F363107

General Info

Members Datasets Scaffolds Average Seq Length
252 169 504 158

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_101033852|Ga0068852_1010338522
Length 190
Sequence LCDRDESVVNNPSIVGFTHLVLPSFVVILLCNQPVNNMQTITTFLTFNDQAEEAANLYTSLFKNSSISRISRYGEGAPVPAGSVMSVIFQLDGQEFIALNGGSHFKFAEGISLFVNCETQEEIDRYWEKLTEGGQPGPCGWLKDKFGVSWQIVPSVLGSLLGNKDPEKAKRAMAAMMKMSKLDIKALEEA

Samples

Sample ID Description Type Environment
1 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
77 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
99 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
106 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
109 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
110 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
111 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
112 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
113 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
114 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
120 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
121 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
124 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
125 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
126 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
127 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
130 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
131 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
132 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
133 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
134 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
135 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
136 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
137 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
140 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
141 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
142 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
143 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
156 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
157 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
158 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
159 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
160 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
166 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
167 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.41
Metatranscriptomes 1.59
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.97
Rhizosphere 95.63
Stem 0
Stem Tuber 0
Unclassified 12.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068852_101033852 3300005616 Bacteria 841
2 Ga0065704_10201545 3300005289 Bacteria 1144
3 Ga0065715_10171145 3300005293 Bacteria 1528
4 Ga0070683_100268092 3300005329 Bacteria 1624
5 Ga0070690_100000902 3300005330 Bacteria 15119
6 Ga0068869_100140530 3300005334 Unclassified 1864
7 Ga0070666_10186466 3300005335 Bacteria 1456
8 Ga0070680_100705834 3300005336 Bacteria 868
9 Ga0068868_100119795 3300005338 Bacteria 2146
10 Ga0068868_101241329 3300005338 Bacteria 690
11 Ga0070689_100266565 3300005340 Unclassified 1417
12 Ga0070668_100060094 3300005347 Bacteria 2942
13 Ga0070671_100102883 3300005355 Bacteria 2396
14 Ga0070703_10000073 3300005406 Bacteria 49578
15 Ga0070709_10284041 3300005434 Archaea 1204
16 Ga0070714_100271625 3300005435 Bacteria 1572
17 Ga0070714_101378146 3300005435 Bacteria 688
18 Ga0070705_100000159 3300005440 Bacteria 39496
19 Ga0070694_100335473 3300005444 Bacteria 1167
20 Ga0070694_100403512 3300005444 Bacteria 1071
21 Ga0070694_100784033 3300005444 Unclassified 780
22 Ga0070708_100040243 3300005445 Bacteria 4093
23 Ga0070708_100662123 3300005445 Bacteria 983
24 Ga0070706_100002927 3300005467 Bacteria 16986
25 Ga0070706_100097883 3300005467 Bacteria 2725
26 Ga0070707_100050583 3300005468 Bacteria 3983
27 Ga0070707_100887286 3300005468 Bacteria 856
28 Ga0070707_101166913 3300005468 Unclassified 736
29 Ga0070707_101385546 3300005468 Bacteria 670
30 Ga0070698_100000606 3300005471 Bacteria 38432
31 Ga0070698_100141544 3300005471 Bacteria 2356
32 Ga0070699_100000009 3300005518 Bacteria 272902
33 Ga0070699_100462663 3300005518 Bacteria 1150
34 Ga0070684_100086421 3300005535 Bacteria 2783
35 Ga0070684_100125160 3300005535 Bacteria 2315
36 Ga0070697_100481448 3300005536 Bacteria 1084
37 Ga0070697_100761727 3300005536 Bacteria 856
38 Ga0070697_101031153 3300005536 Bacteria 731
39 Ga0070697_101537154 3300005536 Bacteria 595
40 Ga0068853_101358894 3300005539 Unclassified 687
41 Ga0070672_100668335 3300005543 Unclassified 908
42 Ga0070686_100007068 3300005544 Bacteria 6259
43 Ga0070686_100572491 3300005544 Bacteria 886
44 Ga0070695_100066560 3300005545 Bacteria 2348
45 Ga0070696_100000079 3300005546 Bacteria 47760
46 Ga0070696_100002792 3300005546 Bacteria 11590
47 Ga0070696_100291913 3300005546 Bacteria 1246
48 Ga0070696_100660853 3300005546 Unclassified 848
49 Ga0070696_101264169 3300005546 Bacteria 625
50 Ga0070693_100000381 3300005547 Bacteria 20152
51 Ga0070704_100510295 3300005549 Bacteria 1045
52 Ga0068855_100263005 3300005563 Bacteria 1921
53 Ga0068857_100622020 3300005577 Bacteria 1022
54 Ga0068859_100186969 3300005617 Bacteria 2155
55 Ga0068859_100452112 3300005617 Unclassified 1381
56 Ga0068859_100924643 3300005617 Bacteria 956
57 Ga0068864_100424162 3300005618 Bacteria 1268
58 Ga0068861_100276073 3300005719 Bacteria 1445
59 Ga0068863_100032098 3300005841 Bacteria 5008
60 Ga0068863_100033748 3300005841 Bacteria 4876
61 Ga0068863_100735883 3300005841 Unclassified 981
62 Ga0068860_100026071 3300005843 Bacteria 5638
63 Ga0068860_100506709 3300005843 Bacteria 1205
64 Ga0068862_100043554 3300005844 Bacteria 3827
65 Ga0081540_1027963 3300005983 Bacteria 3180
66 Ga0070715_10220782 3300006163 Archaea 974
67 Ga0070716_100145737 3300006173 Bacteria 1517
68 Ga0097621_100592575 3300006237 Bacteria 1012
69 Ga0097621_100628587 3300006237 Bacteria 983
70 Ga0068871_100804799 3300006358 Unclassified 866
71 Ga0075428_100239032 3300006844 Bacteria 1960
72 Ga0075431_100019201 3300006847 Bacteria 6967
73 Ga0075431_100068860 3300006847 Bacteria 3652
74 Ga0075433_10117901 3300006852 Bacteria 2356
75 Ga0075433_10235079 3300006852 Bacteria 1627
76 Ga0075434_100020031 3300006871 Bacteria 6479
77 Ga0075434_100094081 3300006871 Bacteria 3001
78 Ga0075434_100099773 3300006871 Bacteria 2909
79 Ga0075434_100101495 3300006871 Bacteria 2884
80 Ga0075434_100663399 3300006871 Bacteria 1061
81 Ga0068865_101594150 3300006881 Unclassified 587
82 Ga0075436_100211185 3300006914 Bacteria 1376
83 Ga0097620_100186949 3300006931 Bacteria 2155
84 Ga0097620_100452099 3300006931 Unclassified 1381
85 Ga0097620_100924662 3300006931 Bacteria 956
86 Ga0075435_100029704 3300007076 Bacteria 4292
87 Ga0075435_100122367 3300007076 Bacteria 2172
88 Ga0099794_10020590 3300007265 Bacteria 2987
89 Ga0099794_10157530 3300007265 Bacteria 1154
90 Ga0105251_10127948 3300009011 Bacteria 1152
91 Ga0111539_10204534 3300009094 Bacteria 2302
92 Ga0105245_10579266 3300009098 Bacteria 1147
93 Ga0105247_10004309 3300009101 Bacteria 9096
94 Ga0105247_10005843 3300009101 Bacteria 7693
95 Ga0114129_10033766 3300009147 Bacteria 7228
96 Ga0114129_10074257 3300009147 Bacteria 4736
97 Ga0114129_10196354 3300009147 Bacteria 2736
98 Ga0105243_10806643 3300009148 Bacteria 926
99 Ga0105241_10564287 3300009174 Bacteria 1024
100 Ga0105242_10638698 3300009176 Bacteria 1034
101 Ga0105248_10345491 3300009177 Bacteria 1675
102 Ga0105248_10393387 3300009177 Bacteria 1561
103 Ga0105239_10503445 3300010375 Bacteria 1377
104 Ga0105239_11316985 3300010375 Bacteria 833
105 Ga0105246_11772776 3300011119 Unclassified 589
106 Ga0157371_10050805 3300013102 Unclassified 2947
107 Ga0157370_10164375 3300013104 Bacteria 2064
108 Ga0157369_10074307 3300013105 Bacteria 3645
109 Ga0157374_10000042 3300013296 Bacteria 147627
110 Ga0157378_10333125 3300013297 Bacteria 1478
111 Ga0163162_10075097 3300013306 Bacteria 3440
112 Ga0163162_10223778 3300013306 Bacteria 2011
113 Ga0163162_10440754 3300013306 Bacteria 1435
114 Ga0157375_10580491 3300013308 Bacteria 1281
115 Ga0163163_10557856 3300014325 Bacteria 1208
116 Ga0163163_11102785 3300014325 Bacteria 857
117 Ga0182008_10007627 3300014497 Bacteria 5964
118 Ga0182008_10021638 3300014497 Bacteria 3302
119 Ga0182008_10121683 3300014497 Bacteria 1297
120 Ga0182008_10307759 3300014497 Unclassified 831
121 Ga0157379_10472981 3300014968 Bacteria 1159
122 Ga0157376_10003341 3300014969 Bacteria 11030
123 Ga0157376_10416503 3300014969 Bacteria 1303
124 Ga0182007_10013700 3300015262 Bacteria 3082
125 Ga0182007_10040809 3300015262 Unclassified 1549
126 Ga0207653_10000081 3300025885 Bacteria 69110
127 Ga0207710_10005986 3300025900 Bacteria 5216
128 Ga0207710_10448520 3300025900 Unclassified 666
129 Ga0207685_10173226 3300025905 Archaea 995
130 Ga0207684_10000161 3300025910 Bacteria 114989
131 Ga0207684_10310550 3300025910 Bacteria 1359
132 Ga0207646_10006089 3300025922 Bacteria 12565
133 Ga0207646_10615579 3300025922 Bacteria 974
134 Ga0207646_10928345 3300025922 Bacteria 771
135 Ga0207700_10867968 3300025928 Bacteria 807
136 Ga0207704_10474606 3300025938 Bacteria 1003
137 Ga0207665_10003296 3300025939 Bacteria 10815
138 Ga0207711_10054654 3300025941 Unclassified 3427
139 Ga0207712_10032263 3300025961 Bacteria 3535
140 Ga0207668_10112074 3300025972 Bacteria 2049
141 Ga0207703_10102325 3300026035 Bacteria 2430
142 Ga0207703_10209951 3300026035 Bacteria 1735
143 Ga0207708_10224208 3300026075 Bacteria 1507
144 Ga0207641_10046872 3300026088 Bacteria 3644
145 Ga0207641_10720460 3300026088 Unclassified 983
146 Ga0207676_10280512 3300026095 Bacteria 1512
147 Ga0207676_10769096 3300026095 Bacteria 938
148 Ga0207676_10814821 3300026095 Unclassified 911
149 Ga0207675_100329692 3300026118 Bacteria 1492
150 Ga0207675_100472775 3300026118 Unclassified 1245
151 Ga0207675_101461496 3300026118 Bacteria 704
152 Ga0209981_1031965 3300027378 Bacteria 774
153 Ga0207428_10100348 3300027907 Bacteria 2237
154 Ga0265356_1002597 3300028017 Bacteria 2378
155 Ga0265356_1002771 3300028017 Unclassified 2269
156 Ga0268265_10028463 3300028380 Bacteria 4000
157 Ga0268264_10026105 3300028381 Unclassified 4770
158 Ga0268264_10171147 3300028381 Bacteria 1964
159 Ga0316182_1379841 3300030745 Unclassified 924
160 Ga0265762_1081494 3300030760 Bacteria 694
161 Ga0265770_1108696 3300030878 Bacteria 572
162 Ga0265765_1020610 3300030879 Bacteria 795
163 Ga0265760_10020602 3300031090 Bacteria 1904
164 Ga0307405_10096898 3300031731 Bacteria 1968
165 Ga0373935_0053777 3300035692 Bacteria 2562
166 Ga0373935_0509556 3300035692 Bacteria 874
167 Ga0373927_0481450 3300035695 Unclassified 820
168 Ga0373933_0936943 3300035724 Bacteria 570
169 Ga0373937_0035474 3300036401 Bacteria 4540
170 Ga0436360_0939444 3300039438 Bacteria 2240
171 Ga0439464_0101035 3300042439 Bacteria 877
172 Ga0466972_0092857 3300044658 Bacteria 1431
173 Ga0453683_0002156 3300044673 Bacteria 15664
174 Ga0453683_0105899 3300044673 Unclassified 1767
175 Ga0453683_0278660 3300044673 Bacteria 1068
176 Ga0466966_0095918 3300044684 Bacteria 1837
177 Ga0466961_0107508 3300044693 Bacteria 1756
178 Ga0466961_0264614 3300044693 Unclassified 1054
179 Ga0466964_0149293 3300044706 Unclassified 1082
180 Ga0453684_0023221 3300044712 Bacteria 9149
181 Ga0466957_0339606 3300044842 Unclassified 1017
182 Ga0466959_0015629 3300045049 Bacteria 5534
183 Ga0466959_0080146 3300045049 Bacteria 2354
184 Ga0451576_0136914 3300045051 Unclassified 2554
185 Ga0451576_0193472 3300045051 Bacteria 2124
186 Ga0495592_0531523 3300046454 Bacteria 726
187 Ga0495629_0086883 3300046459 Bacteria 2182
188 Ga0495641_0008081 3300046461 Bacteria 6467
189 Ga0495651_0061464 3300046462 Bacteria 2875
190 Ga0495582_0016020 3300046473 Bacteria 4110
191 Ga0495639_0030395 3300046475 Bacteria 2401
192 Ga0495662_0067884 3300046476 Bacteria 1726
193 Ga0495618_0204862 3300046514 Bacteria 1248
194 Ga0495628_0490967 3300046516 Bacteria 888
195 Ga0495630_0042931 3300046517 Bacteria 3377
196 Ga0495665_0121758 3300046531 Bacteria 1366
197 Ga0495640_0084009 3300046533 Bacteria 2113
198 Ga0495586_0086736 3300046535 Bacteria 1725
199 Ga0495634_0067622 3300046642 Bacteria 2363
200 Ga0495647_0057841 3300046681 Bacteria 1523
201 Ga0495647_0431872 3300046681 Bacteria 608
202 Ga0495613_0107510 3300046689 Bacteria 2012
203 Ga0495624_0440385 3300046690 Bacteria 781
204 Ga0495581_0001632 3300047315 Bacteria 12510
205 Ga0495604_0070014 3300047317 Bacteria 2658
206 Ga0495604_0495384 3300047317 Bacteria 793
207 Ga0495674_0019526 3300047319 Bacteria 6288
208 Ga0495674_0089156 3300047319 Bacteria 2637
209 Ga0495672_0317434 3300047320 Bacteria 733
210 Ga0495676_0017513 3300047321 Bacteria 6333
211 Ga0495602_0072908 3300048088 Bacteria 2925
212 Ga0495602_0266930 3300048088 Bacteria 1267
213 Ga0495614_0308134 3300048089 Bacteria 733
214 Ga0496103_0563747 3300048906 Bacteria 727
215 Ga0496104_0331228 3300048907 Bacteria 1436
216 Ga0496106_0630917 3300048909 Bacteria 857
217 Ga0496108_1285102 3300048911 Bacteria 616
218 Ga0496109_0909856 3300048912 Bacteria 818
219 Ga0496109_1079045 3300048912 Bacteria 740
220 Ga0496110_0188708 3300048913 Bacteria 1872
221 Ga0496110_0298207 3300048913 Bacteria 1468
222 Ga0496110_1113498 3300048913 Bacteria 698
223 Ga0496111_0482312 3300048914 Bacteria 913
224 Ga0496126_0001542 3300048929 Bacteria 35430
225 Ga0501033_1027360 3300049570 Bacteria 550
226 Ga0501039_1532313 3300049575 Bacteria 512
227 Ga0501041_0154070 3300049577 Bacteria 1436
228 Ga0501070_0011307 3300049586 Bacteria 7542
229 Ga0501071_0327793 3300049587 Bacteria 1163
230 Ga0501072_0077990 3300049588 Bacteria 2623
231 Ga0501073_0006762 3300049589 Bacteria 8538
232 Ga0501074_0006754 3300049590 Bacteria 8280
233 Ga0501223_000540 3300049663 Bacteria 9116
234 Ga0501083_0010273 3300049744 Bacteria 6596
235 nmdc:mga05p37_125919_c1 3300050507 Bacteria 3146
236 nmdc:mga05p37_21195_c1 3300050507 Bacteria 7868
237 nmdc:mga05p37_460319_c1 3300050507 Unclassified 1470
238 nmdc:mga09592_247401_c1 3300050508 Bacteria 1545
239 nmdc:mga09592_7995_c1 3300050508 Bacteria 8599
240 nmdc:mga08y16_158230_c1 3300050511 Bacteria 2354
241 nmdc:mga0n895_17833_c1 3300050512 Bacteria 6554
242 nmdc:mga0n895_43878_c1 3300050512 Bacteria 4359
243 nmdc:mga0n895_498888_c1 3300050512 Bacteria 1226
244 nmdc:mga0n895_695147_c1 3300050512 Bacteria 1013
245 nmdc:mga0rr50_1352103_c1 3300050513 Bacteria 603
246 nmdc:mga0rr50_20452_c1 3300050513 Bacteria 4496
247 nmdc:mga08x19_186364_c1 3300050514 Bacteria 1418
248 nmdc:mga0a205_10909_c1 3300050515 Bacteria 8359
249 nmdc:mga0a205_120563_c1 3300050515 Bacteria 1643
250 nmdc:mga0a205_70188_c1 3300050515 Bacteria 3382
251 Ga0501084_0027079 3300054114 Bacteria 4790
252 Ga0466962_0114798 3300061719 Bacteria 1297
253 Ga0068852_101033852
254 Ga0065704_10201545
255 Ga0065715_10171145
256 Ga0070683_100268092
257 Ga0070690_100000902
258 Ga0068869_100140530
259 Ga0070666_10186466
260 Ga0070680_100705834
261 Ga0068868_100119795
262 Ga0068868_101241329
263 Ga0070689_100266565
264 Ga0070668_100060094
265 Ga0070671_100102883
266 Ga0070703_10000073
267 Ga0070709_10284041
268 Ga0070714_100271625
269 Ga0070714_101378146
270 Ga0070705_100000159
271 Ga0070694_100335473
272 Ga0070694_100403512
273 Ga0070694_100784033
274 Ga0070708_100040243
275 Ga0070708_100662123
276 Ga0070706_100002927
277 Ga0070706_100097883
278 Ga0070707_100050583
279 Ga0070707_100887286
280 Ga0070707_101166913
281 Ga0070707_101385546
282 Ga0070698_100000606
283 Ga0070698_100141544
284 Ga0070699_100000009
285 Ga0070699_100462663
286 Ga0070684_100086421
287 Ga0070684_100125160
288 Ga0070697_100481448
289 Ga0070697_100761727
290 Ga0070697_101031153
291 Ga0070697_101537154
292 Ga0068853_101358894
293 Ga0070672_100668335
294 Ga0070686_100007068
295 Ga0070686_100572491
296 Ga0070695_100066560
297 Ga0070696_100000079
298 Ga0070696_100002792
299 Ga0070696_100291913
300 Ga0070696_100660853
301 Ga0070696_101264169
302 Ga0070693_100000381
303 Ga0070704_100510295
304 Ga0068855_100263005
305 Ga0068857_100622020
306 Ga0068859_100186969
307 Ga0068859_100452112
308 Ga0068859_100924643
309 Ga0068864_100424162
310 Ga0068861_100276073
311 Ga0068863_100032098
312 Ga0068863_100033748
313 Ga0068863_100735883
314 Ga0068860_100026071
315 Ga0068860_100506709
316 Ga0068862_100043554
317 Ga0081540_1027963
318 Ga0070715_10220782
319 Ga0070716_100145737
320 Ga0097621_100592575
321 Ga0097621_100628587
322 Ga0068871_100804799
323 Ga0075428_100239032
324 Ga0075431_100019201
325 Ga0075431_100068860
326 Ga0075433_10117901
327 Ga0075433_10235079
328 Ga0075434_100020031
329 Ga0075434_100094081
330 Ga0075434_100099773
331 Ga0075434_100101495
332 Ga0075434_100663399
333 Ga0068865_101594150
334 Ga0075436_100211185
335 Ga0097620_100186949
336 Ga0097620_100452099
337 Ga0097620_100924662
338 Ga0075435_100029704
339 Ga0075435_100122367
340 Ga0099794_10020590
341 Ga0099794_10157530
342 Ga0105251_10127948
343 Ga0111539_10204534
344 Ga0105245_10579266
345 Ga0105247_10004309
346 Ga0105247_10005843
347 Ga0114129_10033766
348 Ga0114129_10074257
349 Ga0114129_10196354
350 Ga0105243_10806643
351 Ga0105241_10564287
352 Ga0105242_10638698
353 Ga0105248_10345491
354 Ga0105248_10393387
355 Ga0105239_10503445
356 Ga0105239_11316985
357 Ga0105246_11772776
358 Ga0157371_10050805
359 Ga0157370_10164375
360 Ga0157369_10074307
361 Ga0157374_10000042
362 Ga0157378_10333125
363 Ga0163162_10075097
364 Ga0163162_10223778
365 Ga0163162_10440754
366 Ga0157375_10580491
367 Ga0163163_10557856
368 Ga0163163_11102785
369 Ga0182008_10007627
370 Ga0182008_10021638
371 Ga0182008_10121683
372 Ga0182008_10307759
373 Ga0157379_10472981
374 Ga0157376_10003341
375 Ga0157376_10416503
376 Ga0182007_10013700
377 Ga0182007_10040809
378 Ga0207653_10000081
379 Ga0207710_10005986
380 Ga0207710_10448520
381 Ga0207685_10173226
382 Ga0207684_10000161
383 Ga0207684_10310550
384 Ga0207646_10006089
385 Ga0207646_10615579
386 Ga0207646_10928345
387 Ga0207700_10867968
388 Ga0207704_10474606
389 Ga0207665_10003296
390 Ga0207711_10054654
391 Ga0207712_10032263
392 Ga0207668_10112074
393 Ga0207703_10102325
394 Ga0207703_10209951
395 Ga0207708_10224208
396 Ga0207641_10046872
397 Ga0207641_10720460
398 Ga0207676_10280512
399 Ga0207676_10769096
400 Ga0207676_10814821
401 Ga0207675_100329692
402 Ga0207675_100472775
403 Ga0207675_101461496
404 Ga0209981_1031965
405 Ga0207428_10100348
406 Ga0265356_1002597
407 Ga0265356_1002771
408 Ga0268265_10028463
409 Ga0268264_10026105
410 Ga0268264_10171147
411 Ga0316182_1379841
412 Ga0265762_1081494
413 Ga0265770_1108696
414 Ga0265765_1020610
415 Ga0265760_10020602
416 Ga0307405_10096898
417 Ga0373935_0053777
418 Ga0373935_0509556
419 Ga0373927_0481450
420 Ga0373933_0936943
421 Ga0373937_0035474
422 Ga0436360_0939444
423 Ga0439464_0101035
424 Ga0466972_0092857
425 Ga0453683_0002156
426 Ga0453683_0105899
427 Ga0453683_0278660
428 Ga0466966_0095918
429 Ga0466961_0107508
430 Ga0466961_0264614
431 Ga0466964_0149293
432 Ga0453684_0023221
433 Ga0466957_0339606
434 Ga0466959_0015629
435 Ga0466959_0080146
436 Ga0451576_0136914
437 Ga0451576_0193472
438 Ga0495592_0531523
439 Ga0495629_0086883
440 Ga0495641_0008081
441 Ga0495651_0061464
442 Ga0495582_0016020
443 Ga0495639_0030395
444 Ga0495662_0067884
445 Ga0495618_0204862
446 Ga0495628_0490967
447 Ga0495630_0042931
448 Ga0495665_0121758
449 Ga0495640_0084009
450 Ga0495586_0086736
451 Ga0495634_0067622
452 Ga0495647_0057841
453 Ga0495647_0431872
454 Ga0495613_0107510
455 Ga0495624_0440385
456 Ga0495581_0001632
457 Ga0495604_0070014
458 Ga0495604_0495384
459 Ga0495674_0019526
460 Ga0495674_0089156
461 Ga0495672_0317434
462 Ga0495676_0017513
463 Ga0495602_0072908
464 Ga0495602_0266930
465 Ga0495614_0308134
466 Ga0496103_0563747
467 Ga0496104_0331228
468 Ga0496106_0630917
469 Ga0496108_1285102
470 Ga0496109_0909856
471 Ga0496109_1079045
472 Ga0496110_0188708
473 Ga0496110_0298207
474 Ga0496110_1113498
475 Ga0496111_0482312
476 Ga0496126_0001542
477 Ga0501033_1027360
478 Ga0501039_1532313
479 Ga0501041_0154070
480 Ga0501070_0011307
481 Ga0501071_0327793
482 Ga0501072_0077990
483 Ga0501073_0006762
484 Ga0501074_0006754
485 Ga0501223_000540
486 Ga0501083_0010273
487 nmdc:mga05p37_125919_c1
488 nmdc:mga05p37_21195_c1
489 nmdc:mga05p37_460319_c1
490 nmdc:mga09592_247401_c1
491 nmdc:mga09592_7995_c1
492 nmdc:mga08y16_158230_c1
493 nmdc:mga0n895_17833_c1
494 nmdc:mga0n895_43878_c1
495 nmdc:mga0n895_498888_c1
496 nmdc:mga0n895_695147_c1
497 nmdc:mga0rr50_1352103_c1
498 nmdc:mga0rr50_20452_c1
499 nmdc:mga08x19_186364_c1
500 nmdc:mga0a205_10909_c1
501 nmdc:mga0a205_120563_c1
502 nmdc:mga0a205_70188_c1
503 Ga0501084_0027079
504 Ga0466962_0114798

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

39

153

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u69-assembly1.cif.gz_A crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9554 5 158
1u69-assembly3.cif.gz_C crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9459 5 158
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9405 5 158
1u69-assembly3.cif.gz_C crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9397 5 158
1u69-assembly1.cif.gz_A crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9377 5 158
ID Description Score Start End Superfamily
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9367 5 158 3.10.180.10
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9303 5 158 3.10.180.10
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9189 75 120 3.30.720.110
3omsA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8185 72 121 3.30.720.110
af_P16681_7_147_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8153 11 118 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A537CIB8-F1-model_v4 VOC family protein 0.9972 85 158
AF-A0A7K2MI42-F1-model_v4 VOC family protein 0.9916 99 157
AF-A0A2V6CT88-F1-model_v4 PhnB-like domain-containing protein 0.9907 99 160
AF-A0A1D3DUR3-F1-model_v4 PhnB-like domain-containing protein 0.9901 3 159
AF-A0A4V1SQP6-F1-model_v4 VOC family protein 0.9897 103 159

Map