F363899

General Info

Members Datasets Scaffolds Average Seq Length
253 174 506 137

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_100030676|Ga0070704_1000306762
Length 157
Sequence VGALVESPGRRERHRASLSEINVTPLVDVVLVLLIIFMVTAPMMQRGVDVELPRAESAAGAEEQRLIVTIDRANRIYLNQTSMPLGDLQKHLSRVASSLRDPFVYLRADQAVPYGRVMAVMDHIKKAGIARVGLVTEPTGAPASGRTEESASPARRR

Samples

Sample ID Description Type Environment
1 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
115 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
116 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
117 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
118 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
119 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
120 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
121 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
122 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
123 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
124 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
125 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
126 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
127 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
128 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
129 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
130 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
131 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
141 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
142 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
147 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
148 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
152 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
153 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
154 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
165 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.98
Rhizosphere 96.84
Stem 0
Stem Tuber 0
Unclassified 1.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070704_100030676 3300005549 Bacteria 3605
2 Ga0065712_10134548 3300005290 Bacteria 1509
3 Ga0065715_10191200 3300005293 Bacteria 1414
4 Ga0065707_10460607 3300005295 Bacteria 791
5 Ga0065707_11106137 3300005295 Bacteria 505
6 Ga0070683_102205604 3300005329 Unclassified 529
7 Ga0070690_100054889 3300005330 Bacteria 2551
8 Ga0070690_101459019 3300005330 Bacteria 552
9 Ga0070666_10170768 3300005335 Bacteria 1523
10 Ga0070666_10193973 3300005335 Bacteria 1428
11 Ga0068868_101748082 3300005338 Bacteria 587
12 Ga0070689_100196919 3300005340 Bacteria 1643
13 Ga0070687_100002916 3300005343 Bacteria 6558
14 Ga0070661_100241588 3300005344 Bacteria 1391
15 Ga0070692_10159618 3300005345 Bacteria 1291
16 Ga0070669_100320815 3300005353 Bacteria 1251
17 Ga0070675_100274568 3300005354 Bacteria 1480
18 Ga0070675_100755255 3300005354 Bacteria 887
19 Ga0070671_100350034 3300005355 Bacteria 1261
20 Ga0070673_100010567 3300005364 Bacteria 6253
21 Ga0070688_100015542 3300005365 Bacteria 4335
22 Ga0070688_100214313 3300005365 Bacteria 1354
23 Ga0070659_101296438 3300005366 Bacteria 646
24 Ga0070703_10079974 3300005406 Bacteria 1111
25 Ga0070714_100007549 3300005435 Bacteria 8465
26 Ga0070701_10033067 3300005438 Bacteria 2581
27 Ga0070711_101039862 3300005439 Bacteria 704
28 Ga0070705_100538848 3300005440 Bacteria 893
29 Ga0070700_100424512 3300005441 Bacteria 1005
30 Ga0070708_100307836 3300005445 Bacteria 1492
31 Ga0070708_100955048 3300005445 Bacteria 804
32 Ga0070678_100842895 3300005456 Bacteria 835
33 Ga0068867_100323027 3300005459 Bacteria 1279
34 Ga0068867_100680367 3300005459 Bacteria 906
35 Ga0070685_10089868 3300005466 Bacteria 1857
36 Ga0070707_101146276 3300005468 Bacteria 743
37 Ga0070707_101881147 3300005468 Bacteria 566
38 Ga0070698_101173179 3300005471 Bacteria 717
39 Ga0070699_100229037 3300005518 Bacteria 1657
40 Ga0070684_100684146 3300005535 Bacteria 956
41 Ga0070697_100050563 3300005536 Bacteria 3374
42 Ga0068853_100984127 3300005539 Bacteria 812
43 Ga0070672_101274339 3300005543 Bacteria 656
44 Ga0070686_100004893 3300005544 Bacteria 7389
45 Ga0070704_100102471 3300005549 Bacteria 2160
46 Ga0070704_100121028 3300005549 Bacteria 2011
47 Ga0070704_100187698 3300005549 Bacteria 1659
48 Ga0068855_100990316 3300005563 Bacteria 884
49 Ga0070664_101046105 3300005564 Bacteria 768
50 Ga0068854_100035166 3300005578 Bacteria 3505
51 Ga0068854_100071144 3300005578 Bacteria 2544
52 Ga0070702_100222936 3300005615 Bacteria 1262
53 Ga0068852_100726790 3300005616 Bacteria 1004
54 Ga0068859_100222794 3300005617 Bacteria 1974
55 Ga0068859_100234348 3300005617 Bacteria 1924
56 Ga0068859_101194052 3300005617 Bacteria 838
57 Ga0068861_100803778 3300005719 Bacteria 883
58 Ga0068861_100944445 3300005719 Bacteria 820
59 Ga0068861_101889593 3300005719 Bacteria 594
60 Ga0068858_100643841 3300005842 Bacteria 1030
61 Ga0068862_100438329 3300005844 Bacteria 1229
62 Ga0081539_10277113 3300005985 Bacteria 732
63 Ga0097621_100449447 3300006237 Bacteria 1161
64 Ga0097621_100596897 3300006237 Bacteria 1009
65 Ga0097621_100667499 3300006237 Bacteria 955
66 Ga0068871_100131031 3300006358 Bacteria 2126
67 Ga0068871_100507405 3300006358 Bacteria 1088
68 Ga0075428_101204664 3300006844 Bacteria 798
69 Ga0075428_102229991 3300006844 Bacteria 565
70 Ga0075431_100655667 3300006847 Bacteria 1030
71 Ga0075433_10013196 3300006852 Bacteria 6706
72 Ga0075433_10156207 3300006852 Bacteria 2029
73 Ga0075433_10260093 3300006852 Bacteria 1539
74 Ga0075434_100050197 3300006871 Bacteria 4144
75 Ga0075434_100218930 3300006871 Bacteria 1923
76 Ga0075434_100273652 3300006871 Bacteria 1708
77 Ga0075434_100337939 3300006871 Bacteria 1526
78 Ga0075429_100002186 3300006880 Bacteria 16345
79 Ga0075429_100006753 3300006880 Bacteria 9947
80 Ga0075429_101187709 3300006880 Bacteria 666
81 Ga0068865_100506823 3300006881 Bacteria 1007
82 Ga0075436_100147190 3300006914 Bacteria 1656
83 Ga0097620_100222805 3300006931 Bacteria 1974
84 Ga0097620_100234350 3300006931 Bacteria 1924
85 Ga0097620_101194077 3300006931 Bacteria 838
86 Ga0075435_100000469 3300007076 Bacteria 24538
87 Ga0075435_100210759 3300007076 Bacteria 1648
88 Ga0075435_100252373 3300007076 Bacteria 1502
89 Ga0105240_10019357 3300009093 Bacteria 9097
90 Ga0105240_10153152 3300009093 Bacteria 2744
91 Ga0105240_10480658 3300009093 Bacteria 1385
92 Ga0105240_11818605 3300009093 Bacteria 635
93 Ga0111539_10414704 3300009094 Bacteria 1568
94 Ga0111539_11958726 3300009094 Bacteria 679
95 Ga0105245_11457948 3300009098 Bacteria 735
96 Ga0114129_10353178 3300009147 Bacteria 1947
97 Ga0114129_10489472 3300009147 Bacteria 1608
98 Ga0114129_10613010 3300009147 Bacteria 1409
99 Ga0105242_10696791 3300009176 Bacteria 993
100 Ga0105242_11659402 3300009176 Bacteria 674
101 Ga0105248_10060217 3300009177 Bacteria 4262
102 Ga0105248_10231282 3300009177 Bacteria 2081
103 Ga0105248_10251950 3300009177 Bacteria 1987
104 Ga0105248_10480494 3300009177 Bacteria 1400
105 Ga0105239_10996261 3300010375 Bacteria 963
106 Ga0105246_10880188 3300011119 Bacteria 801
107 Ga0105246_12440549 3300011119 Bacteria 513
108 Ga0157378_10140103 3300013297 Bacteria 2245
109 Ga0157378_11776235 3300013297 Bacteria 665
110 Ga0163162_10384076 3300013306 Bacteria 1537
111 Ga0157375_10144152 3300013308 Bacteria 2511
112 Ga0163163_11416998 3300014325 Bacteria 756
113 Ga0157377_10167212 3300014745 Bacteria 1372
114 Ga0182005_1186905 3300015265 Bacteria 618
115 Ga0163161_10181364 3300017792 Bacteria 1614
116 Ga0207653_10430889 3300025885 Bacteria 517
117 Ga0207680_10276841 3300025903 Bacteria 1165
118 Ga0207685_10373083 3300025905 Bacteria 725
119 Ga0207645_10423966 3300025907 Bacteria 896
120 Ga0207707_10977693 3300025912 Bacteria 696
121 Ga0207695_10145965 3300025913 Bacteria 2310
122 Ga0207695_10149595 3300025913 Bacteria 2275
123 Ga0207695_11208225 3300025913 Bacteria 636
124 Ga0207663_10485253 3300025916 Bacteria 958
125 Ga0207662_10014395 3300025918 Bacteria 4438
126 Ga0207649_10680291 3300025920 Bacteria 797
127 Ga0207646_10707176 3300025922 Bacteria 901
128 Ga0207646_10777415 3300025922 Bacteria 854
129 Ga0207659_10771434 3300025926 Bacteria 825
130 Ga0207659_10800140 3300025926 Bacteria 810
131 Ga0207700_10571921 3300025928 Bacteria 1004
132 Ga0207690_11321926 3300025932 Bacteria 602
133 Ga0207686_10722284 3300025934 Bacteria 793
134 Ga0207686_10786453 3300025934 Bacteria 762
135 Ga0207670_10155870 3300025936 Bacteria 1700
136 Ga0207711_10181269 3300025941 Bacteria 1915
137 Ga0207689_10171819 3300025942 Bacteria 1787
138 Ga0207679_10437715 3300025945 Bacteria 1157
139 Ga0207679_10610545 3300025945 Bacteria 984
140 Ga0207667_10206935 3300025949 Bacteria 2012
141 Ga0207651_10051812 3300025960 Bacteria 2795
142 Ga0207651_10369694 3300025960 Bacteria 1213
143 Ga0207712_10839391 3300025961 Bacteria 809
144 Ga0207712_11954080 3300025961 Bacteria 525
145 Ga0207640_10008800 3300025981 Bacteria 5617
146 Ga0207640_10059574 3300025981 Bacteria 2520
147 Ga0207677_10166659 3300026023 Bacteria 1718
148 Ga0207677_10533057 3300026023 Bacteria 1020
149 Ga0207703_10324107 3300026035 Bacteria 1411
150 Ga0207703_10906019 3300026035 Bacteria 844
151 Ga0207639_10585407 3300026041 Bacteria 1028
152 Ga0207639_10705385 3300026041 Bacteria 936
153 Ga0207708_10016298 3300026075 Bacteria 5586
154 Ga0207708_10091919 3300026075 Bacteria 2341
155 Ga0207708_11241310 3300026075 Bacteria 652
156 Ga0207641_10093490 3300026088 Bacteria 2636
157 Ga0207648_11349495 3300026089 Bacteria 670
158 Ga0207675_100196380 3300026118 Bacteria 1937
159 Ga0207675_100832318 3300026118 Bacteria 937
160 Ga0207683_10654103 3300026121 Bacteria 973
161 Ga0207698_10471829 3300026142 Bacteria 1215
162 Ga0207428_10054743 3300027907 Bacteria 3176
163 Ga0268265_10405106 3300028380 Bacteria 1262
164 Ga0316182_1104280 3300030745 Bacteria 976
165 Ga0307405_10153566 3300031731 Bacteria 1622
166 Ga0307410_10139914 3300031852 Bacteria 1789
167 Ga0307406_10191698 3300031901 Bacteria 1497
168 Ga0307407_10031303 3300031903 Bacteria 2880
169 Ga0307409_100205902 3300031995 Bacteria 1764
170 Ga0307416_100860680 3300032002 Bacteria 1005
171 Ga0316593_10272558 3300032168 Bacteria 636
172 Ga0373930_0012153 3300034816 Bacteria 1566
173 Ga0373948_0003128 3300034817 Bacteria 2516
174 Ga0373950_0059609 3300034818 Bacteria 764
175 Ga0373959_0006056 3300034820 Bacteria 1997
176 Ga0373938_0026815 3300034957 Bacteria 1208
177 Ga0373928_0001422 3300035084 Bacteria 4661
178 Ga0373929_0000275 3300035085 Bacteria 9529
179 Ga0373949_0022484 3300035090 Bacteria 1454
180 Ga0373951_0000674 3300035091 Bacteria 9418
181 Ga0373952_0000248 3300035092 Bacteria 8791
182 Ga0373932_0000219 3300035112 Bacteria 16992
183 Ga0373939_0002800 3300035114 Bacteria 4091
184 Ga0373941_0000159 3300035115 Bacteria 12239
185 Ga0373960_0004245 3300035121 Bacteria 3273
186 Ga0373955_0284244 3300035172 Bacteria 996
187 Ga0373942_0000841 3300035207 Bacteria 8426
188 Ga0373961_0004223 3300035241 Bacteria 3487
189 Ga0373962_0006449 3300035242 Bacteria 2842
190 Ga0373931_0004493 3300035691 Bacteria 6377
191 Ga0316582_0376963 3300036647 Bacteria 977
192 Ga0373925_1219895 3300037068 Bacteria 618
193 Ga0395900_0541885 3300037418 Bacteria 1109
194 Ga0395900_0935904 3300037418 Bacteria 789
195 Ga0395898_0273664 3300037466 Bacteria 1610
196 Ga0395905_0092484 3300037471 Bacteria 2836
197 Ga0395905_0187157 3300037471 Bacteria 1943
198 Ga0395905_1019269 3300037471 Unclassified 731
199 Ga0395901_0217358 3300038443 Bacteria 1998
200 Ga0436365_1364203 3300039437 Bacteria 2857
201 Ga0451800_1528839 3300041459 Bacteria 645
202 Ga0450896_088376 3300042133 Bacteria 527
203 Ga0450908_096575 3300042184 Bacteria 539
204 Ga0451577_0027892 3300042876 Bacteria 5109
205 Ga0451577_0737011 3300042876 Bacteria 892
206 Ga0451576_0000138 3300045051 Bacteria 185167
207 Ga0451576_0027356 3300045051 Bacteria 6126
208 Ga0451576_0050530 3300045051 Bacteria 4360
209 Ga0451576_0173705 3300045051 Bacteria 2249
210 Ga0451576_0319889 3300045051 Bacteria 1623
211 Ga0451576_2161401 3300045051 Bacteria 572
212 Ga0466967_0667528 3300045976 Bacteria 1029
213 Ga0495603_0463825 3300046455 Bacteria 725
214 Ga0495634_0235847 3300046642 Bacteria 1124
215 Ga0495669_0255355 3300046684 Bacteria 842
216 Ga0496101_1563236 3300048904 Bacteria 513
217 Ga0496106_0473202 3300048909 Bacteria 1007
218 Ga0496107_0120940 3300048910 Bacteria 1929
219 Ga0496107_0183467 3300048910 Bacteria 1554
220 Ga0496116_0056941 3300048919 Bacteria 2559
221 Ga0496117_0093792 3300048920 Bacteria 1924
222 Ga0501031_0101573 3300049568 Bacteria 1877
223 Ga0501032_0081025 3300049569 Bacteria 2160
224 Ga0501033_0086546 3300049570 Bacteria 2294
225 Ga0501034_0098444 3300049571 Bacteria 2920
226 Ga0501034_0142911 3300049571 Unclassified 2372
227 Ga0501036_0278572 3300049572 Bacteria 1400
228 Ga0501037_0092382 3300049573 Bacteria 2189
229 Ga0501038_0013869 3300049574 Bacteria 7344
230 Ga0501043_0014318 3300049579 Bacteria 6207
231 Ga0501043_0264820 3300049579 Bacteria 1321
232 Ga0501046_0053625 3300049580 Bacteria 3175
233 Ga0501046_0153985 3300049580 Bacteria 1733
234 Ga0501047_0000239 3300049581 Bacteria 65030
235 Ga0501067_0357530 3300049583 Bacteria 814
236 Ga0501070_1002010 3300049586 Unclassified 648
237 Ga0501076_0586310 3300049592 Bacteria 920
238 Ga0501035_0000617 3300049822 Bacteria 39187
239 Ga0501035_0505557 3300049822 Bacteria 994
240 Ga0501044_0000205 3300049823 Bacteria 75083
241 Ga0501044_0088739 3300049823 Bacteria 3121
242 nmdc:mga05p37_647136_c1 3300050507 Bacteria 1184
243 nmdc:mga05p37_771595_c1 3300050507 Bacteria 1056
244 nmdc:mga09592_815_c1 3300050508 Bacteria 24079
245 nmdc:mga09592_8877_c1 3300050508 Bacteria 8175
246 nmdc:mga09592_964443_c1 3300050508 Bacteria 714
247 nmdc:mga08y16_93586_c1 3300050511 Bacteria 3131
248 nmdc:mga0n895_1174753_c1 3300050512 Bacteria 742
249 nmdc:mga0n895_148432_c1 3300050512 Bacteria 2374
250 nmdc:mga0n895_52464_c1 3300050512 Bacteria 4003
251 nmdc:mga0rr50_3289_c1 3300050513 Bacteria 9278
252 nmdc:mga0rr50_58367_c1 3300050513 Bacteria 2892
253 Ga0495619_0091945 3300053085 Bacteria 2055
254 Ga0070704_100030676
255 Ga0065712_10134548
256 Ga0065715_10191200
257 Ga0065707_10460607
258 Ga0065707_11106137
259 Ga0070683_102205604
260 Ga0070690_100054889
261 Ga0070690_101459019
262 Ga0070666_10170768
263 Ga0070666_10193973
264 Ga0068868_101748082
265 Ga0070689_100196919
266 Ga0070687_100002916
267 Ga0070661_100241588
268 Ga0070692_10159618
269 Ga0070669_100320815
270 Ga0070675_100274568
271 Ga0070675_100755255
272 Ga0070671_100350034
273 Ga0070673_100010567
274 Ga0070688_100015542
275 Ga0070688_100214313
276 Ga0070659_101296438
277 Ga0070703_10079974
278 Ga0070714_100007549
279 Ga0070701_10033067
280 Ga0070711_101039862
281 Ga0070705_100538848
282 Ga0070700_100424512
283 Ga0070708_100307836
284 Ga0070708_100955048
285 Ga0070678_100842895
286 Ga0068867_100323027
287 Ga0068867_100680367
288 Ga0070685_10089868
289 Ga0070707_101146276
290 Ga0070707_101881147
291 Ga0070698_101173179
292 Ga0070699_100229037
293 Ga0070684_100684146
294 Ga0070697_100050563
295 Ga0068853_100984127
296 Ga0070672_101274339
297 Ga0070686_100004893
298 Ga0070704_100102471
299 Ga0070704_100121028
300 Ga0070704_100187698
301 Ga0068855_100990316
302 Ga0070664_101046105
303 Ga0068854_100035166
304 Ga0068854_100071144
305 Ga0070702_100222936
306 Ga0068852_100726790
307 Ga0068859_100222794
308 Ga0068859_100234348
309 Ga0068859_101194052
310 Ga0068861_100803778
311 Ga0068861_100944445
312 Ga0068861_101889593
313 Ga0068858_100643841
314 Ga0068862_100438329
315 Ga0081539_10277113
316 Ga0097621_100449447
317 Ga0097621_100596897
318 Ga0097621_100667499
319 Ga0068871_100131031
320 Ga0068871_100507405
321 Ga0075428_101204664
322 Ga0075428_102229991
323 Ga0075431_100655667
324 Ga0075433_10013196
325 Ga0075433_10156207
326 Ga0075433_10260093
327 Ga0075434_100050197
328 Ga0075434_100218930
329 Ga0075434_100273652
330 Ga0075434_100337939
331 Ga0075429_100002186
332 Ga0075429_100006753
333 Ga0075429_101187709
334 Ga0068865_100506823
335 Ga0075436_100147190
336 Ga0097620_100222805
337 Ga0097620_100234350
338 Ga0097620_101194077
339 Ga0075435_100000469
340 Ga0075435_100210759
341 Ga0075435_100252373
342 Ga0105240_10019357
343 Ga0105240_10153152
344 Ga0105240_10480658
345 Ga0105240_11818605
346 Ga0111539_10414704
347 Ga0111539_11958726
348 Ga0105245_11457948
349 Ga0114129_10353178
350 Ga0114129_10489472
351 Ga0114129_10613010
352 Ga0105242_10696791
353 Ga0105242_11659402
354 Ga0105248_10060217
355 Ga0105248_10231282
356 Ga0105248_10251950
357 Ga0105248_10480494
358 Ga0105239_10996261
359 Ga0105246_10880188
360 Ga0105246_12440549
361 Ga0157378_10140103
362 Ga0157378_11776235
363 Ga0163162_10384076
364 Ga0157375_10144152
365 Ga0163163_11416998
366 Ga0157377_10167212
367 Ga0182005_1186905
368 Ga0163161_10181364
369 Ga0207653_10430889
370 Ga0207680_10276841
371 Ga0207685_10373083
372 Ga0207645_10423966
373 Ga0207707_10977693
374 Ga0207695_10145965
375 Ga0207695_10149595
376 Ga0207695_11208225
377 Ga0207663_10485253
378 Ga0207662_10014395
379 Ga0207649_10680291
380 Ga0207646_10707176
381 Ga0207646_10777415
382 Ga0207659_10771434
383 Ga0207659_10800140
384 Ga0207700_10571921
385 Ga0207690_11321926
386 Ga0207686_10722284
387 Ga0207686_10786453
388 Ga0207670_10155870
389 Ga0207711_10181269
390 Ga0207689_10171819
391 Ga0207679_10437715
392 Ga0207679_10610545
393 Ga0207667_10206935
394 Ga0207651_10051812
395 Ga0207651_10369694
396 Ga0207712_10839391
397 Ga0207712_11954080
398 Ga0207640_10008800
399 Ga0207640_10059574
400 Ga0207677_10166659
401 Ga0207677_10533057
402 Ga0207703_10324107
403 Ga0207703_10906019
404 Ga0207639_10585407
405 Ga0207639_10705385
406 Ga0207708_10016298
407 Ga0207708_10091919
408 Ga0207708_11241310
409 Ga0207641_10093490
410 Ga0207648_11349495
411 Ga0207675_100196380
412 Ga0207675_100832318
413 Ga0207683_10654103
414 Ga0207698_10471829
415 Ga0207428_10054743
416 Ga0268265_10405106
417 Ga0316182_1104280
418 Ga0307405_10153566
419 Ga0307410_10139914
420 Ga0307406_10191698
421 Ga0307407_10031303
422 Ga0307409_100205902
423 Ga0307416_100860680
424 Ga0316593_10272558
425 Ga0373930_0012153
426 Ga0373948_0003128
427 Ga0373950_0059609
428 Ga0373959_0006056
429 Ga0373938_0026815
430 Ga0373928_0001422
431 Ga0373929_0000275
432 Ga0373949_0022484
433 Ga0373951_0000674
434 Ga0373952_0000248
435 Ga0373932_0000219
436 Ga0373939_0002800
437 Ga0373941_0000159
438 Ga0373960_0004245
439 Ga0373955_0284244
440 Ga0373942_0000841
441 Ga0373961_0004223
442 Ga0373962_0006449
443 Ga0373931_0004493
444 Ga0316582_0376963
445 Ga0373925_1219895
446 Ga0395900_0541885
447 Ga0395900_0935904
448 Ga0395898_0273664
449 Ga0395905_0092484
450 Ga0395905_0187157
451 Ga0395905_1019269
452 Ga0395901_0217358
453 Ga0436365_1364203
454 Ga0451800_1528839
455 Ga0450896_088376
456 Ga0450908_096575
457 Ga0451577_0027892
458 Ga0451577_0737011
459 Ga0451576_0000138
460 Ga0451576_0027356
461 Ga0451576_0050530
462 Ga0451576_0173705
463 Ga0451576_0319889
464 Ga0451576_2161401
465 Ga0466967_0667528
466 Ga0495603_0463825
467 Ga0495634_0235847
468 Ga0495669_0255355
469 Ga0496101_1563236
470 Ga0496106_0473202
471 Ga0496107_0120940
472 Ga0496107_0183467
473 Ga0496116_0056941
474 Ga0496117_0093792
475 Ga0501031_0101573
476 Ga0501032_0081025
477 Ga0501033_0086546
478 Ga0501034_0098444
479 Ga0501034_0142911
480 Ga0501036_0278572
481 Ga0501037_0092382
482 Ga0501038_0013869
483 Ga0501043_0014318
484 Ga0501043_0264820
485 Ga0501046_0053625
486 Ga0501046_0153985
487 Ga0501047_0000239
488 Ga0501067_0357530
489 Ga0501070_1002010
490 Ga0501076_0586310
491 Ga0501035_0000617
492 Ga0501035_0505557
493 Ga0501044_0000205
494 Ga0501044_0088739
495 nmdc:mga05p37_647136_c1
496 nmdc:mga05p37_771595_c1
497 nmdc:mga09592_815_c1
498 nmdc:mga09592_8877_c1
499 nmdc:mga09592_964443_c1
500 nmdc:mga08y16_93586_c1
501 nmdc:mga0n895_1174753_c1
502 nmdc:mga0n895_148432_c1
503 nmdc:mga0n895_52464_c1
504 nmdc:mga0rr50_3289_c1
505 nmdc:mga0rr50_58367_c1
506 Ga0495619_0091945

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

14

139

0.97

Map