F363597

General Info

Members Datasets Scaffolds Average Seq Length
252 161 505 132

Family's Representative Sequence

Representative Sequence 3300049589|Ga0501073_0202615|Ga0501073_0202615_244_684
Length 146
Sequence MDRESFFQLWSPRMRSVLRIMTGLLFLQHGLMKLFAWPPSEMFAQPVALASLVGVAGVLEVVGGTLIIVGLLTRITAFVLSGQMAVAYFMAHAPQNFFPVLNGGESAVLFCFVFLYLAFAGGGVWSLDQAFRSGSRNFVVKAKAAD

Samples

Sample ID Description Type Environment
1 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
63 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
64 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
100 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
101 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
102 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
103 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
104 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
109 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
110 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
111 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
112 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
113 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
114 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
115 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
116 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
117 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
118 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
119 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
120 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
121 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
122 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
123 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
124 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
125 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
126 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
127 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
128 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
134 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
135 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
136 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
137 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
138 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
139 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
140 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
141 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
142 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
143 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
144 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
145 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
146 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
147 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
148 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
149 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
150 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
151 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
152 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
153 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
154 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
155 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
156 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
157 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
158 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
159 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
160 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
161 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.27
Nodule 0
Rhizoplane 3.17
Rhizosphere 73.81
Stem 0
Stem Tuber 0
Unclassified 1.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501073_0202615 3300049589 Unclassified 1372
2 JGI24736J21556_1001569 3300001904 Bacteria 4161
3 JGI24739J22299_10003814 3300001989 Bacteria 5753
4 JGI24739J22299_10234902 3300001989 Bacteria 537
5 JGI24737J22298_10001595 3300001990 Bacteria 8065
6 JGI24737J22298_10001668 3300001990 Bacteria 7911
7 JGI24737J22298_10012934 3300001990 Bacteria 2720
8 JGI24735J21928_10002870 3300002067 Bacteria 5943
9 JGI24735J21928_10029604 3300002067 Bacteria 1629
10 JGI24735J21928_10055903 3300002067 Bacteria 1136
11 JGI24738J21930_10002817 3300002075 Bacteria 4455
12 rootH1_10015094 3300003316 Bacteria 3029
13 rootH1_10015094 3300003323 Bacteria 1440
14 rootL2_10330239 3300003322 Bacteria 1201
15 rootH1_10203301 3300003323 Bacteria 3459
16 rootH1_10225823 3300003323 Bacteria 2672
17 Ga0055531_10000966 3300003794 Bacteria 23016
18 Ga0055543_1053107 3300004625 Bacteria 661
19 Ga0065165_1000277 3300005262 Bacteria 87540
20 Ga0065165_1038718 3300005262 Bacteria 1435
21 Ga0065165_1047535 3300005262 Bacteria 1238
22 Ga0070658_10666144 3300005327 Bacteria 903
23 Ga0070690_100697689 3300005330 Bacteria 779
24 Ga0070670_102261928 3300005331 Bacteria 501
25 Ga0070666_10076605 3300005335 Bacteria 2282
26 Ga0070666_10277849 3300005335 Bacteria 1190
27 Ga0070660_100094743 3300005339 Bacteria 2359
28 Ga0070660_100371218 3300005339 Bacteria 1180
29 Ga0070661_100424752 3300005344 Bacteria 1054
30 Ga0070661_101558020 3300005344 Bacteria 558
31 Ga0070668_100000097 3300005347 Bacteria 53800
32 Ga0070668_100043214 3300005347 Bacteria 3456
33 Ga0070669_100748044 3300005353 Bacteria 828
34 Ga0070675_100467150 3300005354 Bacteria 1133
35 Ga0070671_100001361 3300005355 Bacteria 18331
36 Ga0070671_100510367 3300005355 Bacteria 1034
37 Ga0070674_100191539 3300005356 Bacteria 1573
38 Ga0070659_101491015 3300005366 Unclassified 602
39 Ga0070667_100000083 3300005367 Bacteria 118261
40 Ga0070714_101061840 3300005435 Bacteria 789
41 Ga0070663_100377232 3300005455 Bacteria 1154
42 Ga0070663_100593042 3300005455 Bacteria 931
43 Ga0070662_100023703 3300005457 Bacteria 4219
44 Ga0070662_100292500 3300005457 Bacteria 1321
45 Ga0070662_100565099 3300005457 Bacteria 954
46 Ga0070679_100181613 3300005530 Bacteria 2076
47 Ga0070679_100860995 3300005530 Bacteria 850
48 Ga0068853_100114495 3300005539 Bacteria 2399
49 Ga0068853_100957959 3300005539 Bacteria 823
50 Ga0068853_101215493 3300005539 Bacteria 728
51 Ga0068853_101651653 3300005539 Bacteria 621
52 Ga0070672_100879274 3300005543 Bacteria 791
53 Ga0070665_100000116 3300005548 Bacteria 150141
54 Ga0070665_100000483 3300005548 Bacteria 57237
55 Ga0070665_101431148 3300005548 Bacteria 700
56 Ga0068855_100001736 3300005563 Bacteria 27204
57 Ga0070664_100175509 3300005564 Bacteria 1902
58 Ga0070664_101017354 3300005564 Bacteria 779
59 Ga0068854_100547342 3300005578 Bacteria 981
60 Ga0068856_100628763 3300005614 Bacteria 1094
61 Ga0068856_102650762 3300005614 Bacteria 507
62 Ga0068859_100251171 3300005617 Bacteria 1859
63 Ga0068859_101940093 3300005617 Bacteria 650
64 Ga0068864_100000786 3300005618 Bacteria 26635
65 Ga0068861_101571798 3300005719 Bacteria 647
66 Ga0068870_10700659 3300005840 Bacteria 699
67 Ga0068863_100000392 3300005841 Bacteria 44421
68 Ga0068858_100004211 3300005842 Bacteria 14164
69 Ga0068860_100000128 3300005843 Bacteria 122731
70 Ga0068860_100000145 3300005843 Bacteria 115830
71 Ga0068862_100000121 3300005844 Bacteria 91849
72 Ga0068862_100312162 3300005844 Bacteria 1449
73 Ga0068862_100352905 3300005844 Bacteria 1365
74 Ga0075366_10025128 3300006195 Bacteria 3477
75 Ga0075366_10100784 3300006195 Bacteria 1733
76 Ga0075370_10008332 3300006353 Bacteria 5330
77 Ga0075370_10630670 3300006353 Bacteria 650
78 Ga0068865_100085292 3300006881 Bacteria 2278
79 Ga0097620_100251185 3300006931 Bacteria 1859
80 Ga0097620_101940622 3300006931 Bacteria 650
81 Ga0105240_10095672 3300009093 Bacteria 3621
82 Ga0105247_10139195 3300009101 Bacteria 1589
83 Ga0105248_10033806 3300009177 Bacteria 5713
84 Ga0105248_10675425 3300009177 Bacteria 1165
85 Ga0105237_10321929 3300009545 Bacteria 1550
86 Ga0105237_10465799 3300009545 Bacteria 1270
87 Ga0105237_11283893 3300009545 Bacteria 738
88 Ga0105238_10355740 3300009551 Bacteria 1453
89 Ga0105238_10478694 3300009551 Bacteria 1244
90 Ga0105238_11230273 3300009551 Bacteria 774
91 Ga0105249_10000410 3300009553 Bacteria 41122
92 Ga0105239_10070993 3300010375 Bacteria 3825
93 Ga0105239_10209052 3300010375 Bacteria 2187
94 Ga0105239_10363721 3300010375 Bacteria 1634
95 Ga0105239_10727523 3300010375 Bacteria 1135
96 Ga0105239_11762656 3300010375 Bacteria 717
97 Ga0105246_10034356 3300011119 Bacteria 3378
98 Ga0163162_11853627 3300013306 Bacteria 690
99 Ga0157372_10032961 3300013307 Bacteria 5686
100 Ga0157372_11213729 3300013307 Bacteria 871
101 Ga0157380_10266049 3300014326 Bacteria 1560
102 Ga0157379_10011660 3300014968 Bacteria 7674
103 Ga0163161_10297360 3300017792 Bacteria 1270
104 Ga0163161_10932151 3300017792 Bacteria 738
105 Ga0213876_10031542 3300021384 Bacteria 2796
106 Ga0209026_1000888 3300025250 Bacteria 15481
107 Ga0209677_125788 3300025253 Bacteria 632
108 Ga0207710_10243187 3300025900 Bacteria 898
109 Ga0207688_10396812 3300025901 Bacteria 855
110 Ga0207680_10199921 3300025903 Bacteria 1361
111 Ga0207680_10321068 3300025903 Bacteria 1083
112 Ga0207647_10000178 3300025904 Bacteria 50957
113 Ga0207647_10033953 3300025904 Bacteria 3261
114 Ga0207647_10617665 3300025904 Bacteria 597
115 Ga0207707_10364946 3300025912 Bacteria 1243
116 Ga0207695_10046119 3300025913 Bacteria 4621
117 Ga0207695_10050184 3300025913 Bacteria 4391
118 Ga0207695_10677782 3300025913 Bacteria 912
119 Ga0207695_11283864 3300025913 Bacteria 612
120 Ga0207671_10677621 3300025914 Bacteria 820
121 Ga0207671_11000520 3300025914 Bacteria 659
122 Ga0207657_10291490 3300025919 Bacteria 1294
123 Ga0207657_10378722 3300025919 Bacteria 1115
124 Ga0207652_10316953 3300025921 Bacteria 1408
125 Ga0207652_10361759 3300025921 Bacteria 1310
126 Ga0207694_10040545 3300025924 Bacteria 3585
127 Ga0207694_10412805 3300025924 Bacteria 1124
128 Ga0207694_10469193 3300025924 Bacteria 1052
129 Ga0207694_10846739 3300025924 Bacteria 773
130 Ga0207694_11553276 3300025924 Bacteria 558
131 Ga0207650_10000062 3300025925 Bacteria 149776
132 Ga0207659_10411474 3300025926 Bacteria 1133
133 Ga0207664_10376274 3300025929 Bacteria 1260
134 Ga0207644_10000790 3300025931 Bacteria 20093
135 Ga0207644_10120813 3300025931 Bacteria 1994
136 Ga0207690_10013914 3300025932 Bacteria 4848
137 Ga0207690_11180657 3300025932 Unclassified 639
138 Ga0207706_10030404 3300025933 Bacteria 4818
139 Ga0207706_10451113 3300025933 Bacteria 1112
140 Ga0207706_11219694 3300025933 Bacteria 624
141 Ga0207706_11530073 3300025933 Bacteria 543
142 Ga0207669_10076559 3300025937 Bacteria 2124
143 Ga0207704_10945252 3300025938 Bacteria 727
144 Ga0207711_10038101 3300025941 Bacteria 4087
145 Ga0207679_10191561 3300025945 Bacteria 1701
146 Ga0207667_10004037 3300025949 Bacteria 18034
147 Ga0207651_10328394 3300025960 Bacteria 1281
148 Ga0207712_10001004 3300025961 Bacteria 20092
149 Ga0207668_10000828 3300025972 Bacteria 18733
150 Ga0207668_10017498 3300025972 Bacteria 4491
151 Ga0207658_10000209 3300025986 Bacteria 61041
152 Ga0207658_10243510 3300025986 Bacteria 1525
153 Ga0207658_11824641 3300025986 Unclassified 555
154 Ga0207703_10003500 3300026035 Bacteria 13131
155 Ga0207703_10441923 3300026035 Bacteria 1213
156 Ga0207639_10043424 3300026041 Bacteria 3374
157 Ga0207639_11124905 3300026041 Bacteria 737
158 Ga0207639_11631222 3300026041 Bacteria 605
159 Ga0207678_10085941 3300026067 Bacteria 2688
160 Ga0207678_10158715 3300026067 Bacteria 1931
161 Ga0207678_10944796 3300026067 Bacteria 763
162 Ga0207702_10435091 3300026078 Bacteria 1270
163 Ga0207702_11723619 3300026078 Bacteria 619
164 Ga0207641_10000341 3300026088 Bacteria 56155
165 Ga0207676_10000797 3300026095 Bacteria 24574
166 Ga0268266_10000064 3300028379 Bacteria 249533
167 Ga0268266_10001340 3300028379 Bacteria 29786
168 Ga0268266_10030647 3300028379 Bacteria 4569
169 Ga0268266_11299391 3300028379 Bacteria 703
170 Ga0268265_10007012 3300028380 Bacteria 7620
171 Ga0268265_10013179 3300028380 Bacteria 5616
172 Ga0268265_10290071 3300028380 Bacteria 1468
173 Ga0268264_10000046 3300028381 Bacteria 364597
174 Ga0268264_10000059 3300028381 Bacteria 306927
175 Ga0307511_10016571 3300030521 Bacteria 7098
176 Ga0265327_10000166 3300031251 Bacteria 141539
177 Ga0307513_10000181 3300031456 Bacteria 91264
178 Ga0307513_10563081 3300031456 Bacteria 851
179 Ga0307510_10040874 3300033180 Bacteria 5081
180 Ga0373943_0204027 3300035170 Bacteria 1095
181 Ga0373925_0365653 3300037068 Bacteria 1173
182 Ga0395905_0000174 3300037471 Bacteria 104301
183 Ga0395905_0830088 3300037471 Unclassified 827
184 Ga0395905_1279519 3300037471 Bacteria 637
185 Ga0395901_0178615 3300038443 Bacteria 2226
186 Ga0436365_1494280 3300039437 Bacteria 3272
187 Ga0436360_1030276 3300039438 Bacteria 2793
188 Ga0436361_0662716 3300039447 Bacteria 2591
189 Ga0451806_623294 3300041462 Bacteria 1263
190 Ga0451807_0752095 3300041486 Bacteria 1502
191 Ga0451849_1461687 3300041505 Bacteria 1030
192 Ga0439448_0001311 3300042005 Bacteria 6355
193 Ga0439434_0101727 3300042435 Bacteria 926
194 Ga0466965_0286917 3300044683 Bacteria 890
195 Ga0495616_0202021 3300046513 Bacteria 873
196 Ga0495620_0118082 3300046515 Bacteria 1047
197 Ga0495642_0055534 3300046528 Bacteria 1635
198 Ga0495597_0011719 3300046542 Bacteria 4246
199 Ga0495622_0001737 3300046557 Bacteria 10774
200 Ga0495667_0158714 3300046559 Bacteria 1455
201 Ga0495668_0080221 3300046616 Bacteria 1791
202 Ga0495625_0000342 3300046660 Bacteria 71332
203 Ga0495660_0025932 3300046810 Bacteria 3325
204 Ga0495677_0085084 3300047445 Bacteria 1188
205 Ga0495684_0043500 3300047471 Bacteria 3439
206 Ga0495686_0004653 3300047472 Bacteria 11145
207 Ga0495686_0369979 3300047472 Bacteria 775
208 Ga0495686_0690359 3300047472 Bacteria 521
209 Ga0495593_0410668 3300047673 Bacteria 677
210 Ga0496101_0865107 3300048904 Bacteria 712
211 Ga0496102_0010654 3300048905 Bacteria 7920
212 Ga0496104_0235966 3300048907 Bacteria 1741
213 Ga0496104_0449751 3300048907 Bacteria 1200
214 Ga0496112_0081871 3300048915 Bacteria 3193
215 Ga0496112_0231753 3300048915 Bacteria 1801
216 Ga0496119_0000213 3300048922 Bacteria 82822
217 Ga0496121_0792870 3300048924 Bacteria 558
218 Ga0496124_0081914 3300048927 Bacteria 2650
219 Ga0496125_0104031 3300048928 Bacteria 2081
220 Ga0496126_0004695 3300048929 Bacteria 16142
221 Ga0495682_0320578 3300049460 Bacteria 546
222 Ga0501033_1143402 3300049570 Bacteria 517
223 nmdc:mga07m45_273158_c1 3300050496 Bacteria 983
224 nmdc:mga0sz30_3225_c1 3300050516 Bacteria 5858
225 Ga0500635_0000186 3300053080 Bacteria 32044
226 Ga0500578_0286926 3300053086 Bacteria 980
227 Ga0500566_0205560 3300053094 Bacteria 990
228 Ga0500566_0308994 3300053094 Bacteria 741
229 Ga0500562_001429 3300053108 Bacteria 5875
230 Ga0500569_308272 3300053109 Bacteria 531
231 Ga0500595_003668 3300053119 Bacteria 7101
232 Ga0500595_004764 3300053119 Bacteria 6011
233 Ga0500595_056268 3300053119 Bacteria 1202
234 Ga0500607_175320 3300053121 Bacteria 959
235 Ga0500607_193670 3300053121 Bacteria 884
236 Ga0500608_000025 3300053122 Bacteria 71403
237 Ga0500608_023041 3300053122 Bacteria 2893
238 Ga0500614_026529 3300053123 Bacteria 1385
239 Ga0500642_0143884 3300053130 Bacteria 1119
240 Ga0500559_0001640 3300053136 Bacteria 12400
241 Ga0500559_0017633 3300053136 Bacteria 3016
242 Ga0500590_021824 3300053148 Bacteria 3322
243 Ga0500590_176870 3300053148 Bacteria 931
244 Ga0500619_030087 3300053154 Bacteria 1647
245 Ga0500622_0009768 3300053156 Bacteria 5297
246 Ga0500638_101231 3300053162 Bacteria 1343
247 Ga0500639_326787 3300053163 Bacteria 558
248 Ga0500636_0011778 3300053177 Bacteria 5120
249 Ga0500636_0317270 3300053177 Bacteria 759
250 Ga0500637_0009167 3300053178 Bacteria 5024
251 Ga0500637_0009178 3300053178 Bacteria 5021
252 Ga0500645_004437 3300053730 Bacteria 5389
253 Ga0500596_020362 3300053735 Bacteria 997
254 Ga0501073_0202615
255 JGI24736J21556_1001569
256 JGI24739J22299_10003814
257 JGI24739J22299_10234902
258 JGI24737J22298_10001595
259 JGI24737J22298_10001668
260 JGI24737J22298_10012934
261 JGI24735J21928_10002870
262 JGI24735J21928_10029604
263 JGI24735J21928_10055903
264 JGI24738J21930_10002817
265 rootH1_10015094
266 rootL2_10330239
267 rootH1_10203301
268 rootH1_10225823
269 Ga0055531_10000966
270 Ga0055543_1053107
271 Ga0065165_1000277
272 Ga0065165_1038718
273 Ga0065165_1047535
274 Ga0070658_10666144
275 Ga0070690_100697689
276 Ga0070670_102261928
277 Ga0070666_10076605
278 Ga0070666_10277849
279 Ga0070660_100094743
280 Ga0070660_100371218
281 Ga0070661_100424752
282 Ga0070661_101558020
283 Ga0070668_100000097
284 Ga0070668_100043214
285 Ga0070669_100748044
286 Ga0070675_100467150
287 Ga0070671_100001361
288 Ga0070671_100510367
289 Ga0070674_100191539
290 Ga0070659_101491015
291 Ga0070667_100000083
292 Ga0070714_101061840
293 Ga0070663_100377232
294 Ga0070663_100593042
295 Ga0070662_100023703
296 Ga0070662_100292500
297 Ga0070662_100565099
298 Ga0070679_100181613
299 Ga0070679_100860995
300 Ga0068853_100114495
301 Ga0068853_100957959
302 Ga0068853_101215493
303 Ga0068853_101651653
304 Ga0070672_100879274
305 Ga0070665_100000116
306 Ga0070665_100000483
307 Ga0070665_101431148
308 Ga0068855_100001736
309 Ga0070664_100175509
310 Ga0070664_101017354
311 Ga0068854_100547342
312 Ga0068856_100628763
313 Ga0068856_102650762
314 Ga0068859_100251171
315 Ga0068859_101940093
316 Ga0068864_100000786
317 Ga0068861_101571798
318 Ga0068870_10700659
319 Ga0068863_100000392
320 Ga0068858_100004211
321 Ga0068860_100000128
322 Ga0068860_100000145
323 Ga0068862_100000121
324 Ga0068862_100312162
325 Ga0068862_100352905
326 Ga0075366_10025128
327 Ga0075366_10100784
328 Ga0075370_10008332
329 Ga0075370_10630670
330 Ga0068865_100085292
331 Ga0097620_100251185
332 Ga0097620_101940622
333 Ga0105240_10095672
334 Ga0105247_10139195
335 Ga0105248_10033806
336 Ga0105248_10675425
337 Ga0105237_10321929
338 Ga0105237_10465799
339 Ga0105237_11283893
340 Ga0105238_10355740
341 Ga0105238_10478694
342 Ga0105238_11230273
343 Ga0105249_10000410
344 Ga0105239_10070993
345 Ga0105239_10209052
346 Ga0105239_10363721
347 Ga0105239_10727523
348 Ga0105239_11762656
349 Ga0105246_10034356
350 Ga0163162_11853627
351 Ga0157372_10032961
352 Ga0157372_11213729
353 Ga0157380_10266049
354 Ga0157379_10011660
355 Ga0163161_10297360
356 Ga0163161_10932151
357 Ga0213876_10031542
358 Ga0209026_1000888
359 Ga0209677_125788
360 Ga0207710_10243187
361 Ga0207688_10396812
362 Ga0207680_10199921
363 Ga0207680_10321068
364 Ga0207647_10000178
365 Ga0207647_10033953
366 Ga0207647_10617665
367 Ga0207707_10364946
368 Ga0207695_10046119
369 Ga0207695_10050184
370 Ga0207695_10677782
371 Ga0207695_11283864
372 Ga0207671_10677621
373 Ga0207671_11000520
374 Ga0207657_10291490
375 Ga0207657_10378722
376 Ga0207652_10316953
377 Ga0207652_10361759
378 Ga0207694_10040545
379 Ga0207694_10412805
380 Ga0207694_10469193
381 Ga0207694_10846739
382 Ga0207694_11553276
383 Ga0207650_10000062
384 Ga0207659_10411474
385 Ga0207664_10376274
386 Ga0207644_10000790
387 Ga0207644_10120813
388 Ga0207690_10013914
389 Ga0207690_11180657
390 Ga0207706_10030404
391 Ga0207706_10451113
392 Ga0207706_11219694
393 Ga0207706_11530073
394 Ga0207669_10076559
395 Ga0207704_10945252
396 Ga0207711_10038101
397 Ga0207679_10191561
398 Ga0207667_10004037
399 Ga0207651_10328394
400 Ga0207712_10001004
401 Ga0207668_10000828
402 Ga0207668_10017498
403 Ga0207658_10000209
404 Ga0207658_10243510
405 Ga0207658_11824641
406 Ga0207703_10003500
407 Ga0207703_10441923
408 Ga0207639_10043424
409 Ga0207639_11124905
410 Ga0207639_11631222
411 Ga0207678_10085941
412 Ga0207678_10158715
413 Ga0207678_10944796
414 Ga0207702_10435091
415 Ga0207702_11723619
416 Ga0207641_10000341
417 Ga0207676_10000797
418 Ga0268266_10000064
419 Ga0268266_10001340
420 Ga0268266_10030647
421 Ga0268266_11299391
422 Ga0268265_10007012
423 Ga0268265_10013179
424 Ga0268265_10290071
425 Ga0268264_10000046
426 Ga0268264_10000059
427 Ga0307511_10016571
428 Ga0265327_10000166
429 Ga0307513_10000181
430 Ga0307513_10563081
431 Ga0307510_10040874
432 Ga0373943_0204027
433 Ga0373925_0365653
434 Ga0395905_0000174
435 Ga0395905_0830088
436 Ga0395905_1279519
437 Ga0395901_0178615
438 Ga0436365_1494280
439 Ga0436360_1030276
440 Ga0436361_0662716
441 Ga0451806_623294
442 Ga0451807_0752095
443 Ga0451849_1461687
444 Ga0439448_0001311
445 Ga0439434_0101727
446 Ga0466965_0286917
447 Ga0495616_0202021
448 Ga0495620_0118082
449 Ga0495642_0055534
450 Ga0495597_0011719
451 Ga0495622_0001737
452 Ga0495667_0158714
453 Ga0495668_0080221
454 Ga0495625_0000342
455 Ga0495660_0025932
456 Ga0495677_0085084
457 Ga0495684_0043500
458 Ga0495686_0004653
459 Ga0495686_0369979
460 Ga0495686_0690359
461 Ga0495593_0410668
462 Ga0496101_0865107
463 Ga0496102_0010654
464 Ga0496104_0235966
465 Ga0496104_0449751
466 Ga0496112_0081871
467 Ga0496112_0231753
468 Ga0496119_0000213
469 Ga0496121_0792870
470 Ga0496124_0081914
471 Ga0496125_0104031
472 Ga0496126_0004695
473 Ga0495682_0320578
474 Ga0501033_1143402
475 nmdc:mga07m45_273158_c1
476 nmdc:mga0sz30_3225_c1
477 Ga0500635_0000186
478 Ga0500578_0286926
479 Ga0500566_0205560
480 Ga0500566_0308994
481 Ga0500562_001429
482 Ga0500569_308272
483 Ga0500595_003668
484 Ga0500595_004764
485 Ga0500595_056268
486 Ga0500607_175320
487 Ga0500607_193670
488 Ga0500608_000025
489 Ga0500608_023041
490 Ga0500614_026529
491 Ga0500642_0143884
492 Ga0500559_0001640
493 Ga0500559_0017633
494 Ga0500590_021824
495 Ga0500590_176870
496 Ga0500619_030087
497 Ga0500622_0009768
498 Ga0500638_101231
499 Ga0500639_326787
500 Ga0500636_0011778
501 Ga0500636_0317270
502 Ga0500637_0009167
503 Ga0500637_0009178
504 Ga0500645_004437
505 Ga0500596_020362

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07681

DoxX

DoxX

14

93

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fig-assembly2.cif.gz_F-2 apo-csp3 (copper storage protein 3) from bacillus subtilis 0.6084 13 114
5fig-assembly2.cif.gz_F-2 apo-csp3 (copper storage protein 3) from bacillus subtilis 0.5937 13 114
4zsz-assembly1.cif.gz_A structure of a fusion protein with a helix linker, 2arh-3-3kaw-3.0 0.5751 2 111
6zif-assembly1.cif.gz_C the structure of a cytosolic copper storage protein from methylocystis sp. strain rockwell (atcc 49242) 0.5692 10 115
4zsx-assembly1.cif.gz_B structure of a fusion protein with a helix linker, 2arh-3-3kaw-2.0 0.5604 6 111
ID Description Score Start End Superfamily
af_I1LYI2_1_138_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7026 13 114 1.20.120.550
af_Q2FWC2_1_116_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6907 13 111 1.20.120.550
af_A4IAM6_1_156_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6751 10 131 1.20.120.550
af_Q4E5C0_1_157_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6545 10 131 1.20.120.550
af_Q7TP91_4_196_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6303 2 116 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A4Q3LDT2-F1-model_v4 deleted 0.9848 7 130
AF-A0A4S1XIF3-F1-model_v4 DoxX family protein 0.9808 6 130 GO:0005886
AF-A0A176YKS9-F1-model_v4 DoxX family protein 0.979 4 131 GO:0005886
AF-A0A318SZY6-F1-model_v4 Putative oxidoreductase 0.9742 4 131 GO:0005886
AF-A0A5B8FIK0-F1-model_v4 DoxX family protein 0.9738 2 131 GO:0005886

Map