F362915

General Info

Members Datasets Scaffolds Average Seq Length
252 171 236 283

Family's Representative Sequence

Representative Sequence 3300003792|Ga0055540_1000941|Ga0055540_100094113
Length 305
Sequence MNVPHVTPRPPGELVSLAATGDLIASAVADGTAVLAFNVVTLEHAEGIAEGAERAGVPAMFQISENTVHFHGGRLAPLVSACAAIAARSSAPLAIHLDHFTDATLIGEALDAAADLGVTSIMVDAAHLPYDDNVDLTRTFADRGRRAGLWVEAELGEVGGKGGAHDFGVRTDPXEAAAFTAATGVDGLAVAVGSSHAMTTRDAALDVDLIGRLAAAVPAPLVLHGSSGVPDDQLRLAVAAGIRKVNVGTALNVAYTAALREHLAAAPTKSDPRRALTAARTAIADTVTDLCDVVAPRPVSNGGAR

Samples

Sample ID Description Type Environment
1 2643221572 Leifsonia sp. Root60 Isolate Unclassified
2 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
3 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
4 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
5 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
6 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
7 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
8 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
9 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
10 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
11 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
12 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
13 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
14 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
15 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
16 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
19 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
20 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
56 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
75 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
76 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
82 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
83 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
84 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
87 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
88 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
89 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
90 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
91 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
92 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
93 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
94 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
95 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
96 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
97 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
98 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
99 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
100 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
101 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
105 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
106 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
107 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
108 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
111 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
112 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
113 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
114 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
115 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
116 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
117 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
118 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
119 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
120 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
123 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
124 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
125 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
126 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
127 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
132 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
133 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
134 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
135 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
136 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
137 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
138 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
139 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
150 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
151 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
152 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
157 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
158 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
159 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
160 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
164 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
165 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
166 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
167 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
168 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
169 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
170 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.86
Metatranscriptomes 0.79
Isolates 6.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.08
Nodule 0
Rhizoplane 9.92
Rhizosphere 61.11
Stem 0
Stem Tuber 0
Unclassified 13.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10004892 3300002459 Bacteria 2727
2 rootL2_10078980 3300003322 Bacteria 5687
3 Ga0055539_1000006 3300003752 Bacteria 580055
4 Ga0055533_1000002 3300003756 Bacteria 1196393
5 Ga0055525_1000022 3300003759 Bacteria 368755
6 Ga0055540_1000941 3300003792 Bacteria 18922
7 Ga0055540_1002151 3300003792 Bacteria 10736
8 Ga0055540_1003478 3300003792 Bacteria 7599
9 Ga0055541_1006910 3300003841 Bacteria 1896
10 Ga0070658_10000285 3300005327 Bacteria 44343
11 Ga0070658_10162845 3300005327 Bacteria 1872
12 Ga0070682_100069824 3300005337 Bacteria 2244
13 Ga0070660_100335904 3300005339 Bacteria 1243
14 Ga0070671_100000490 3300005355 Bacteria 27629
15 Ga0070667_100286160 3300005367 Bacteria 1481
16 Ga0070663_100082555 3300005455 Bacteria 2364
17 Ga0068853_100074399 3300005539 Bacteria 2964
18 Ga0070665_100009958 3300005548 Bacteria 9614
19 Ga0070665_100133134 3300005548 Bacteria 2488
20 Ga0070665_100635629 3300005548 Bacteria 1080
21 Ga0068855_100012739 3300005563 Bacteria 10141
22 Ga0068854_100003840 3300005578 Bacteria 9411
23 Ga0068852_100278390 3300005616 Bacteria 1612
24 Ga0068852_100382718 3300005616 Bacteria 1380
25 Ga0068863_100001514 3300005841 Bacteria 22958
26 Ga0075365_10016662 3300006038 Bacteria 4476
27 Ga0075365_10103531 3300006038 Bacteria 1951
28 Ga0075363_100001294 3300006048 Bacteria 9329
29 Ga0075364_10000184 3300006051 Bacteria 28604
30 Ga0075362_10028525 3300006177 Bacteria 2397
31 Ga0075369_10016445 3300006186 Bacteria 2985
32 Ga0075370_10184675 3300006353 Bacteria 1228
33 Ga0075429_100015621 3300006880 Bacteria 6578
34 Ga0105240_10015928 3300009093 Bacteria 10197
35 Ga0105248_10223762 3300009177 Bacteria 2118
36 Ga0105237_10000178 3300009545 Bacteria 89960
37 Ga0105237_10086288 3300009545 Bacteria 3128
38 Ga0105238_10030404 3300009551 Bacteria 5498
39 Ga0105238_10050035 3300009551 Bacteria 4207
40 Ga0105239_10007516 3300010375 Bacteria 12498
41 Ga0105239_10094880 3300010375 Bacteria 3295
42 Ga0157371_10004459 3300013102 Bacteria 12207
43 Ga0157370_10005993 3300013104 Bacteria 13522
44 Ga0157369_10190670 3300013105 Bacteria 2154
45 Ga0157369_10516675 3300013105 Bacteria 1235
46 Ga0157372_10423466 3300013307 Bacteria 1551
47 Ga0163163_10002897 3300014325 Bacteria 14510
48 Ga0163161_10096642 3300017792 Bacteria 2193
49 Ga0206354_10748343 3300020081 Bacteria 1908
50 Ga0206353_11072340 3300020082 Bacteria 3399
51 Ga0213875_10115539 3300021388 Bacteria 1254
52 Ga0209566_102182 3300025225 Bacteria 3911
53 Ga0209674_100001 3300025226 Bacteria 4013750
54 Ga0209563_100001 3300025230 Bacteria 4013775
55 Ga0209677_100001 3300025253 Bacteria 4013787
56 Ga0209051_1002205 3300025303 Bacteria 14383
57 Ga0209051_1005449 3300025303 Bacteria 7433
58 Ga0207647_10003687 3300025904 Bacteria 11456
59 Ga0207647_10140644 3300025904 Bacteria 1414
60 Ga0207705_10000001 3300025909 Bacteria 2061880
61 Ga0207695_10001059 3300025913 Bacteria 48227
62 Ga0207671_10001032 3300025914 Bacteria 33903
63 Ga0207671_10022723 3300025914 Bacteria 4738
64 Ga0207657_10071552 3300025919 Bacteria 2936
65 Ga0207694_10160697 3300025924 Bacteria 1814
66 Ga0207690_10062791 3300025932 Bacteria 2531
67 Ga0207667_10022658 3300025949 Bacteria 6929
68 Ga0207658_10028411 3300025986 Bacteria 3938
69 Ga0207639_10033563 3300026041 Bacteria 3787
70 Ga0207678_10019764 3300026067 Bacteria 5925
71 Ga0207698_10030652 3300026142 Bacteria 3871
72 Ga0268266_10008929 3300028379 Bacteria 8869
73 Ga0268266_10010757 3300028379 Bacteria 7972
74 Ga0268266_10703217 3300028379 Bacteria 974
75 Ga0307515_10000952 3300028794 Bacteria 66191
76 Ga0307513_10008582 3300031456 Bacteria 13051
77 Ga0307516_10001600 3300031730 Bacteria 31152
78 Ga0307516_10019513 3300031730 Bacteria 7024
79 Ga0307516_10064250 3300031730 Bacteria 3550
80 Ga0307405_10096448 3300031731 Bacteria 1972
81 Ga0307413_10045278 3300031824 Bacteria 2607
82 Ga0307413_10338917 3300031824 Bacteria 1156
83 Ga0307409_100139164 3300031995 Bacteria 2088
84 Ga0307409_100709007 3300031995 Bacteria 1006
85 Ga0307416_100105473 3300032002 Bacteria 2467
86 Ga0307414_10075244 3300032004 Bacteria 2450
87 Ga0307415_100249440 3300032126 Bacteria 1441
88 Ga0373951_0000010 3300035091 Bacteria 76713
89 Ga0395899_0221695 3300037312 Bacteria 1310
90 Ga0395898_0005514 3300037466 Bacteria 13660
91 Ga0436364_1186774 3300037853 Bacteria 4998
92 Ga0439461_0000217 3300041410 Bacteria 8182
93 Ga0439466_0002071 3300041411 Bacteria 7861
94 Ga0439465_0008188 3300041413 Bacteria 3300
95 Ga0439465_0032763 3300041413 Bacteria 1660
96 Ga0451791_0443949 3300041451 Bacteria 1728
97 Ga0451797_0045396 3300041453 Bacteria 1751
98 Ga0451795_0706639 3300041456 Bacteria 1008
99 Ga0451806_250740 3300041462 Bacteria 1168
100 Ga0451806_342794 3300041462 Bacteria 1044
101 Ga0451833_0319473 3300041491 Bacteria 2726
102 Ga0451853_1276994 3300041512 Bacteria 3325
103 Ga0439431_0002890 3300041997 Bacteria 3780
104 Ga0439449_0024969 3300042007 Bacteria 2233
105 Ga0439459_0006528 3300042438 Bacteria 1945
106 Ga0466969_0008440 3300044656 Bacteria 5465
107 Ga0466972_0065771 3300044658 Bacteria 1734
108 Ga0466965_0004636 3300044683 Bacteria 6124
109 Ga0466965_0019593 3300044683 Bacteria 3248
110 Ga0466965_0167990 3300044683 Bacteria 1153
111 Ga0466961_0009037 3300044693 Bacteria 6357
112 Ga0466961_0114977 3300044693 Bacteria 1691
113 Ga0466961_0135382 3300044693 Bacteria 1544
114 Ga0466963_0000256 3300044694 Bacteria 23361
115 Ga0466963_0120146 3300044694 Bacteria 1808
116 Ga0466968_0003676 3300044735 Bacteria 5687
117 Ga0466968_0051933 3300044735 Bacteria 1753
118 Ga0466970_0011489 3300044765 Bacteria 4513
119 Ga0466970_0053777 3300044765 Bacteria 2150
120 Ga0466957_0004101 3300044842 Bacteria 8069
121 Ga0466957_0157457 3300044842 Bacteria 1473
122 Ga0466960_0003050 3300044901 Bacteria 6403
123 Ga0466960_0004184 3300044901 Bacteria 5613
124 Ga0466960_0026923 3300044901 Bacteria 2617
125 Ga0466960_0050361 3300044901 Bacteria 2008
126 Ga0466958_0040256 3300045836 Bacteria 2809
127 Ga0466967_0005177 3300045976 Bacteria 8977
128 Ga0466967_0025442 3300045976 Bacteria 4882
129 Ga0495594_0121411 3300046499 Bacteria 1477
130 Ga0495628_0009869 3300046516 Bacteria 8132
131 Ga0495648_0016749 3300046524 Bacteria 5272
132 Ga0495652_0012514 3300046529 Bacteria 7651
133 Ga0495652_0241597 3300046529 Bacteria 1343
134 Ga0495668_0034346 3300046616 Bacteria 2846
135 Ga0495600_0213674 3300046809 Bacteria 1235
136 Ga0495581_0138536 3300047315 Bacteria 1419
137 Ga0495604_0227580 3300047317 Bacteria 1281
138 Ga0495673_0014236 3300047469 Bacteria 4142
139 Ga0496100_0006879 3300048903 Bacteria 6227
140 Ga0496100_0058783 3300048903 Bacteria 2524
141 Ga0496100_0094572 3300048903 Bacteria 2047
142 Ga0496101_0000021 3300048904 Bacteria 217090
143 Ga0496102_0000001 3300048905 Bacteria 873433
144 Ga0496102_0000590 3300048905 Bacteria 38332
145 Ga0496103_0000007 3300048906 Bacteria 354915
146 Ga0496103_0075097 3300048906 Bacteria 2120
147 Ga0496103_0090654 3300048906 Bacteria 1929
148 Ga0496103_0149137 3300048906 Bacteria 1498
149 Ga0496104_0002417 3300048907 Bacteria 16081
150 Ga0496104_0023194 3300048907 Bacteria 5705
151 Ga0496105_0005433 3300048908 Bacteria 9671
152 Ga0496106_0003386 3300048909 Bacteria 11881
153 Ga0496107_0013919 3300048910 Bacteria 5626
154 Ga0496108_0042422 3300048911 Bacteria 3798
155 Ga0496109_0112068 3300048912 Bacteria 2537
156 Ga0496111_0117039 3300048914 Bacteria 1966
157 Ga0496114_0035514 3300048917 Bacteria 4116
158 Ga0496114_0555632 3300048917 Bacteria 1014
159 Ga0496116_0000018 3300048919 Bacteria 545877
160 Ga0496116_0200273 3300048919 Bacteria 1046
161 Ga0496117_0000015 3300048920 Bacteria 583316
162 Ga0496117_0022432 3300048920 Bacteria 5063
163 Ga0496118_0000012 3300048921 Bacteria 583316
164 Ga0496118_0014040 3300048921 Bacteria 7522
165 Ga0496119_0000551 3300048922 Bacteria 51087
166 Ga0496119_0088750 3300048922 Bacteria 1762
167 Ga0496120_0000155 3300048923 Bacteria 114046
168 Ga0496121_0000177 3300048924 Bacteria 141456
169 Ga0496125_0015308 3300048928 Bacteria 7423
170 Ga0496126_0001113 3300048929 Bacteria 45012
171 Ga0496126_0007609 3300048929 Bacteria 11831
172 Ga0496126_0054545 3300048929 Bacteria 3619
173 Ga0496126_0151486 3300048929 Bacteria 1987
174 Ga0501031_0004067 3300049568 Bacteria 9435
175 Ga0501031_0031366 3300049568 Bacteria 3467
176 Ga0501032_0059239 3300049569 Bacteria 2570
177 Ga0501032_0109414 3300049569 Bacteria 1829
178 Ga0501033_0016284 3300049570 Bacteria 5631
179 Ga0501033_0072870 3300049570 Bacteria 2522
180 Ga0501034_0012528 3300049571 Bacteria 8754
181 Ga0501034_0032944 3300049571 Bacteria 5261
182 Ga0501034_0044059 3300049571 Bacteria 4513
183 Ga0501034_0314371 3300049571 Bacteria 1500
184 Ga0501034_0377063 3300049571 Bacteria 1344
185 Ga0501034_0448329 3300049571 Bacteria 1208
186 Ga0501037_0015213 3300049573 Bacteria 5661
187 Ga0501037_0059269 3300049573 Bacteria 2793
188 Ga0501038_0045137 3300049574 Bacteria 3826
189 Ga0501038_0156777 3300049574 Bacteria 1853
190 Ga0501043_0005182 3300049579 Bacteria 10546
191 Ga0501043_0112003 3300049579 Bacteria 2143
192 Ga0501043_0174289 3300049579 Bacteria 1677
193 Ga0501043_0183971 3300049579 Bacteria 1627
194 Ga0501046_0056701 3300049580 Bacteria 3074
195 Ga0501047_0002864 3300049581 Bacteria 16372
196 Ga0501047_0020315 3300049581 Bacteria 6377
197 Ga0501047_0353206 3300049581 Bacteria 1306
198 Ga0501048_0000055 3300049582 Bacteria 56696
199 Ga0501069_0105030 3300049585 Bacteria 1605
200 Ga0501069_0185524 3300049585 Bacteria 1203
201 Ga0501070_0001420 3300049586 Bacteria 21451
202 Ga0501073_0019887 3300049589 Bacteria 4845
203 Ga0501073_0128186 3300049589 Bacteria 1759
204 Ga0501077_0216141 3300049593 Bacteria 1218
205 Ga0501080_0000023 3300049742 Bacteria 90345
206 Ga0501080_0250250 3300049742 Bacteria 1616
207 Ga0501083_0002923 3300049744 Bacteria 11826
208 Ga0501035_0002452 3300049822 Bacteria 18100
209 Ga0501035_0031337 3300049822 Bacteria 4843
210 Ga0501035_0161528 3300049822 Bacteria 1939
211 Ga0501044_0011962 3300049823 Bacteria 9405
212 Ga0501044_0026263 3300049823 Bacteria 6167
213 nmdc:mga03683_46827_c1 3300050489 Bacteria 1793
214 nmdc:mga03n38_38902_c1 3300050490 Bacteria 2060
215 nmdc:mga00v17_116261_c1 3300050491 Bacteria 1700
216 nmdc:mga00v17_1369_c1 3300050491 Bacteria 12779
217 nmdc:mga00v17_223780_c1 3300050491 Bacteria 1218
218 nmdc:mga00v17_83177_c1 3300050491 Bacteria 2002
219 nmdc:mga0yw44_13368_c1 3300050492 Bacteria 4320
220 nmdc:mga0yw44_27122_c1 3300050492 Bacteria 3278
221 nmdc:mga09592_429363_c1 3300050508 Bacteria 1141
222 nmdc:mga06r32_273550_c1 3300050510 Bacteria 1676
223 Ga0495601_0021427 3300053077 Bacteria 3958
224 Ga0495612_0083354 3300053078 Bacteria 1345
225 Ga0500643_006664 3300053087 Bacteria 4789
226 Ga0500559_0000168 3300053136 Bacteria 51816
227 Ga0500559_0000418 3300053136 Bacteria 30441
228 Ga0500559_0014988 3300053136 Bacteria 3276
229 Ga0500568_0000304 3300053139 Bacteria 39367
230 Ga0500568_0003869 3300053139 Bacteria 8156
231 Ga0500568_0036100 3300053139 Bacteria 2013
232 Ga0500573_0070133 3300053140 Bacteria 2000
233 Ga0500573_0077399 3300053140 Bacteria 1893
234 Ga0500616_0007278 3300053153 Bacteria 7061
235 Ga0501084_0208708 3300054114 Bacteria 1648
236 Ga0501082_0005425 3300060353 Bacteria 11067

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049585 Ga0501069_0185524 Ga0501069_0185524_403_1086 223
2 3300041462 Ga0451806_342794 Ga0451806_342794_96_836 246
3 3300049571 Ga0501034_0044059 Ga0501034_0044059_2556_3383 253
4 3300005327 Ga0070658_10000285 Ga0070658_1000028543 256
5 3300025904 Ga0207647_10140644 Ga0207647_101406442 256
6 3300025909 Ga0207705_10000001 Ga0207705_10000001526 256
7 3300005616 Ga0068852_100278390 Ga0068852_1002783902 260
8 3300009551 Ga0105238_10030404 Ga0105238_100304045 260
9 3300025924 Ga0207694_10160697 Ga0207694_101606971 260
10 3300044693 Ga0466961_0009037 Ga0466961_0009037_2639_3490 260
11 3300005539 Ga0068853_100074399 Ga0068853_1000743992 262
12 3300005548 Ga0070665_100635629 Ga0070665_1006356292 262
13 3300026041 Ga0207639_10033563 Ga0207639_100335632 262
14 3300028379 Ga0268266_10703217 Ga0268266_107032171 262
15 3300047315 Ga0495581_0138536 Ga0495581_0138536_100_963 262
16 3300013105 Ga0157369_10516675 Ga0157369_105166752 263
17 3300044656 Ga0466969_0008440 Ga0466969_0008440_2939_3802 263
18 3300044693 Ga0466961_0114977 Ga0466961_0114977_287_1150 263
19 3300044765 Ga0466970_0011489 Ga0466970_0011489_65_928 263
20 3300048929 Ga0496126_0007609 Ga0496126_0007609_9300_10148 263
21 3300046529 Ga0495652_0012514 Ga0495652_0012514_3610_4473 265
22 3300046809 Ga0495600_0213674 Ga0495600_0213674_154_1017 265
23 3300013105 Ga0157369_10190670 Ga0157369_101906701 267
24 3300005339 Ga0070660_100335904 Ga0070660_1003359041 271
25 3300006186 Ga0075369_10016445 Ga0075369_100164453 271
26 3300025919 Ga0207657_10071552 Ga0207657_100715523 271
27 3300025932 Ga0207690_10062791 Ga0207690_100627912 271
28 3300037312 Ga0395899_0221695 Ga0395899_0221695_468_1292 271
29 3300037466 Ga0395898_0005514 Ga0395898_0005514_9640_10464 271
30 iso_pu_bacteria 2919055335 2919055520 271
31 3300049593 Ga0501077_0216141 Ga0501077_0216141_389_1207 272
32 3300045836 Ga0466958_0040256 Ga0466958_0040256_1719_2552 273
33 3300053139 Ga0500568_0003869 Ga0500568_0003869_5893_6717 274
34 3300044694 Ga0466963_0000256 Ga0466963_0000256_2728_3567 275
35 3300048929 Ga0496126_0151486 Ga0496126_0151486_224_1069 275
36 3300003322 rootL2_10078980 rootL2_100789804 276
37 3300003752 Ga0055539_1000006 Ga0055539_1000006238 276
38 3300003756 Ga0055533_1000002 Ga0055533_1000002322 276
39 3300003759 Ga0055525_1000022 Ga0055525_1000022117 276
40 3300003841 Ga0055541_1006910 Ga0055541_10069102 276
41 3300005327 Ga0070658_10162845 Ga0070658_101628452 276
42 3300005455 Ga0070663_100082555 Ga0070663_1000825552 276
43 3300013104 Ga0157370_10005993 Ga0157370_100059933 276
44 3300020082 Ga0206353_11072340 Ga0206353_110723402 276
45 3300025225 Ga0209566_102182 Ga0209566_1021822 276
46 3300025226 Ga0209674_100001 Ga0209674_1000013241 276
47 3300025230 Ga0209563_100001 Ga0209563_1000013241 276
48 3300025253 Ga0209677_100001 Ga0209677_1000013241 276
49 3300026067 Ga0207678_10019764 Ga0207678_100197644 276
50 3300031456 Ga0307513_10008582 Ga0307513_100085829 276
51 3300049568 Ga0501031_0004067 Ga0501031_0004067_7913_8755 276
52 3300049569 Ga0501032_0059239 Ga0501032_0059239_1219_2061 276
53 3300049570 Ga0501033_0072870 Ga0501033_0072870_699_1541 276
54 3300049573 Ga0501037_0015213 Ga0501037_0015213_3742_4584 276
55 3300049574 Ga0501038_0045137 Ga0501038_0045137_695_1537 276
56 3300049579 Ga0501043_0183971 Ga0501043_0183971_467_1309 276
57 3300049580 Ga0501046_0056701 Ga0501046_0056701_27_869 276
58 3300049581 Ga0501047_0002864 Ga0501047_0002864_10712_11554 276
59 3300049582 Ga0501048_0000055 Ga0501048_0000055_13390_14232 276
60 3300049742 Ga0501080_0250250 Ga0501080_0250250_423_1265 276
61 3300049822 Ga0501035_0031337 Ga0501035_0031337_2638_3480 276
62 3300049822 Ga0501035_0161528 Ga0501035_0161528_211_1053 276
63 3300049823 Ga0501044_0026263 Ga0501044_0026263_435_1277 276
64 3300050492 nmdc:mga0yw44_13368_c1 nmdc:mga0yw44_13368_c1_57_887 276
65 iso_pu_bacteria 2811994879 2812360938 276
66 iso_pu_bacteria 2912715099 2912723183 276
67 iso_pu_bacteria 2947224130 2947232493 276
68 3300021388 Ga0213875_10115539 Ga0213875_101155392 277
69 3300031730 Ga0307516_10064250 Ga0307516_100642504 277
70 3300037853 Ga0436364_1186774 Ga0436364_1186774_3493_4326 277
71 3300044694 Ga0466963_0120146 Ga0466963_0120146_582_1427 277
72 3300047317 Ga0495604_0227580 Ga0495604_0227580_377_1228 277
73 iso_pu_bacteria 2758568522 2760303167 277
74 3300020081 Ga0206354_10748343 Ga0206354_107483431 278
75 3300041451 Ga0451791_0443949 Ga0451791_0443949_626_1462 278
76 3300041453 Ga0451797_0045396 Ga0451797_0045396_573_1409 278
77 3300041491 Ga0451833_0319473 Ga0451833_0319473_92_928 278
78 3300041512 Ga0451853_1276994 Ga0451853_1276994_283_1119 278
79 3300044842 Ga0466957_0157457 Ga0466957_0157457_363_1199 278
80 3300045976 Ga0466967_0005177 Ga0466967_0005177_7377_8213 278
81 3300048917 Ga0496114_0555632 Ga0496114_0555632_69_905 278
82 iso_pu_bacteria 2932431166 2932433958 278
83 3300013307 Ga0157372_10423466 Ga0157372_104234661 279
84 3300046499 Ga0495594_0121411 Ga0495594_0121411_106_945 279
85 3300050492 nmdc:mga0yw44_27122_c1 nmdc:mga0yw44_27122_c1_139_981 279
86 iso_pu_bacteria 2758568621 2760622898 279
87 3300017792 Ga0163161_10096642 Ga0163161_100966422 280
88 3300028794 Ga0307515_10000952 Ga0307515_1000095227 280
89 3300031730 Ga0307516_10001600 Ga0307516_1000160026 280
90 3300031731 Ga0307405_10096448 Ga0307405_100964482 280
91 3300031824 Ga0307413_10338917 Ga0307413_103389171 280
92 3300031995 Ga0307409_100709007 Ga0307409_1007090072 280
93 3300035091 Ga0373951_0000010 Ga0373951_0000010_10178_11032 280
94 3300042007 Ga0439449_0024969 Ga0439449_0024969_1351_2202 280
95 3300044658 Ga0466972_0065771 Ga0466972_0065771_304_1149 280
96 3300044683 Ga0466965_0167990 Ga0466965_0167990_59_919 280
97 3300044693 Ga0466961_0135382 Ga0466961_0135382_279_1124 280
98 3300044735 Ga0466968_0051933 Ga0466968_0051933_896_1741 280
99 3300044901 Ga0466960_0050361 Ga0466960_0050361_468_1313 280
100 3300053140 Ga0500573_0077399 Ga0500573_0077399_89_931 280
101 iso_pu_bacteria 2643221572 2643876684 280
102 iso_pu_bacteria 2643221669 2644383739 280
103 3300006880 Ga0075429_100015621 Ga0075429_1000156212 281
104 3300031730 Ga0307516_10019513 Ga0307516_100195134 281
105 3300031824 Ga0307413_10045278 Ga0307413_100452782 281
106 3300031995 Ga0307409_100139164 Ga0307409_1001391642 281
107 3300032002 Ga0307416_100105473 Ga0307416_1001054732 281
108 3300032004 Ga0307414_10075244 Ga0307414_100752442 281
109 3300032126 Ga0307415_100249440 Ga0307415_1002494402 281
110 3300046516 Ga0495628_0009869 Ga0495628_0009869_6389_7252 281
111 3300046529 Ga0495652_0241597 Ga0495652_0241597_98_961 281
112 3300048919 Ga0496116_0200273 Ga0496116_0200273_165_1025 281
113 3300048920 Ga0496117_0022432 Ga0496117_0022432_42_902 281
114 3300048921 Ga0496118_0014040 Ga0496118_0014040_33_893 281
115 3300048922 Ga0496119_0088750 Ga0496119_0088750_708_1565 281
116 3300049573 Ga0501037_0059269 Ga0501037_0059269_1735_2580 281
117 3300049579 Ga0501043_0005182 Ga0501043_0005182_514_1359 281
118 3300049581 Ga0501047_0353206 Ga0501047_0353206_159_1004 281
119 3300049585 Ga0501069_0105030 Ga0501069_0105030_115_960 281
120 3300049586 Ga0501070_0001420 Ga0501070_0001420_756_1601 281
121 3300049589 Ga0501073_0019887 Ga0501073_0019887_2431_3276 281
122 3300049742 Ga0501080_0000023 Ga0501080_0000023_24632_25477 281
123 3300049744 Ga0501083_0002923 Ga0501083_0002923_9778_10623 281
124 3300050508 nmdc:mga09592_429363_c1 nmdc:mga09592_429363_c1_226_1098 281
125 3300050510 nmdc:mga06r32_273550_c1 nmdc:mga06r32_273550_c1_676_1548 281
126 3300053077 Ga0495601_0021427 Ga0495601_0021427_129_992 281
127 3300053078 Ga0495612_0083354 Ga0495612_0083354_40_903 281
128 3300053136 Ga0500559_0000168 Ga0500559_0000168_2504_3349 281
129 3300053139 Ga0500568_0036100 Ga0500568_0036100_184_1029 281
130 3300054114 Ga0501084_0208708 Ga0501084_0208708_423_1268 281
131 iso_pu_bacteria 2902792274 2902795193 281
132 iso_pu_bacteria 2929212328 2929216243 281
133 3300005337 Ga0070682_100069824 Ga0070682_1000698242 282
134 3300006038 Ga0075365_10103531 Ga0075365_101035312 282
135 3300013102 Ga0157371_10004459 Ga0157371_100044599 282
136 3300048903 Ga0496100_0058783 Ga0496100_0058783_420_1274 282
137 3300048906 Ga0496103_0075097 Ga0496103_0075097_574_1428 282
138 3300048906 Ga0496103_0090654 Ga0496103_0090654_782_1630 282
139 3300048907 Ga0496104_0023194 Ga0496104_0023194_1885_2739 282
140 3300048908 Ga0496105_0005433 Ga0496105_0005433_2545_3399 282
141 3300048917 Ga0496114_0035514 Ga0496114_0035514_3206_4060 282
142 3300048929 Ga0496126_0054545 Ga0496126_0054545_1516_2370 282
143 3300049571 Ga0501034_0012528 Ga0501034_0012528_6492_7340 282
144 3300049571 Ga0501034_0448329 Ga0501034_0448329_84_932 282
145 3300049579 Ga0501043_0174289 Ga0501043_0174289_455_1303 282
146 3300049589 Ga0501073_0128186 Ga0501073_0128186_765_1613 282
147 3300053139 Ga0500568_0000304 Ga0500568_0000304_2785_3633 282
148 3300005548 Ga0070665_100133134 Ga0070665_1001331342 283
149 3300009551 Ga0105238_10050035 Ga0105238_100500355 283
150 3300049568 Ga0501031_0031366 Ga0501031_0031366_1968_2819 283
151 3300049569 Ga0501032_0109414 Ga0501032_0109414_312_1163 283
152 3300049570 Ga0501033_0016284 Ga0501033_0016284_192_1043 283
153 3300049571 Ga0501034_0314371 Ga0501034_0314371_539_1390 283
154 3300049574 Ga0501038_0156777 Ga0501038_0156777_782_1633 283
155 3300005563 Ga0068855_100012739 Ga0068855_1000127397 284
156 3300005578 Ga0068854_100003840 Ga0068854_1000038404 284
157 3300005616 Ga0068852_100382718 Ga0068852_1003827182 284
158 3300009093 Ga0105240_10015928 Ga0105240_100159284 284
159 3300009545 Ga0105237_10086288 Ga0105237_100862883 284
160 3300010375 Ga0105239_10094880 Ga0105239_100948803 284
161 3300050489 nmdc:mga03683_46827_c1 nmdc:mga03683_46827_c1_88_942 284
162 3300050491 nmdc:mga00v17_1369_c1 nmdc:mga00v17_1369_c1_4529_5383 284
163 3300009545 Ga0105237_10000178 Ga0105237_1000017830 285
164 3300010375 Ga0105239_10007516 Ga0105239_100075169 285
165 3300025904 Ga0207647_10003687 Ga0207647_100036873 285
166 3300025913 Ga0207695_10001059 Ga0207695_1000105934 285
167 3300025914 Ga0207671_10001032 Ga0207671_1000103228 285
168 3300025914 Ga0207671_10022723 Ga0207671_100227233 285
169 3300025949 Ga0207667_10022658 Ga0207667_100226584 285
170 3300026142 Ga0207698_10030652 Ga0207698_100306524 285
171 3300028379 Ga0268266_10008929 Ga0268266_100089297 285
172 3300042438 Ga0439459_0006528 Ga0439459_0006528_947_1816 285
173 3300046524 Ga0495648_0016749 Ga0495648_0016749_2797_3666 285
174 3300046616 Ga0495668_0034346 Ga0495668_0034346_369_1238 285
175 3300047469 Ga0495673_0014236 Ga0495673_0014236_464_1333 285
176 3300048903 Ga0496100_0006879 Ga0496100_0006879_1712_2581 285
177 3300048904 Ga0496101_0000021 Ga0496101_0000021_25173_26042 285
178 3300048905 Ga0496102_0000001 Ga0496102_0000001_231971_232840 285
179 3300048906 Ga0496103_0000007 Ga0496103_0000007_122849_123718 285
180 3300048909 Ga0496106_0003386 Ga0496106_0003386_8605_9474 285
181 3300048910 Ga0496107_0013919 Ga0496107_0013919_1294_2163 285
182 3300048919 Ga0496116_0000018 Ga0496116_0000018_195073_195942 285
183 3300048920 Ga0496117_0000015 Ga0496117_0000015_349936_350805 285
184 3300048921 Ga0496118_0000012 Ga0496118_0000012_349936_350805 285
185 3300048922 Ga0496119_0000551 Ga0496119_0000551_2835_3704 285
186 3300048923 Ga0496120_0000155 Ga0496120_0000155_111183_112052 285
187 3300048924 Ga0496121_0000177 Ga0496121_0000177_134160_135029 285
188 3300048929 Ga0496126_0001113 Ga0496126_0001113_26569_27438 285
189 3300049571 Ga0501034_0032944 Ga0501034_0032944_3692_4549 285
190 3300053087 Ga0500643_006664 Ga0500643_006664_1978_2847 285
191 3300053140 Ga0500573_0070133 Ga0500573_0070133_10_882 285
192 3300060353 Ga0501082_0005425 Ga0501082_0005425_6128_6985 285
193 3300006051 Ga0075364_10000184 Ga0075364_1000018420 286
194 3300006177 Ga0075362_10028525 Ga0075362_100285252 286
195 3300048903 Ga0496100_0094572 Ga0496100_0094572_101_961 286
196 3300048906 Ga0496103_0149137 Ga0496103_0149137_234_1094 286
197 3300044901 Ga0466960_0026923 Ga0466960_0026923_1467_2339 287
198 3300048928 Ga0496125_0015308 Ga0496125_0015308_123_986 287
199 3300049571 Ga0501034_0377063 Ga0501034_0377063_184_1047 287
200 3300049579 Ga0501043_0112003 Ga0501043_0112003_405_1268 287
201 3300049581 Ga0501047_0020315 Ga0501047_0020315_4798_5661 287
202 3300049822 Ga0501035_0002452 Ga0501035_0002452_7957_8820 287
203 3300049823 Ga0501044_0011962 Ga0501044_0011962_3948_4811 287
204 3300050491 nmdc:mga00v17_116261_c1 nmdc:mga00v17_116261_c1_375_1238 287
205 3300053153 Ga0500616_0007278 Ga0500616_0007278_3171_4034 287
206 iso_pu_bacteria 2643221687 2644488280 287
207 iso_pu_bacteria 2902810491 2902811295 287
208 iso_pu_bacteria 2902837492 2902841368 287
209 iso_pu_bacteria 2919055335 2919056008 287
210 iso_pu_bacteria 2939582691 2939583052 288
211 3300041410 Ga0439461_0000217 Ga0439461_0000217_3165_4046 290
212 3300041411 Ga0439466_0002071 Ga0439466_0002071_2808_3689 290
213 3300041413 Ga0439465_0008188 Ga0439465_0008188_14_895 290
214 3300041997 Ga0439431_0002890 Ga0439431_0002890_1004_1885 290
215 3300003792 Ga0055540_1000941 Ga0055540_100094113 291
216 3300003792 Ga0055540_1002151 Ga0055540_10021512 291
217 3300003792 Ga0055540_1003478 Ga0055540_10034784 291
218 3300006038 Ga0075365_10016662 Ga0075365_100166625 291
219 3300025303 Ga0209051_1002205 Ga0209051_100220512 291
220 3300025303 Ga0209051_1005449 Ga0209051_10054496 291
221 3300041456 Ga0451795_0706639 Ga0451795_0706639_70_945 291
222 3300041462 Ga0451806_250740 Ga0451806_250740_168_1043 291
223 3300041413 Ga0439465_0032763 Ga0439465_0032763_722_1609 292
224 3300053136 Ga0500559_0000418 Ga0500559_0000418_2788_3678 292
225 3300053136 Ga0500559_0014988 Ga0500559_0014988_1189_2085 292
226 3300044683 Ga0466965_0004636 Ga0466965_0004636_2836_3735 294
227 3300044683 Ga0466965_0019593 Ga0466965_0019593_1773_2666 294
228 3300044735 Ga0466968_0003676 Ga0466968_0003676_2660_3553 294
229 3300044765 Ga0466970_0053777 Ga0466970_0053777_497_1390 294
230 3300044842 Ga0466957_0004101 Ga0466957_0004101_1583_2476 294
231 3300044901 Ga0466960_0003050 Ga0466960_0003050_3562_4455 294
232 3300044901 Ga0466960_0004184 Ga0466960_0004184_1764_2663 294
233 3300045976 Ga0466967_0025442 Ga0466967_0025442_2309_3202 294
234 3300050491 nmdc:mga00v17_223780_c1 nmdc:mga00v17_223780_c1_44_928 294
235 3300002459 JGI24751J29686_10004892 JGI24751J29686_100048921 295
236 3300005355 Ga0070671_100000490 Ga0070671_10000049028 295
237 3300005367 Ga0070667_100286160 Ga0070667_1002861602 295
238 3300005548 Ga0070665_100009958 Ga0070665_1000099584 295
239 3300005841 Ga0068863_100001514 Ga0068863_10000151413 295
240 3300006048 Ga0075363_100001294 Ga0075363_1000012944 295
241 3300006353 Ga0075370_10184675 Ga0075370_101846752 295
242 3300009177 Ga0105248_10223762 Ga0105248_102237622 295
243 3300014325 Ga0163163_10002897 Ga0163163_100028978 295
244 3300025986 Ga0207658_10028411 Ga0207658_100284113 295
245 3300028379 Ga0268266_10010757 Ga0268266_100107574 295
246 3300048905 Ga0496102_0000590 Ga0496102_0000590_11438_12325 295
247 3300048907 Ga0496104_0002417 Ga0496104_0002417_9683_10570 295
248 3300048911 Ga0496108_0042422 Ga0496108_0042422_1688_2575 295
249 3300048912 Ga0496109_0112068 Ga0496109_0112068_1248_2135 295
250 3300048914 Ga0496111_0117039 Ga0496111_0117039_237_1124 295
251 3300050490 nmdc:mga03n38_38902_c1 nmdc:mga03n38_38902_c1_603_1490 295
252 3300050491 nmdc:mga00v17_83177_c1 nmdc:mga00v17_83177_c1_124_1011 295

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01116

F_bP_aldolase

Fructose-bisphosphate aldolase class-II

18

296

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8q57-assembly1.cif.gz_A crystal structure of class ii sfp aldolase from yersinia aldovae (yasqia-zn-so4) with bound sulfate ions 0.9344 1 283
8q59-assembly1.cif.gz_B-2 crystal structure of metal-dependent class ii sulfofructose phosphate aldolase from yersinia aldovae in complex with sulfofructose phosphate (yasqia-zn-sfp) 0.9316 1 283
8q58-assembly1.cif.gz_A crystal structure of metal-dependent classii sulfofructosephosphate aldolase (sfpa) from hafnia paralvei hpsqia-zn 0.9312 1 283
8q59-assembly1.cif.gz_A-2 crystal structure of metal-dependent class ii sulfofructose phosphate aldolase from yersinia aldovae in complex with sulfofructose phosphate (yasqia-zn-sfp) 0.9304 1 283
8q5a-assembly1.cif.gz_A crystal structure of metal-dependent class ii sulfofructosephosphate aldolase from hafnia paralvei hpsqia-zn in complex with dihydroxyacetone phosphate (dhap) 0.9264 1 283
ID Description Score Start End Superfamily
6ofuA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9234 3 283 3.20.20.70
3q94B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9147 2 283 3.20.20.70
6ofuA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8995 3 283 3.20.20.70
1gvfB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8993 3 281 3.20.20.70
3q94B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8985 2 283 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A3S3ABZ2-F1-model_v4 Fructose-bisphosphate aldolase 0.9875 4 281 GO:0005975
GO:0008270
GO:0016832
AF-A0A6B1JT59-F1-model_v4 deleted 0.982 166 281
AF-A0A6B3G8C4-F1-model_v4 Class II fructose-bisphosphate aldolase 0.9783 1 95 GO:0005975
GO:0008270
GO:0016832
AF-A0A506XYH0-F1-model_v4 Class II fructose-bisphosphate aldolase 0.977 1 280 GO:0005975
GO:0008270
GO:0016832
AF-A0A6G4X1V5-F1-model_v4 Fructose-bisphosphate aldolase 0.974 105 282 GO:0005975
GO:0008270
GO:0016832

Feature Viewer

pLDDT pTM Quality
90.04 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map