F362915
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 252 | 171 | 236 | 283 |
Family's Representative Sequence
| Representative Sequence | 3300003792|Ga0055540_1000941|Ga0055540_100094113 |
| Length | 305 |
| Sequence | MNVPHVTPRPPGELVSLAATGDLIASAVADGTAVLAFNVVTLEHAEGIAEGAERAGVPAMFQISENTVHFHGGRLAPLVSACAAIAARSSAPLAIHLDHFTDATLIGEALDAAADLGVTSIMVDAAHLPYDDNVDLTRTFADRGRRAGLWVEAELGEVGGKGGAHDFGVRTDPXEAAAFTAATGVDGLAVAVGSSHAMTTRDAALDVDLIGRLAAAVPAPLVLHGSSGVPDDQLRLAVAAGIRKVNVGTALNVAYTAALREHLAAAPTKSDPRRALTAARTAIADTVTDLCDVVAPRPVSNGGAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 2 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 3 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 4 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 5 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 6 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 7 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 8 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 9 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 10 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 11 | 2919055335 | Leifsonia sp. 1010 | Isolate | Rhizosphere |
| 12 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 13 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 14 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 15 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 16 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 17 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 18 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 35 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 36 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 37 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 38 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 39 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 40 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 41 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 42 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 54 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 55 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 56 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 75 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 76 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 77 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 78 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 79 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 80 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 81 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 82 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 83 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 84 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 85 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 86 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 87 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 88 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 89 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 90 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 91 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 92 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 93 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 94 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 95 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 96 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 97 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 98 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 99 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 100 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 101 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 102 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 103 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 104 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 105 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 106 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 107 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 108 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 109 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 110 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 120 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 121 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 122 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 123 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 124 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 125 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 126 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 127 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 128 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 129 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 130 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 131 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 132 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 133 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 134 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 135 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 136 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 137 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 138 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 139 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 141 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 142 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 150 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 158 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 159 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 160 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 161 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 166 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 167 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 168 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 169 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 170 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.86 |
| Metatranscriptomes | 0.79 |
| Isolates | 6.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.08 |
| Nodule | 0 |
| Rhizoplane | 9.92 |
| Rhizosphere | 61.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.89 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10004892 | 3300002459 | Bacteria | 2727 |
| 2 | rootL2_10078980 | 3300003322 | Bacteria | 5687 |
| 3 | Ga0055539_1000006 | 3300003752 | Bacteria | 580055 |
| 4 | Ga0055533_1000002 | 3300003756 | Bacteria | 1196393 |
| 5 | Ga0055525_1000022 | 3300003759 | Bacteria | 368755 |
| 6 | Ga0055540_1000941 | 3300003792 | Bacteria | 18922 |
| 7 | Ga0055540_1002151 | 3300003792 | Bacteria | 10736 |
| 8 | Ga0055540_1003478 | 3300003792 | Bacteria | 7599 |
| 9 | Ga0055541_1006910 | 3300003841 | Bacteria | 1896 |
| 10 | Ga0070658_10000285 | 3300005327 | Bacteria | 44343 |
| 11 | Ga0070658_10162845 | 3300005327 | Bacteria | 1872 |
| 12 | Ga0070682_100069824 | 3300005337 | Bacteria | 2244 |
| 13 | Ga0070660_100335904 | 3300005339 | Bacteria | 1243 |
| 14 | Ga0070671_100000490 | 3300005355 | Bacteria | 27629 |
| 15 | Ga0070667_100286160 | 3300005367 | Bacteria | 1481 |
| 16 | Ga0070663_100082555 | 3300005455 | Bacteria | 2364 |
| 17 | Ga0068853_100074399 | 3300005539 | Bacteria | 2964 |
| 18 | Ga0070665_100009958 | 3300005548 | Bacteria | 9614 |
| 19 | Ga0070665_100133134 | 3300005548 | Bacteria | 2488 |
| 20 | Ga0070665_100635629 | 3300005548 | Bacteria | 1080 |
| 21 | Ga0068855_100012739 | 3300005563 | Bacteria | 10141 |
| 22 | Ga0068854_100003840 | 3300005578 | Bacteria | 9411 |
| 23 | Ga0068852_100278390 | 3300005616 | Bacteria | 1612 |
| 24 | Ga0068852_100382718 | 3300005616 | Bacteria | 1380 |
| 25 | Ga0068863_100001514 | 3300005841 | Bacteria | 22958 |
| 26 | Ga0075365_10016662 | 3300006038 | Bacteria | 4476 |
| 27 | Ga0075365_10103531 | 3300006038 | Bacteria | 1951 |
| 28 | Ga0075363_100001294 | 3300006048 | Bacteria | 9329 |
| 29 | Ga0075364_10000184 | 3300006051 | Bacteria | 28604 |
| 30 | Ga0075362_10028525 | 3300006177 | Bacteria | 2397 |
| 31 | Ga0075369_10016445 | 3300006186 | Bacteria | 2985 |
| 32 | Ga0075370_10184675 | 3300006353 | Bacteria | 1228 |
| 33 | Ga0075429_100015621 | 3300006880 | Bacteria | 6578 |
| 34 | Ga0105240_10015928 | 3300009093 | Bacteria | 10197 |
| 35 | Ga0105248_10223762 | 3300009177 | Bacteria | 2118 |
| 36 | Ga0105237_10000178 | 3300009545 | Bacteria | 89960 |
| 37 | Ga0105237_10086288 | 3300009545 | Bacteria | 3128 |
| 38 | Ga0105238_10030404 | 3300009551 | Bacteria | 5498 |
| 39 | Ga0105238_10050035 | 3300009551 | Bacteria | 4207 |
| 40 | Ga0105239_10007516 | 3300010375 | Bacteria | 12498 |
| 41 | Ga0105239_10094880 | 3300010375 | Bacteria | 3295 |
| 42 | Ga0157371_10004459 | 3300013102 | Bacteria | 12207 |
| 43 | Ga0157370_10005993 | 3300013104 | Bacteria | 13522 |
| 44 | Ga0157369_10190670 | 3300013105 | Bacteria | 2154 |
| 45 | Ga0157369_10516675 | 3300013105 | Bacteria | 1235 |
| 46 | Ga0157372_10423466 | 3300013307 | Bacteria | 1551 |
| 47 | Ga0163163_10002897 | 3300014325 | Bacteria | 14510 |
| 48 | Ga0163161_10096642 | 3300017792 | Bacteria | 2193 |
| 49 | Ga0206354_10748343 | 3300020081 | Bacteria | 1908 |
| 50 | Ga0206353_11072340 | 3300020082 | Bacteria | 3399 |
| 51 | Ga0213875_10115539 | 3300021388 | Bacteria | 1254 |
| 52 | Ga0209566_102182 | 3300025225 | Bacteria | 3911 |
| 53 | Ga0209674_100001 | 3300025226 | Bacteria | 4013750 |
| 54 | Ga0209563_100001 | 3300025230 | Bacteria | 4013775 |
| 55 | Ga0209677_100001 | 3300025253 | Bacteria | 4013787 |
| 56 | Ga0209051_1002205 | 3300025303 | Bacteria | 14383 |
| 57 | Ga0209051_1005449 | 3300025303 | Bacteria | 7433 |
| 58 | Ga0207647_10003687 | 3300025904 | Bacteria | 11456 |
| 59 | Ga0207647_10140644 | 3300025904 | Bacteria | 1414 |
| 60 | Ga0207705_10000001 | 3300025909 | Bacteria | 2061880 |
| 61 | Ga0207695_10001059 | 3300025913 | Bacteria | 48227 |
| 62 | Ga0207671_10001032 | 3300025914 | Bacteria | 33903 |
| 63 | Ga0207671_10022723 | 3300025914 | Bacteria | 4738 |
| 64 | Ga0207657_10071552 | 3300025919 | Bacteria | 2936 |
| 65 | Ga0207694_10160697 | 3300025924 | Bacteria | 1814 |
| 66 | Ga0207690_10062791 | 3300025932 | Bacteria | 2531 |
| 67 | Ga0207667_10022658 | 3300025949 | Bacteria | 6929 |
| 68 | Ga0207658_10028411 | 3300025986 | Bacteria | 3938 |
| 69 | Ga0207639_10033563 | 3300026041 | Bacteria | 3787 |
| 70 | Ga0207678_10019764 | 3300026067 | Bacteria | 5925 |
| 71 | Ga0207698_10030652 | 3300026142 | Bacteria | 3871 |
| 72 | Ga0268266_10008929 | 3300028379 | Bacteria | 8869 |
| 73 | Ga0268266_10010757 | 3300028379 | Bacteria | 7972 |
| 74 | Ga0268266_10703217 | 3300028379 | Bacteria | 974 |
| 75 | Ga0307515_10000952 | 3300028794 | Bacteria | 66191 |
| 76 | Ga0307513_10008582 | 3300031456 | Bacteria | 13051 |
| 77 | Ga0307516_10001600 | 3300031730 | Bacteria | 31152 |
| 78 | Ga0307516_10019513 | 3300031730 | Bacteria | 7024 |
| 79 | Ga0307516_10064250 | 3300031730 | Bacteria | 3550 |
| 80 | Ga0307405_10096448 | 3300031731 | Bacteria | 1972 |
| 81 | Ga0307413_10045278 | 3300031824 | Bacteria | 2607 |
| 82 | Ga0307413_10338917 | 3300031824 | Bacteria | 1156 |
| 83 | Ga0307409_100139164 | 3300031995 | Bacteria | 2088 |
| 84 | Ga0307409_100709007 | 3300031995 | Bacteria | 1006 |
| 85 | Ga0307416_100105473 | 3300032002 | Bacteria | 2467 |
| 86 | Ga0307414_10075244 | 3300032004 | Bacteria | 2450 |
| 87 | Ga0307415_100249440 | 3300032126 | Bacteria | 1441 |
| 88 | Ga0373951_0000010 | 3300035091 | Bacteria | 76713 |
| 89 | Ga0395899_0221695 | 3300037312 | Bacteria | 1310 |
| 90 | Ga0395898_0005514 | 3300037466 | Bacteria | 13660 |
| 91 | Ga0436364_1186774 | 3300037853 | Bacteria | 4998 |
| 92 | Ga0439461_0000217 | 3300041410 | Bacteria | 8182 |
| 93 | Ga0439466_0002071 | 3300041411 | Bacteria | 7861 |
| 94 | Ga0439465_0008188 | 3300041413 | Bacteria | 3300 |
| 95 | Ga0439465_0032763 | 3300041413 | Bacteria | 1660 |
| 96 | Ga0451791_0443949 | 3300041451 | Bacteria | 1728 |
| 97 | Ga0451797_0045396 | 3300041453 | Bacteria | 1751 |
| 98 | Ga0451795_0706639 | 3300041456 | Bacteria | 1008 |
| 99 | Ga0451806_250740 | 3300041462 | Bacteria | 1168 |
| 100 | Ga0451806_342794 | 3300041462 | Bacteria | 1044 |
| 101 | Ga0451833_0319473 | 3300041491 | Bacteria | 2726 |
| 102 | Ga0451853_1276994 | 3300041512 | Bacteria | 3325 |
| 103 | Ga0439431_0002890 | 3300041997 | Bacteria | 3780 |
| 104 | Ga0439449_0024969 | 3300042007 | Bacteria | 2233 |
| 105 | Ga0439459_0006528 | 3300042438 | Bacteria | 1945 |
| 106 | Ga0466969_0008440 | 3300044656 | Bacteria | 5465 |
| 107 | Ga0466972_0065771 | 3300044658 | Bacteria | 1734 |
| 108 | Ga0466965_0004636 | 3300044683 | Bacteria | 6124 |
| 109 | Ga0466965_0019593 | 3300044683 | Bacteria | 3248 |
| 110 | Ga0466965_0167990 | 3300044683 | Bacteria | 1153 |
| 111 | Ga0466961_0009037 | 3300044693 | Bacteria | 6357 |
| 112 | Ga0466961_0114977 | 3300044693 | Bacteria | 1691 |
| 113 | Ga0466961_0135382 | 3300044693 | Bacteria | 1544 |
| 114 | Ga0466963_0000256 | 3300044694 | Bacteria | 23361 |
| 115 | Ga0466963_0120146 | 3300044694 | Bacteria | 1808 |
| 116 | Ga0466968_0003676 | 3300044735 | Bacteria | 5687 |
| 117 | Ga0466968_0051933 | 3300044735 | Bacteria | 1753 |
| 118 | Ga0466970_0011489 | 3300044765 | Bacteria | 4513 |
| 119 | Ga0466970_0053777 | 3300044765 | Bacteria | 2150 |
| 120 | Ga0466957_0004101 | 3300044842 | Bacteria | 8069 |
| 121 | Ga0466957_0157457 | 3300044842 | Bacteria | 1473 |
| 122 | Ga0466960_0003050 | 3300044901 | Bacteria | 6403 |
| 123 | Ga0466960_0004184 | 3300044901 | Bacteria | 5613 |
| 124 | Ga0466960_0026923 | 3300044901 | Bacteria | 2617 |
| 125 | Ga0466960_0050361 | 3300044901 | Bacteria | 2008 |
| 126 | Ga0466958_0040256 | 3300045836 | Bacteria | 2809 |
| 127 | Ga0466967_0005177 | 3300045976 | Bacteria | 8977 |
| 128 | Ga0466967_0025442 | 3300045976 | Bacteria | 4882 |
| 129 | Ga0495594_0121411 | 3300046499 | Bacteria | 1477 |
| 130 | Ga0495628_0009869 | 3300046516 | Bacteria | 8132 |
| 131 | Ga0495648_0016749 | 3300046524 | Bacteria | 5272 |
| 132 | Ga0495652_0012514 | 3300046529 | Bacteria | 7651 |
| 133 | Ga0495652_0241597 | 3300046529 | Bacteria | 1343 |
| 134 | Ga0495668_0034346 | 3300046616 | Bacteria | 2846 |
| 135 | Ga0495600_0213674 | 3300046809 | Bacteria | 1235 |
| 136 | Ga0495581_0138536 | 3300047315 | Bacteria | 1419 |
| 137 | Ga0495604_0227580 | 3300047317 | Bacteria | 1281 |
| 138 | Ga0495673_0014236 | 3300047469 | Bacteria | 4142 |
| 139 | Ga0496100_0006879 | 3300048903 | Bacteria | 6227 |
| 140 | Ga0496100_0058783 | 3300048903 | Bacteria | 2524 |
| 141 | Ga0496100_0094572 | 3300048903 | Bacteria | 2047 |
| 142 | Ga0496101_0000021 | 3300048904 | Bacteria | 217090 |
| 143 | Ga0496102_0000001 | 3300048905 | Bacteria | 873433 |
| 144 | Ga0496102_0000590 | 3300048905 | Bacteria | 38332 |
| 145 | Ga0496103_0000007 | 3300048906 | Bacteria | 354915 |
| 146 | Ga0496103_0075097 | 3300048906 | Bacteria | 2120 |
| 147 | Ga0496103_0090654 | 3300048906 | Bacteria | 1929 |
| 148 | Ga0496103_0149137 | 3300048906 | Bacteria | 1498 |
| 149 | Ga0496104_0002417 | 3300048907 | Bacteria | 16081 |
| 150 | Ga0496104_0023194 | 3300048907 | Bacteria | 5705 |
| 151 | Ga0496105_0005433 | 3300048908 | Bacteria | 9671 |
| 152 | Ga0496106_0003386 | 3300048909 | Bacteria | 11881 |
| 153 | Ga0496107_0013919 | 3300048910 | Bacteria | 5626 |
| 154 | Ga0496108_0042422 | 3300048911 | Bacteria | 3798 |
| 155 | Ga0496109_0112068 | 3300048912 | Bacteria | 2537 |
| 156 | Ga0496111_0117039 | 3300048914 | Bacteria | 1966 |
| 157 | Ga0496114_0035514 | 3300048917 | Bacteria | 4116 |
| 158 | Ga0496114_0555632 | 3300048917 | Bacteria | 1014 |
| 159 | Ga0496116_0000018 | 3300048919 | Bacteria | 545877 |
| 160 | Ga0496116_0200273 | 3300048919 | Bacteria | 1046 |
| 161 | Ga0496117_0000015 | 3300048920 | Bacteria | 583316 |
| 162 | Ga0496117_0022432 | 3300048920 | Bacteria | 5063 |
| 163 | Ga0496118_0000012 | 3300048921 | Bacteria | 583316 |
| 164 | Ga0496118_0014040 | 3300048921 | Bacteria | 7522 |
| 165 | Ga0496119_0000551 | 3300048922 | Bacteria | 51087 |
| 166 | Ga0496119_0088750 | 3300048922 | Bacteria | 1762 |
| 167 | Ga0496120_0000155 | 3300048923 | Bacteria | 114046 |
| 168 | Ga0496121_0000177 | 3300048924 | Bacteria | 141456 |
| 169 | Ga0496125_0015308 | 3300048928 | Bacteria | 7423 |
| 170 | Ga0496126_0001113 | 3300048929 | Bacteria | 45012 |
| 171 | Ga0496126_0007609 | 3300048929 | Bacteria | 11831 |
| 172 | Ga0496126_0054545 | 3300048929 | Bacteria | 3619 |
| 173 | Ga0496126_0151486 | 3300048929 | Bacteria | 1987 |
| 174 | Ga0501031_0004067 | 3300049568 | Bacteria | 9435 |
| 175 | Ga0501031_0031366 | 3300049568 | Bacteria | 3467 |
| 176 | Ga0501032_0059239 | 3300049569 | Bacteria | 2570 |
| 177 | Ga0501032_0109414 | 3300049569 | Bacteria | 1829 |
| 178 | Ga0501033_0016284 | 3300049570 | Bacteria | 5631 |
| 179 | Ga0501033_0072870 | 3300049570 | Bacteria | 2522 |
| 180 | Ga0501034_0012528 | 3300049571 | Bacteria | 8754 |
| 181 | Ga0501034_0032944 | 3300049571 | Bacteria | 5261 |
| 182 | Ga0501034_0044059 | 3300049571 | Bacteria | 4513 |
| 183 | Ga0501034_0314371 | 3300049571 | Bacteria | 1500 |
| 184 | Ga0501034_0377063 | 3300049571 | Bacteria | 1344 |
| 185 | Ga0501034_0448329 | 3300049571 | Bacteria | 1208 |
| 186 | Ga0501037_0015213 | 3300049573 | Bacteria | 5661 |
| 187 | Ga0501037_0059269 | 3300049573 | Bacteria | 2793 |
| 188 | Ga0501038_0045137 | 3300049574 | Bacteria | 3826 |
| 189 | Ga0501038_0156777 | 3300049574 | Bacteria | 1853 |
| 190 | Ga0501043_0005182 | 3300049579 | Bacteria | 10546 |
| 191 | Ga0501043_0112003 | 3300049579 | Bacteria | 2143 |
| 192 | Ga0501043_0174289 | 3300049579 | Bacteria | 1677 |
| 193 | Ga0501043_0183971 | 3300049579 | Bacteria | 1627 |
| 194 | Ga0501046_0056701 | 3300049580 | Bacteria | 3074 |
| 195 | Ga0501047_0002864 | 3300049581 | Bacteria | 16372 |
| 196 | Ga0501047_0020315 | 3300049581 | Bacteria | 6377 |
| 197 | Ga0501047_0353206 | 3300049581 | Bacteria | 1306 |
| 198 | Ga0501048_0000055 | 3300049582 | Bacteria | 56696 |
| 199 | Ga0501069_0105030 | 3300049585 | Bacteria | 1605 |
| 200 | Ga0501069_0185524 | 3300049585 | Bacteria | 1203 |
| 201 | Ga0501070_0001420 | 3300049586 | Bacteria | 21451 |
| 202 | Ga0501073_0019887 | 3300049589 | Bacteria | 4845 |
| 203 | Ga0501073_0128186 | 3300049589 | Bacteria | 1759 |
| 204 | Ga0501077_0216141 | 3300049593 | Bacteria | 1218 |
| 205 | Ga0501080_0000023 | 3300049742 | Bacteria | 90345 |
| 206 | Ga0501080_0250250 | 3300049742 | Bacteria | 1616 |
| 207 | Ga0501083_0002923 | 3300049744 | Bacteria | 11826 |
| 208 | Ga0501035_0002452 | 3300049822 | Bacteria | 18100 |
| 209 | Ga0501035_0031337 | 3300049822 | Bacteria | 4843 |
| 210 | Ga0501035_0161528 | 3300049822 | Bacteria | 1939 |
| 211 | Ga0501044_0011962 | 3300049823 | Bacteria | 9405 |
| 212 | Ga0501044_0026263 | 3300049823 | Bacteria | 6167 |
| 213 | nmdc:mga03683_46827_c1 | 3300050489 | Bacteria | 1793 |
| 214 | nmdc:mga03n38_38902_c1 | 3300050490 | Bacteria | 2060 |
| 215 | nmdc:mga00v17_116261_c1 | 3300050491 | Bacteria | 1700 |
| 216 | nmdc:mga00v17_1369_c1 | 3300050491 | Bacteria | 12779 |
| 217 | nmdc:mga00v17_223780_c1 | 3300050491 | Bacteria | 1218 |
| 218 | nmdc:mga00v17_83177_c1 | 3300050491 | Bacteria | 2002 |
| 219 | nmdc:mga0yw44_13368_c1 | 3300050492 | Bacteria | 4320 |
| 220 | nmdc:mga0yw44_27122_c1 | 3300050492 | Bacteria | 3278 |
| 221 | nmdc:mga09592_429363_c1 | 3300050508 | Bacteria | 1141 |
| 222 | nmdc:mga06r32_273550_c1 | 3300050510 | Bacteria | 1676 |
| 223 | Ga0495601_0021427 | 3300053077 | Bacteria | 3958 |
| 224 | Ga0495612_0083354 | 3300053078 | Bacteria | 1345 |
| 225 | Ga0500643_006664 | 3300053087 | Bacteria | 4789 |
| 226 | Ga0500559_0000168 | 3300053136 | Bacteria | 51816 |
| 227 | Ga0500559_0000418 | 3300053136 | Bacteria | 30441 |
| 228 | Ga0500559_0014988 | 3300053136 | Bacteria | 3276 |
| 229 | Ga0500568_0000304 | 3300053139 | Bacteria | 39367 |
| 230 | Ga0500568_0003869 | 3300053139 | Bacteria | 8156 |
| 231 | Ga0500568_0036100 | 3300053139 | Bacteria | 2013 |
| 232 | Ga0500573_0070133 | 3300053140 | Bacteria | 2000 |
| 233 | Ga0500573_0077399 | 3300053140 | Bacteria | 1893 |
| 234 | Ga0500616_0007278 | 3300053153 | Bacteria | 7061 |
| 235 | Ga0501084_0208708 | 3300054114 | Bacteria | 1648 |
| 236 | Ga0501082_0005425 | 3300060353 | Bacteria | 11067 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049585 | Ga0501069_0185524 | Ga0501069_0185524_403_1086 | 223 |
| 2 | 3300041462 | Ga0451806_342794 | Ga0451806_342794_96_836 | 246 |
| 3 | 3300049571 | Ga0501034_0044059 | Ga0501034_0044059_2556_3383 | 253 |
| 4 | 3300005327 | Ga0070658_10000285 | Ga0070658_1000028543 | 256 |
| 5 | 3300025904 | Ga0207647_10140644 | Ga0207647_101406442 | 256 |
| 6 | 3300025909 | Ga0207705_10000001 | Ga0207705_10000001526 | 256 |
| 7 | 3300005616 | Ga0068852_100278390 | Ga0068852_1002783902 | 260 |
| 8 | 3300009551 | Ga0105238_10030404 | Ga0105238_100304045 | 260 |
| 9 | 3300025924 | Ga0207694_10160697 | Ga0207694_101606971 | 260 |
| 10 | 3300044693 | Ga0466961_0009037 | Ga0466961_0009037_2639_3490 | 260 |
| 11 | 3300005539 | Ga0068853_100074399 | Ga0068853_1000743992 | 262 |
| 12 | 3300005548 | Ga0070665_100635629 | Ga0070665_1006356292 | 262 |
| 13 | 3300026041 | Ga0207639_10033563 | Ga0207639_100335632 | 262 |
| 14 | 3300028379 | Ga0268266_10703217 | Ga0268266_107032171 | 262 |
| 15 | 3300047315 | Ga0495581_0138536 | Ga0495581_0138536_100_963 | 262 |
| 16 | 3300013105 | Ga0157369_10516675 | Ga0157369_105166752 | 263 |
| 17 | 3300044656 | Ga0466969_0008440 | Ga0466969_0008440_2939_3802 | 263 |
| 18 | 3300044693 | Ga0466961_0114977 | Ga0466961_0114977_287_1150 | 263 |
| 19 | 3300044765 | Ga0466970_0011489 | Ga0466970_0011489_65_928 | 263 |
| 20 | 3300048929 | Ga0496126_0007609 | Ga0496126_0007609_9300_10148 | 263 |
| 21 | 3300046529 | Ga0495652_0012514 | Ga0495652_0012514_3610_4473 | 265 |
| 22 | 3300046809 | Ga0495600_0213674 | Ga0495600_0213674_154_1017 | 265 |
| 23 | 3300013105 | Ga0157369_10190670 | Ga0157369_101906701 | 267 |
| 24 | 3300005339 | Ga0070660_100335904 | Ga0070660_1003359041 | 271 |
| 25 | 3300006186 | Ga0075369_10016445 | Ga0075369_100164453 | 271 |
| 26 | 3300025919 | Ga0207657_10071552 | Ga0207657_100715523 | 271 |
| 27 | 3300025932 | Ga0207690_10062791 | Ga0207690_100627912 | 271 |
| 28 | 3300037312 | Ga0395899_0221695 | Ga0395899_0221695_468_1292 | 271 |
| 29 | 3300037466 | Ga0395898_0005514 | Ga0395898_0005514_9640_10464 | 271 |
| 30 | iso_pu_bacteria | 2919055335 | 2919055520 | 271 |
| 31 | 3300049593 | Ga0501077_0216141 | Ga0501077_0216141_389_1207 | 272 |
| 32 | 3300045836 | Ga0466958_0040256 | Ga0466958_0040256_1719_2552 | 273 |
| 33 | 3300053139 | Ga0500568_0003869 | Ga0500568_0003869_5893_6717 | 274 |
| 34 | 3300044694 | Ga0466963_0000256 | Ga0466963_0000256_2728_3567 | 275 |
| 35 | 3300048929 | Ga0496126_0151486 | Ga0496126_0151486_224_1069 | 275 |
| 36 | 3300003322 | rootL2_10078980 | rootL2_100789804 | 276 |
| 37 | 3300003752 | Ga0055539_1000006 | Ga0055539_1000006238 | 276 |
| 38 | 3300003756 | Ga0055533_1000002 | Ga0055533_1000002322 | 276 |
| 39 | 3300003759 | Ga0055525_1000022 | Ga0055525_1000022117 | 276 |
| 40 | 3300003841 | Ga0055541_1006910 | Ga0055541_10069102 | 276 |
| 41 | 3300005327 | Ga0070658_10162845 | Ga0070658_101628452 | 276 |
| 42 | 3300005455 | Ga0070663_100082555 | Ga0070663_1000825552 | 276 |
| 43 | 3300013104 | Ga0157370_10005993 | Ga0157370_100059933 | 276 |
| 44 | 3300020082 | Ga0206353_11072340 | Ga0206353_110723402 | 276 |
| 45 | 3300025225 | Ga0209566_102182 | Ga0209566_1021822 | 276 |
| 46 | 3300025226 | Ga0209674_100001 | Ga0209674_1000013241 | 276 |
| 47 | 3300025230 | Ga0209563_100001 | Ga0209563_1000013241 | 276 |
| 48 | 3300025253 | Ga0209677_100001 | Ga0209677_1000013241 | 276 |
| 49 | 3300026067 | Ga0207678_10019764 | Ga0207678_100197644 | 276 |
| 50 | 3300031456 | Ga0307513_10008582 | Ga0307513_100085829 | 276 |
| 51 | 3300049568 | Ga0501031_0004067 | Ga0501031_0004067_7913_8755 | 276 |
| 52 | 3300049569 | Ga0501032_0059239 | Ga0501032_0059239_1219_2061 | 276 |
| 53 | 3300049570 | Ga0501033_0072870 | Ga0501033_0072870_699_1541 | 276 |
| 54 | 3300049573 | Ga0501037_0015213 | Ga0501037_0015213_3742_4584 | 276 |
| 55 | 3300049574 | Ga0501038_0045137 | Ga0501038_0045137_695_1537 | 276 |
| 56 | 3300049579 | Ga0501043_0183971 | Ga0501043_0183971_467_1309 | 276 |
| 57 | 3300049580 | Ga0501046_0056701 | Ga0501046_0056701_27_869 | 276 |
| 58 | 3300049581 | Ga0501047_0002864 | Ga0501047_0002864_10712_11554 | 276 |
| 59 | 3300049582 | Ga0501048_0000055 | Ga0501048_0000055_13390_14232 | 276 |
| 60 | 3300049742 | Ga0501080_0250250 | Ga0501080_0250250_423_1265 | 276 |
| 61 | 3300049822 | Ga0501035_0031337 | Ga0501035_0031337_2638_3480 | 276 |
| 62 | 3300049822 | Ga0501035_0161528 | Ga0501035_0161528_211_1053 | 276 |
| 63 | 3300049823 | Ga0501044_0026263 | Ga0501044_0026263_435_1277 | 276 |
| 64 | 3300050492 | nmdc:mga0yw44_13368_c1 | nmdc:mga0yw44_13368_c1_57_887 | 276 |
| 65 | iso_pu_bacteria | 2811994879 | 2812360938 | 276 |
| 66 | iso_pu_bacteria | 2912715099 | 2912723183 | 276 |
| 67 | iso_pu_bacteria | 2947224130 | 2947232493 | 276 |
| 68 | 3300021388 | Ga0213875_10115539 | Ga0213875_101155392 | 277 |
| 69 | 3300031730 | Ga0307516_10064250 | Ga0307516_100642504 | 277 |
| 70 | 3300037853 | Ga0436364_1186774 | Ga0436364_1186774_3493_4326 | 277 |
| 71 | 3300044694 | Ga0466963_0120146 | Ga0466963_0120146_582_1427 | 277 |
| 72 | 3300047317 | Ga0495604_0227580 | Ga0495604_0227580_377_1228 | 277 |
| 73 | iso_pu_bacteria | 2758568522 | 2760303167 | 277 |
| 74 | 3300020081 | Ga0206354_10748343 | Ga0206354_107483431 | 278 |
| 75 | 3300041451 | Ga0451791_0443949 | Ga0451791_0443949_626_1462 | 278 |
| 76 | 3300041453 | Ga0451797_0045396 | Ga0451797_0045396_573_1409 | 278 |
| 77 | 3300041491 | Ga0451833_0319473 | Ga0451833_0319473_92_928 | 278 |
| 78 | 3300041512 | Ga0451853_1276994 | Ga0451853_1276994_283_1119 | 278 |
| 79 | 3300044842 | Ga0466957_0157457 | Ga0466957_0157457_363_1199 | 278 |
| 80 | 3300045976 | Ga0466967_0005177 | Ga0466967_0005177_7377_8213 | 278 |
| 81 | 3300048917 | Ga0496114_0555632 | Ga0496114_0555632_69_905 | 278 |
| 82 | iso_pu_bacteria | 2932431166 | 2932433958 | 278 |
| 83 | 3300013307 | Ga0157372_10423466 | Ga0157372_104234661 | 279 |
| 84 | 3300046499 | Ga0495594_0121411 | Ga0495594_0121411_106_945 | 279 |
| 85 | 3300050492 | nmdc:mga0yw44_27122_c1 | nmdc:mga0yw44_27122_c1_139_981 | 279 |
| 86 | iso_pu_bacteria | 2758568621 | 2760622898 | 279 |
| 87 | 3300017792 | Ga0163161_10096642 | Ga0163161_100966422 | 280 |
| 88 | 3300028794 | Ga0307515_10000952 | Ga0307515_1000095227 | 280 |
| 89 | 3300031730 | Ga0307516_10001600 | Ga0307516_1000160026 | 280 |
| 90 | 3300031731 | Ga0307405_10096448 | Ga0307405_100964482 | 280 |
| 91 | 3300031824 | Ga0307413_10338917 | Ga0307413_103389171 | 280 |
| 92 | 3300031995 | Ga0307409_100709007 | Ga0307409_1007090072 | 280 |
| 93 | 3300035091 | Ga0373951_0000010 | Ga0373951_0000010_10178_11032 | 280 |
| 94 | 3300042007 | Ga0439449_0024969 | Ga0439449_0024969_1351_2202 | 280 |
| 95 | 3300044658 | Ga0466972_0065771 | Ga0466972_0065771_304_1149 | 280 |
| 96 | 3300044683 | Ga0466965_0167990 | Ga0466965_0167990_59_919 | 280 |
| 97 | 3300044693 | Ga0466961_0135382 | Ga0466961_0135382_279_1124 | 280 |
| 98 | 3300044735 | Ga0466968_0051933 | Ga0466968_0051933_896_1741 | 280 |
| 99 | 3300044901 | Ga0466960_0050361 | Ga0466960_0050361_468_1313 | 280 |
| 100 | 3300053140 | Ga0500573_0077399 | Ga0500573_0077399_89_931 | 280 |
| 101 | iso_pu_bacteria | 2643221572 | 2643876684 | 280 |
| 102 | iso_pu_bacteria | 2643221669 | 2644383739 | 280 |
| 103 | 3300006880 | Ga0075429_100015621 | Ga0075429_1000156212 | 281 |
| 104 | 3300031730 | Ga0307516_10019513 | Ga0307516_100195134 | 281 |
| 105 | 3300031824 | Ga0307413_10045278 | Ga0307413_100452782 | 281 |
| 106 | 3300031995 | Ga0307409_100139164 | Ga0307409_1001391642 | 281 |
| 107 | 3300032002 | Ga0307416_100105473 | Ga0307416_1001054732 | 281 |
| 108 | 3300032004 | Ga0307414_10075244 | Ga0307414_100752442 | 281 |
| 109 | 3300032126 | Ga0307415_100249440 | Ga0307415_1002494402 | 281 |
| 110 | 3300046516 | Ga0495628_0009869 | Ga0495628_0009869_6389_7252 | 281 |
| 111 | 3300046529 | Ga0495652_0241597 | Ga0495652_0241597_98_961 | 281 |
| 112 | 3300048919 | Ga0496116_0200273 | Ga0496116_0200273_165_1025 | 281 |
| 113 | 3300048920 | Ga0496117_0022432 | Ga0496117_0022432_42_902 | 281 |
| 114 | 3300048921 | Ga0496118_0014040 | Ga0496118_0014040_33_893 | 281 |
| 115 | 3300048922 | Ga0496119_0088750 | Ga0496119_0088750_708_1565 | 281 |
| 116 | 3300049573 | Ga0501037_0059269 | Ga0501037_0059269_1735_2580 | 281 |
| 117 | 3300049579 | Ga0501043_0005182 | Ga0501043_0005182_514_1359 | 281 |
| 118 | 3300049581 | Ga0501047_0353206 | Ga0501047_0353206_159_1004 | 281 |
| 119 | 3300049585 | Ga0501069_0105030 | Ga0501069_0105030_115_960 | 281 |
| 120 | 3300049586 | Ga0501070_0001420 | Ga0501070_0001420_756_1601 | 281 |
| 121 | 3300049589 | Ga0501073_0019887 | Ga0501073_0019887_2431_3276 | 281 |
| 122 | 3300049742 | Ga0501080_0000023 | Ga0501080_0000023_24632_25477 | 281 |
| 123 | 3300049744 | Ga0501083_0002923 | Ga0501083_0002923_9778_10623 | 281 |
| 124 | 3300050508 | nmdc:mga09592_429363_c1 | nmdc:mga09592_429363_c1_226_1098 | 281 |
| 125 | 3300050510 | nmdc:mga06r32_273550_c1 | nmdc:mga06r32_273550_c1_676_1548 | 281 |
| 126 | 3300053077 | Ga0495601_0021427 | Ga0495601_0021427_129_992 | 281 |
| 127 | 3300053078 | Ga0495612_0083354 | Ga0495612_0083354_40_903 | 281 |
| 128 | 3300053136 | Ga0500559_0000168 | Ga0500559_0000168_2504_3349 | 281 |
| 129 | 3300053139 | Ga0500568_0036100 | Ga0500568_0036100_184_1029 | 281 |
| 130 | 3300054114 | Ga0501084_0208708 | Ga0501084_0208708_423_1268 | 281 |
| 131 | iso_pu_bacteria | 2902792274 | 2902795193 | 281 |
| 132 | iso_pu_bacteria | 2929212328 | 2929216243 | 281 |
| 133 | 3300005337 | Ga0070682_100069824 | Ga0070682_1000698242 | 282 |
| 134 | 3300006038 | Ga0075365_10103531 | Ga0075365_101035312 | 282 |
| 135 | 3300013102 | Ga0157371_10004459 | Ga0157371_100044599 | 282 |
| 136 | 3300048903 | Ga0496100_0058783 | Ga0496100_0058783_420_1274 | 282 |
| 137 | 3300048906 | Ga0496103_0075097 | Ga0496103_0075097_574_1428 | 282 |
| 138 | 3300048906 | Ga0496103_0090654 | Ga0496103_0090654_782_1630 | 282 |
| 139 | 3300048907 | Ga0496104_0023194 | Ga0496104_0023194_1885_2739 | 282 |
| 140 | 3300048908 | Ga0496105_0005433 | Ga0496105_0005433_2545_3399 | 282 |
| 141 | 3300048917 | Ga0496114_0035514 | Ga0496114_0035514_3206_4060 | 282 |
| 142 | 3300048929 | Ga0496126_0054545 | Ga0496126_0054545_1516_2370 | 282 |
| 143 | 3300049571 | Ga0501034_0012528 | Ga0501034_0012528_6492_7340 | 282 |
| 144 | 3300049571 | Ga0501034_0448329 | Ga0501034_0448329_84_932 | 282 |
| 145 | 3300049579 | Ga0501043_0174289 | Ga0501043_0174289_455_1303 | 282 |
| 146 | 3300049589 | Ga0501073_0128186 | Ga0501073_0128186_765_1613 | 282 |
| 147 | 3300053139 | Ga0500568_0000304 | Ga0500568_0000304_2785_3633 | 282 |
| 148 | 3300005548 | Ga0070665_100133134 | Ga0070665_1001331342 | 283 |
| 149 | 3300009551 | Ga0105238_10050035 | Ga0105238_100500355 | 283 |
| 150 | 3300049568 | Ga0501031_0031366 | Ga0501031_0031366_1968_2819 | 283 |
| 151 | 3300049569 | Ga0501032_0109414 | Ga0501032_0109414_312_1163 | 283 |
| 152 | 3300049570 | Ga0501033_0016284 | Ga0501033_0016284_192_1043 | 283 |
| 153 | 3300049571 | Ga0501034_0314371 | Ga0501034_0314371_539_1390 | 283 |
| 154 | 3300049574 | Ga0501038_0156777 | Ga0501038_0156777_782_1633 | 283 |
| 155 | 3300005563 | Ga0068855_100012739 | Ga0068855_1000127397 | 284 |
| 156 | 3300005578 | Ga0068854_100003840 | Ga0068854_1000038404 | 284 |
| 157 | 3300005616 | Ga0068852_100382718 | Ga0068852_1003827182 | 284 |
| 158 | 3300009093 | Ga0105240_10015928 | Ga0105240_100159284 | 284 |
| 159 | 3300009545 | Ga0105237_10086288 | Ga0105237_100862883 | 284 |
| 160 | 3300010375 | Ga0105239_10094880 | Ga0105239_100948803 | 284 |
| 161 | 3300050489 | nmdc:mga03683_46827_c1 | nmdc:mga03683_46827_c1_88_942 | 284 |
| 162 | 3300050491 | nmdc:mga00v17_1369_c1 | nmdc:mga00v17_1369_c1_4529_5383 | 284 |
| 163 | 3300009545 | Ga0105237_10000178 | Ga0105237_1000017830 | 285 |
| 164 | 3300010375 | Ga0105239_10007516 | Ga0105239_100075169 | 285 |
| 165 | 3300025904 | Ga0207647_10003687 | Ga0207647_100036873 | 285 |
| 166 | 3300025913 | Ga0207695_10001059 | Ga0207695_1000105934 | 285 |
| 167 | 3300025914 | Ga0207671_10001032 | Ga0207671_1000103228 | 285 |
| 168 | 3300025914 | Ga0207671_10022723 | Ga0207671_100227233 | 285 |
| 169 | 3300025949 | Ga0207667_10022658 | Ga0207667_100226584 | 285 |
| 170 | 3300026142 | Ga0207698_10030652 | Ga0207698_100306524 | 285 |
| 171 | 3300028379 | Ga0268266_10008929 | Ga0268266_100089297 | 285 |
| 172 | 3300042438 | Ga0439459_0006528 | Ga0439459_0006528_947_1816 | 285 |
| 173 | 3300046524 | Ga0495648_0016749 | Ga0495648_0016749_2797_3666 | 285 |
| 174 | 3300046616 | Ga0495668_0034346 | Ga0495668_0034346_369_1238 | 285 |
| 175 | 3300047469 | Ga0495673_0014236 | Ga0495673_0014236_464_1333 | 285 |
| 176 | 3300048903 | Ga0496100_0006879 | Ga0496100_0006879_1712_2581 | 285 |
| 177 | 3300048904 | Ga0496101_0000021 | Ga0496101_0000021_25173_26042 | 285 |
| 178 | 3300048905 | Ga0496102_0000001 | Ga0496102_0000001_231971_232840 | 285 |
| 179 | 3300048906 | Ga0496103_0000007 | Ga0496103_0000007_122849_123718 | 285 |
| 180 | 3300048909 | Ga0496106_0003386 | Ga0496106_0003386_8605_9474 | 285 |
| 181 | 3300048910 | Ga0496107_0013919 | Ga0496107_0013919_1294_2163 | 285 |
| 182 | 3300048919 | Ga0496116_0000018 | Ga0496116_0000018_195073_195942 | 285 |
| 183 | 3300048920 | Ga0496117_0000015 | Ga0496117_0000015_349936_350805 | 285 |
| 184 | 3300048921 | Ga0496118_0000012 | Ga0496118_0000012_349936_350805 | 285 |
| 185 | 3300048922 | Ga0496119_0000551 | Ga0496119_0000551_2835_3704 | 285 |
| 186 | 3300048923 | Ga0496120_0000155 | Ga0496120_0000155_111183_112052 | 285 |
| 187 | 3300048924 | Ga0496121_0000177 | Ga0496121_0000177_134160_135029 | 285 |
| 188 | 3300048929 | Ga0496126_0001113 | Ga0496126_0001113_26569_27438 | 285 |
| 189 | 3300049571 | Ga0501034_0032944 | Ga0501034_0032944_3692_4549 | 285 |
| 190 | 3300053087 | Ga0500643_006664 | Ga0500643_006664_1978_2847 | 285 |
| 191 | 3300053140 | Ga0500573_0070133 | Ga0500573_0070133_10_882 | 285 |
| 192 | 3300060353 | Ga0501082_0005425 | Ga0501082_0005425_6128_6985 | 285 |
| 193 | 3300006051 | Ga0075364_10000184 | Ga0075364_1000018420 | 286 |
| 194 | 3300006177 | Ga0075362_10028525 | Ga0075362_100285252 | 286 |
| 195 | 3300048903 | Ga0496100_0094572 | Ga0496100_0094572_101_961 | 286 |
| 196 | 3300048906 | Ga0496103_0149137 | Ga0496103_0149137_234_1094 | 286 |
| 197 | 3300044901 | Ga0466960_0026923 | Ga0466960_0026923_1467_2339 | 287 |
| 198 | 3300048928 | Ga0496125_0015308 | Ga0496125_0015308_123_986 | 287 |
| 199 | 3300049571 | Ga0501034_0377063 | Ga0501034_0377063_184_1047 | 287 |
| 200 | 3300049579 | Ga0501043_0112003 | Ga0501043_0112003_405_1268 | 287 |
| 201 | 3300049581 | Ga0501047_0020315 | Ga0501047_0020315_4798_5661 | 287 |
| 202 | 3300049822 | Ga0501035_0002452 | Ga0501035_0002452_7957_8820 | 287 |
| 203 | 3300049823 | Ga0501044_0011962 | Ga0501044_0011962_3948_4811 | 287 |
| 204 | 3300050491 | nmdc:mga00v17_116261_c1 | nmdc:mga00v17_116261_c1_375_1238 | 287 |
| 205 | 3300053153 | Ga0500616_0007278 | Ga0500616_0007278_3171_4034 | 287 |
| 206 | iso_pu_bacteria | 2643221687 | 2644488280 | 287 |
| 207 | iso_pu_bacteria | 2902810491 | 2902811295 | 287 |
| 208 | iso_pu_bacteria | 2902837492 | 2902841368 | 287 |
| 209 | iso_pu_bacteria | 2919055335 | 2919056008 | 287 |
| 210 | iso_pu_bacteria | 2939582691 | 2939583052 | 288 |
| 211 | 3300041410 | Ga0439461_0000217 | Ga0439461_0000217_3165_4046 | 290 |
| 212 | 3300041411 | Ga0439466_0002071 | Ga0439466_0002071_2808_3689 | 290 |
| 213 | 3300041413 | Ga0439465_0008188 | Ga0439465_0008188_14_895 | 290 |
| 214 | 3300041997 | Ga0439431_0002890 | Ga0439431_0002890_1004_1885 | 290 |
| 215 | 3300003792 | Ga0055540_1000941 | Ga0055540_100094113 | 291 |
| 216 | 3300003792 | Ga0055540_1002151 | Ga0055540_10021512 | 291 |
| 217 | 3300003792 | Ga0055540_1003478 | Ga0055540_10034784 | 291 |
| 218 | 3300006038 | Ga0075365_10016662 | Ga0075365_100166625 | 291 |
| 219 | 3300025303 | Ga0209051_1002205 | Ga0209051_100220512 | 291 |
| 220 | 3300025303 | Ga0209051_1005449 | Ga0209051_10054496 | 291 |
| 221 | 3300041456 | Ga0451795_0706639 | Ga0451795_0706639_70_945 | 291 |
| 222 | 3300041462 | Ga0451806_250740 | Ga0451806_250740_168_1043 | 291 |
| 223 | 3300041413 | Ga0439465_0032763 | Ga0439465_0032763_722_1609 | 292 |
| 224 | 3300053136 | Ga0500559_0000418 | Ga0500559_0000418_2788_3678 | 292 |
| 225 | 3300053136 | Ga0500559_0014988 | Ga0500559_0014988_1189_2085 | 292 |
| 226 | 3300044683 | Ga0466965_0004636 | Ga0466965_0004636_2836_3735 | 294 |
| 227 | 3300044683 | Ga0466965_0019593 | Ga0466965_0019593_1773_2666 | 294 |
| 228 | 3300044735 | Ga0466968_0003676 | Ga0466968_0003676_2660_3553 | 294 |
| 229 | 3300044765 | Ga0466970_0053777 | Ga0466970_0053777_497_1390 | 294 |
| 230 | 3300044842 | Ga0466957_0004101 | Ga0466957_0004101_1583_2476 | 294 |
| 231 | 3300044901 | Ga0466960_0003050 | Ga0466960_0003050_3562_4455 | 294 |
| 232 | 3300044901 | Ga0466960_0004184 | Ga0466960_0004184_1764_2663 | 294 |
| 233 | 3300045976 | Ga0466967_0025442 | Ga0466967_0025442_2309_3202 | 294 |
| 234 | 3300050491 | nmdc:mga00v17_223780_c1 | nmdc:mga00v17_223780_c1_44_928 | 294 |
| 235 | 3300002459 | JGI24751J29686_10004892 | JGI24751J29686_100048921 | 295 |
| 236 | 3300005355 | Ga0070671_100000490 | Ga0070671_10000049028 | 295 |
| 237 | 3300005367 | Ga0070667_100286160 | Ga0070667_1002861602 | 295 |
| 238 | 3300005548 | Ga0070665_100009958 | Ga0070665_1000099584 | 295 |
| 239 | 3300005841 | Ga0068863_100001514 | Ga0068863_10000151413 | 295 |
| 240 | 3300006048 | Ga0075363_100001294 | Ga0075363_1000012944 | 295 |
| 241 | 3300006353 | Ga0075370_10184675 | Ga0075370_101846752 | 295 |
| 242 | 3300009177 | Ga0105248_10223762 | Ga0105248_102237622 | 295 |
| 243 | 3300014325 | Ga0163163_10002897 | Ga0163163_100028978 | 295 |
| 244 | 3300025986 | Ga0207658_10028411 | Ga0207658_100284113 | 295 |
| 245 | 3300028379 | Ga0268266_10010757 | Ga0268266_100107574 | 295 |
| 246 | 3300048905 | Ga0496102_0000590 | Ga0496102_0000590_11438_12325 | 295 |
| 247 | 3300048907 | Ga0496104_0002417 | Ga0496104_0002417_9683_10570 | 295 |
| 248 | 3300048911 | Ga0496108_0042422 | Ga0496108_0042422_1688_2575 | 295 |
| 249 | 3300048912 | Ga0496109_0112068 | Ga0496109_0112068_1248_2135 | 295 |
| 250 | 3300048914 | Ga0496111_0117039 | Ga0496111_0117039_237_1124 | 295 |
| 251 | 3300050490 | nmdc:mga03n38_38902_c1 | nmdc:mga03n38_38902_c1_603_1490 | 295 |
| 252 | 3300050491 | nmdc:mga00v17_83177_c1 | nmdc:mga00v17_83177_c1_124_1011 | 295 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8q57-assembly1.cif.gz_A | crystal structure of class ii sfp aldolase from yersinia aldovae (yasqia-zn-so4) with bound sulfate ions | 0.9344 | 1 | 283 |
| 8q59-assembly1.cif.gz_B-2 | crystal structure of metal-dependent class ii sulfofructose phosphate aldolase from yersinia aldovae in complex with sulfofructose phosphate (yasqia-zn-sfp) | 0.9316 | 1 | 283 |
| 8q58-assembly1.cif.gz_A | crystal structure of metal-dependent classii sulfofructosephosphate aldolase (sfpa) from hafnia paralvei hpsqia-zn | 0.9312 | 1 | 283 |
| 8q59-assembly1.cif.gz_A-2 | crystal structure of metal-dependent class ii sulfofructose phosphate aldolase from yersinia aldovae in complex with sulfofructose phosphate (yasqia-zn-sfp) | 0.9304 | 1 | 283 |
| 8q5a-assembly1.cif.gz_A | crystal structure of metal-dependent class ii sulfofructosephosphate aldolase from hafnia paralvei hpsqia-zn in complex with dihydroxyacetone phosphate (dhap) | 0.9264 | 1 | 283 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6ofuA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9234 | 3 | 283 | 3.20.20.70 |
| 3q94B00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9147 | 2 | 283 | 3.20.20.70 |
| 6ofuA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8995 | 3 | 283 | 3.20.20.70 |
| 1gvfB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8993 | 3 | 281 | 3.20.20.70 |
| 3q94B00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8985 | 2 | 283 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S3ABZ2-F1-model_v4 | Fructose-bisphosphate aldolase | 0.9875 | 4 | 281 |
GO:0005975
GO:0008270 GO:0016832 |
| AF-A0A6B1JT59-F1-model_v4 | deleted | 0.982 | 166 | 281 |
|
| AF-A0A6B3G8C4-F1-model_v4 | Class II fructose-bisphosphate aldolase | 0.9783 | 1 | 95 |
GO:0005975
GO:0008270 GO:0016832 |
| AF-A0A506XYH0-F1-model_v4 | Class II fructose-bisphosphate aldolase | 0.977 | 1 | 280 |
GO:0005975
GO:0008270 GO:0016832 |
| AF-A0A6G4X1V5-F1-model_v4 | Fructose-bisphosphate aldolase | 0.974 | 105 | 282 |
GO:0005975
GO:0008270 GO:0016832 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar