941 Ga0207711_10005279 Ga0207711_100052797 320
82 3300025949 Ga0207667_10069625 Ga0207667_100696253 320
83 3300025949 Ga0207667_10477210 Ga0207667_104772101 320
84 3300026095 Ga0207676_10061039 Ga0207676_100610392 320
85 3300026142 Ga0207698_10021022 Ga0207698_100210224 320
86 3300028379 Ga0268266_10000005 Ga0268266_10000005926 320
87 3300028380 Ga0268265_10315499 Ga0268265_103154992 320
88 3300030521 Ga0307511_10028223 Ga0307511_100282232 320
89 3300032004 Ga0307414_10187571 Ga0307414_101875711 320
90 3300037312 Ga0395899_0000664 Ga0395899_0000664_23962_24951 320
91 3300037418 Ga0395900_0000006 Ga0395900_0000006_85264_86253 320
92 3300037418 Ga0395900_0248112 Ga0395900_0248112_317_1318 320
93 3300037466 Ga0395898_0002742 Ga0395898_0002742_8557_9546 320
94 3300037471 Ga0395905_0041355 Ga0395905_0041355_2055_3044 320
95 3300038443 Ga0395901_0000001 Ga0395901_0000001_128512_129501 320
96 3300048918 Ga0496115_0041925 Ga0496115_0041925_2515_3495 320
97 3300049570 Ga0501033_0026603 Ga0501033_0026603_285_1265 320
98 3300049581 Ga0501047_0079004 Ga0501047_0079004_668_1636 320
99 3300049581 Ga0501047_0312089 Ga0501047_0312089_315_1295 320
100 3300049582 Ga0501048_0054462 Ga0501048_0054462_433_1401 320
101 3300049823 Ga0501044_0004906 Ga0501044_0004906_13767_14747 320
102 3300053096 Ga0500641_0012303 Ga0500641_0012303_1049_2029 320
103 3300053108 Ga0500562_024675 Ga0500562_024675_261_1241 320
104 3300003791 Ga0055530_10000397 Ga0055530_1000039723 321
105 3300003794 Ga0055531_10002958 Ga0055531_1000295810 321
106 3300004625 Ga0055543_1016493 Ga0055543_10164931 321
107 3300005262 Ga0065165_1000103 Ga0065165_10001035 321
108 3300005458 Ga0070681_10034019 Ga0070681_100340194 321
109 3300005530 Ga0070679_100023704 Ga0070679_1000237044 321
110 3300005844 Ga0068862_100091032 Ga0068862_1000910322 321
111 3300014968 Ga0157379_10334857 Ga0157379_103348572 321
112 3300021320 Ga0214544_1000001 Ga0214544_1000001692 321
113 3300021321 Ga0214542_1000037 Ga0214542_100003777 321
114 3300021324 Ga0214545_1000003 Ga0214545_100000368 321
115 3300025297 Ga0209758_1001516 Ga0209758_100151621 321
116 3300025298 Ga0209050_1000038 Ga0209050_1000038121 321
117 3300025304 Ga0209257_1000138 Ga0209257_100013810 321
118 3300025913 Ga0207695_10000397 Ga0207695_1000039744 321
119 3300028380 Ga0268265_10145128 Ga0268265_101451282 321
120 3300037068 Ga0373925_0131690 Ga0373925_0131690_394_1377 321
121 3300037312 Ga0395899_0061241 Ga0395899_0061241_348_1325 321
122 3300037418 Ga0395900_0025218 Ga0395900_0025218_2150_3127 321
123 3300037466 Ga0395898_0051663 Ga0395898_0051663_2101_3078 321
124 3300037471 Ga0395905_0023377 Ga0395905_0023377_2363_3340 321
125 3300044901 Ga0466960_0104626 Ga0466960_0104626_49_1044 321
126 3300005563 Ga0068855_100369252 Ga0068855_1003692521 322
127 3300025250 Ga0209026_1002710 Ga0209026_10027105 322
128 3300025304 Ga0209257_1002053 Ga0209257_100205310 322
129 3300025949 Ga0207667_10356897 Ga0207667_103568971 322
130 3300049581 Ga0501047_0011962 Ga0501047_0011962_681_1667 322
131 3300049742 Ga0501080_0028825 Ga0501080_0028825_1613_2599 322
132 3300049744 Ga0501083_0031839 Ga0501083_0031839_1510_2538 322
133 3300026041 Ga0207639_10035913 Ga0207639_100359132 323
134 3300031456 Ga0307513_10002371 Ga0307513_1000237121 323
135 3300049588 Ga0501072_0012094 Ga0501072_0012094_2937_3926 323
136 3300005355 Ga0070671_100045388 Ga0070671_1000453882 324
137 3300005548 Ga0070665_100019125 Ga0070665_1000191255 324
138 3300013308 Ga0157375_10353528 Ga0157375_103535282 324
139 3300025931 Ga0207644_10035971 Ga0207644_100359712 324
140 3300028379 Ga0268266_10047350 Ga0268266_100473502 324
141 3300028786 Ga0307517_10002892 Ga0307517_1000289220 324
142 3300028786 Ga0307517_10044492 Ga0307517_100444926 324
143 3300031456 Ga0307513_10002607 Ga0307513_100026079 324
144 3300031456 Ga0307513_10009922 Ga0307513_1000992211 324
145 3300046506 Ga0495583_0032787 Ga0495583_0032787_320_1363 324
146 3300046539 Ga0495621_0034159 Ga0495621_0034159_16_1005 324
147 3300046648 Ga0495611_0009004 Ga0495611_0009004_1539_2582 324
148 3300046660 Ga0495625_0079122 Ga0495625_0079122_59_1075 324
149 3300046684 Ga0495669_0032410 Ga0495669_0032410_688_1704 324
150 3300047318 Ga0495636_0039453 Ga0495636_0039453_706_1722 324
151 3300047320 Ga0495672_0043573 Ga0495672_0043573_1593_2609 324
152 3300031251 Ga0265327_10000359 Ga0265327_1000035941 325
153 3300033180 Ga0307510_10016927 Ga0307510_100169278 325
154 3300039438 Ga0436360_0068581 Ga0436360_0068581_41_1057 325
155 3300053119 Ga0500595_002319 Ga0500595_002319_1155_2174 325
156 iso_pu_bacteria 2507262055 2507507592 327
157 iso_pu_bacteria 2508501009 2508541711 327
158 iso_pu_bacteria 2511231028 2511398569 327
159 iso_pu_bacteria 2513237102 2513701385 327
160 iso_pu_bacteria 2517093001 2517104229 327
161 iso_pu_bacteria 2791355196 2793060945 327
162 iso_pu_bacteria 2824679649 2824681765 327
163 iso_pu_bacteria 2842038055 2842040719 327
164 iso_pu_bacteria 2842045827 2842046335 327
165 iso_pu_bacteria 2844315083 2844320097 327
166 iso_pu_bacteria 2849076700 2849078327 327
167 iso_pu_bacteria 2874620515 2874628147 327
168 iso_pu_bacteria 2881364244 2881371393 327
169 iso_pu_bacteria 2885366525 2885370034 327
170 iso_pu_bacteria 2903727486 2903730229 327
171 iso_pu_bacteria 2904666416 2904674235 327
172 iso_pu_bacteria 2906602504 2906609922 327
173 iso_pu_bacteria 2922393267 2922397008 327
174 iso_pu_bacteria 2935769743 2935776059 327
175 iso_pu_bacteria 2935785616 2935791928 327
176 iso_pu_bacteria 2935793552 2935800262 327
177 iso_pu_bacteria 2935934488 2935937123 327
178 iso_pu_bacteria 2935967501 2935969851 327
179 iso_pu_bacteria 3005483717 3005485472 327
180 iso_pu_bacteria 3005506211 3005508369 327
181 iso_pu_bacteria 3005587118 3005588131 327
182 iso_pu_bacteria 3005594810 3005600383 327
183 iso_pu_bacteria 3005718088 3005723232 327
184 iso_pu_bacteria 8016522445 8016528614 327
185 iso_pu_bacteria 8016557553 8016563474 327
186 iso_pu_bacteria 8016566248 8016572120 327
187 iso_pu_bacteria 8016575299 8016576318 327
188 iso_pu_bacteria 8016595262 8016601222 327
189 iso_pu_bacteria 8056967851 8056974997 327
190 iso_pu_bacteria 2885409591 2885415663 328
191 iso_pu_bacteria 2888388044 2888392709 328
192 iso_pu_bacteria 3005710791 3005715875 328
193 iso_pu_bacteria 2935608549 2935609900 329
194 iso_pu_bacteria 2935777560 2935783483 329
195 iso_pu_bacteria 2935819856 2935823060 329
196 iso_pu_bacteria 2935847175 2935848642 329
197 iso_pu_bacteria 2935908558 2935909552 329
198 iso_pu_bacteria 2935916978 2935917277 329
199 iso_pu_bacteria 2935926038 2935927033 329
200 iso_pu_bacteria 2935942939 2935944574 329
201 iso_pu_bacteria 2935951376 2935953011 329
202 iso_pu_bacteria 8016530956 8016533783 329
203 iso_pu_bacteria 8016539877 8016547002 329
204 iso_pu_bacteria 8016548790 8016555109 329
205 iso_pu_bacteria 8016603502 8016609216 329
206 iso_pu_bacteria 8016613128 8016615687 329
207 iso_pu_bacteria 8019530166 8019533560 329
208 iso_pu_bacteria 8019547302 8019552596 329
209 iso_pu_bacteria 8019687851 8019691143 329
210 3300003214 JGI25165J46597_1005586 JGI25165J46597_10055862 331
211 3300003215 JGI25153J46596_10002029 JGI25153J46596_100020295 331
212 3300003215 JGI25153J46596_10006414 JGI25153J46596_100064142 331
213 3300003354 JGI25160J50197_1026075 JGI25160J50197_10260752 331
214 3300003794 Ga0055531_10009026 Ga0055531_100090263 331
215 3300005262 Ga0065165_1001202 Ga0065165_10012022 331
216 3300005262 Ga0065165_1001214 Ga0065165_10012142 331
217 3300005262 Ga0065165_1005805 Ga0065165_10058055 331
218 3300005364 Ga0070673_100377276 Ga0070673_1003772762 331
219 3300005457 Ga0070662_100081668 Ga0070662_1000816682 331
220 3300005937 Ga0081455_10078198 Ga0081455_100781982 331
221 3300006048 Ga0075363_100139157 Ga0075363_1001391572 331
222 3300025245 Ga0207425_1012378 Ga0207425_10123782 331
223 3300025261 Ga0209233_1005004 Ga0209233_10050042 331
224 3300025295 Ga0209564_1015118 Ga0209564_10151183 331
225 3300025297 Ga0209758_1000011 Ga0209758_1000011396 331
226 3300025297 Ga0209758_1000133 Ga0209758_1000133126 331
227 3300025299 Ga0209256_1006977 Ga0209256_10069772 331
228 3300025299 Ga0209256_1011635 Ga0209256_10116353 331
229 3300025302 Ga0207426_1000800 Ga0207426_100080030 331
230 3300025302 Ga0207426_1004959 Ga0207426_10049595 331
231 3300025304 Ga0209257_1004185 Ga0209257_10041859 331
232 3300025304 Ga0209257_1026045 Ga0209257_10260452 331
233 3300044658 Ga0466972_0002813 Ga0466972_0002813_2018_3013 331
234 3300044901 Ga0466960_0007894 Ga0466960_0007894_1230_2225 331
235 3300046454 Ga0495592_0026966 Ga0495592_0026966_3134_4129 331
236 3300046462 Ga0495651_0004240 Ga0495651_0004240_9368_10363 331
237 3300046477 Ga0495664_0018925 Ga0495664_0018925_948_1943 331
238 3300046529 Ga0495652_0048131 Ga0495652_0048131_1986_2981 331
239 3300046533 Ga0495640_0163437 Ga0495640_0163437_414_1409 331
240 3300046536 Ga0495587_0185535 Ga0495587_0185535_108_1103 331
241 3300046660 Ga0495625_0200274 Ga0495625_0200274_12_1007 331
242 3300046663 Ga0495635_0067139 Ga0495635_0067139_763_1758 331
243 3300046675 Ga0495657_0008941 Ga0495657_0008941_6220_7215 331
244 3300046679 Ga0495623_0064138 Ga0495623_0064138_381_1376 331
245 3300047317 Ga0495604_0055668 Ga0495604_0055668_1793_2788 331
246 3300048088 Ga0495602_0104551 Ga0495602_0104551_43_1038 331
247 3300048914 Ga0496111_0303289 Ga0496111_0303289_11_1006 331
248 3300048921 Ga0496118_0059677 Ga0496118_0059677_1083_2078 331
249 3300049744 Ga0501083_0128854 Ga0501083_0128854_153_1148 331
250 3300053094 Ga0500566_0000608 Ga0500566_0000608_14942_15937 331
251 3300053105 Ga0500557_000003 Ga0500557_000003_109458_110453 331
252 3300053130 Ga0500642_0000051 Ga0500642_0000051_36358_37353 331
253 3300053177 Ga0500636_0000166 Ga0500636_0000166_30100_31095 331

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

41

176

0.89

PF12146

Hydrolase_4

Serine aminopeptidase, S33

39

174

0.88

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

43

336

0.54

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p4k-assembly1.cif.gz_B soluble epoxide hydrolase in complex with fl217 0.8928 3 326
5cw2-assembly4.cif.gz_D crystal structure of epoxide hydrolase a from mycobacterium thermoresistibile 0.884 5 327
5xmd-assembly2.cif.gz_D-3 crystal structure of epoxide hydrolase vreh1 from vigna radiata 0.8778 1 328
8b6n-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) 0.8778 1 127
5ak6-assembly1.cif.gz_A-2 ligand complex structure of soluble epoxide hydrolase 0.8764 3 326
ID Description Score Start End Superfamily
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9031 6 97 3.40.50.12270
5cw2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8725 5 325 3.40.50.1820
2wj4A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8724 7 129 3.40.50.1820
af_B6SUW2_10_323_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8677 3 325 3.40.50.1820
3pdcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8648 6 326 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A401TTW0-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9584 138 331 GO:0004301
AF-A0A401TTW0-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9536 138 331 GO:0004301
AF-A0A7Y8SQJ3-F1-model_v4 Alpha/beta hydrolase 0.9502 1 325 GO:0016787
AF-A0A2T0QJH6-F1-model_v4 Alpha/beta hydrolase family protein 0.9315 6 138 GO:0016787
AF-A0A1I3U8I9-F1-model_v4 Pimeloyl-ACP methyl ester carboxylesterase 0.9279 84 331 GO:0003824

Feature Viewer

pLDDT pTM Quality
89.42 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map