F362764

General Info

Members Datasets Scaffolds Average Seq Length
251 184 502 102

Family's Representative Sequence

Representative Sequence 3300049583|Ga0501067_0063290|Ga0501067_0063290_343_705
Length 120
Sequence LRARRDGTILAEERHMALMSTRSWDDWIREYAESHTNAVNRRCHTVGIPMIALSVPLFVVAAFWRALWPVPVALFVIGWIFQLVGHAYEHKPPEFLKDWRFLFVGLRWWIAKMRGRAIHH

Samples

Sample ID Description Type Environment
1 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
99 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
100 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
101 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
105 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
108 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
116 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
117 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
118 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
120 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
121 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
122 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
123 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
124 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
133 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
134 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
135 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
136 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
137 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
138 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
144 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
167 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
168 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
169 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
170 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
171 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
183 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
184 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.98
Rhizosphere 94.82
Stem 0
Stem Tuber 0
Unclassified 21.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501067_0063290 3300049583 Bacteria 2048
2 Ga0065715_10677564 3300005293 Unclassified 665
3 Ga0070658_10041008 3300005327 Bacteria 3735
4 Ga0070676_10693151 3300005328 Unclassified 743
5 Ga0070683_100537247 3300005329 Bacteria 1118
6 Ga0070690_100003673 3300005330 Bacteria 8449
7 Ga0070670_100457296 3300005331 Bacteria 1132
8 Ga0068869_100016434 3300005334 Bacteria 4987
9 Ga0070666_10128724 3300005335 Unclassified 1758
10 Ga0068868_100509539 3300005338 Unclassified 1055
11 Ga0070689_100102956 3300005340 Unclassified 2262
12 Ga0070689_100904880 3300005340 Unclassified 781
13 Ga0070689_101115344 3300005340 Unclassified 705
14 Ga0070687_100206604 3300005343 Bacteria 1194
15 Ga0070687_101401636 3300005343 Unclassified 522
16 Ga0070692_10218989 3300005345 Bacteria 1124
17 Ga0070668_101158373 3300005347 Bacteria 699
18 Ga0070675_101249117 3300005354 Bacteria 684
19 Ga0070671_100612733 3300005355 Unclassified 941
20 Ga0070688_100072292 3300005365 Unclassified 2210
21 Ga0070688_100303532 3300005365 Bacteria 1155
22 Ga0070703_10006821 3300005406 Bacteria 3204
23 Ga0070709_10417371 3300005434 Bacteria 1005
24 Ga0070714_101011644 3300005435 Bacteria 809
25 Ga0070710_10249776 3300005437 Bacteria 1140
26 Ga0070701_10134585 3300005438 Bacteria 1407
27 Ga0070705_100680602 3300005440 Bacteria 806
28 Ga0070694_101027982 3300005444 Unclassified 685
29 Ga0070708_100048235 3300005445 Bacteria 3764
30 Ga0070708_101586061 3300005445 Unclassified 609
31 Ga0070678_101677119 3300005456 Unclassified 598
32 Ga0070681_10091912 3300005458 Bacteria 2984
33 Ga0070706_100286456 3300005467 Bacteria 1537
34 Ga0070707_101163431 3300005468 Bacteria 737
35 Ga0070698_100000087 3300005471 Bacteria 72711
36 Ga0070699_100010060 3300005518 Bacteria 8189
37 Ga0070699_100596030 3300005518 Bacteria 1007
38 Ga0070679_100207868 3300005530 Bacteria 1922
39 Ga0070684_101038040 3300005535 Bacteria 770
40 Ga0070672_101534379 3300005543 Unclassified 597
41 Ga0070686_100014194 3300005544 Bacteria 4586
42 Ga0070686_100087656 3300005544 Bacteria 2075
43 Ga0070696_100085904 3300005546 Bacteria 2233
44 Ga0070704_101371191 3300005549 Bacteria 648
45 Ga0068859_100037046 3300005617 Bacteria 4896
46 Ga0068866_10663859 3300005718 Unclassified 711
47 Ga0068861_100025354 3300005719 Bacteria 4299
48 Ga0068861_100126672 3300005719 Bacteria 2067
49 Ga0068861_101322671 3300005719 Bacteria 701
50 Ga0068863_100138830 3300005841 Unclassified 2323
51 Ga0068858_100427541 3300005842 Unclassified 1274
52 Ga0068862_100132071 3300005844 Unclassified 2209
53 Ga0068862_100730148 3300005844 Bacteria 962
54 Ga0070717_10041309 3300006028 Bacteria 3760
55 Ga0075428_100012468 3300006844 Bacteria 9453
56 Ga0075428_100774647 3300006844 Bacteria 1020
57 Ga0075430_100001985 3300006846 Bacteria 16850
58 Ga0075430_100703966 3300006846 Bacteria 833
59 Ga0075431_100000994 3300006847 Bacteria 25257
60 Ga0075431_100804372 3300006847 Bacteria 913
61 Ga0075431_101393686 3300006847 Bacteria 661
62 Ga0075433_10003451 3300006852 Bacteria 12196
63 Ga0075434_100044592 3300006871 Bacteria 4399
64 Ga0075434_101773476 3300006871 Bacteria 624
65 Ga0075429_100001053 3300006880 Bacteria 22024
66 Ga0075436_100504754 3300006914 Bacteria 885
67 Ga0097620_100037041 3300006931 Bacteria 4896
68 Ga0105240_10262855 3300009093 Bacteria 1990
69 Ga0111539_10093840 3300009094 Bacteria 3525
70 Ga0111539_10156603 3300009094 Bacteria 2666
71 Ga0114129_10088129 3300009147 Unclassified 4304
72 Ga0114129_10964428 3300009147 Bacteria 1076
73 Ga0105243_11867254 3300009148 Bacteria 633
74 Ga0105242_11941928 3300009176 Unclassified 630
75 Ga0105248_12266998 3300009177 Bacteria 618
76 Ga0105238_12013681 3300009551 Bacteria 611
77 Ga0105246_10304185 3300011119 Unclassified 1289
78 Ga0157369_11790057 3300013105 Bacteria 624
79 Ga0157374_10422226 3300013296 Bacteria 1332
80 Ga0157374_11183485 3300013296 Unclassified 785
81 Ga0157378_11570881 3300013297 Bacteria 703
82 Ga0157375_10540096 3300013308 Bacteria 1328
83 Ga0157375_11791602 3300013308 Unclassified 728
84 Ga0157380_10063257 3300014326 Bacteria 2966
85 Ga0157380_11902346 3300014326 Bacteria 655
86 Ga0157380_13548951 3300014326 Bacteria 500
87 Ga0157377_10448561 3300014745 Bacteria 890
88 Ga0157376_10186227 3300014969 Bacteria 1901
89 Ga0157376_11568061 3300014969 Bacteria 692
90 Ga0163161_10502050 3300017792 Bacteria 988
91 Ga0207653_10011078 3300025885 Bacteria 2816
92 Ga0207692_10019042 3300025898 Bacteria 3095
93 Ga0207680_10213436 3300025903 Unclassified 1320
94 Ga0207699_10347834 3300025906 Bacteria 1046
95 Ga0207705_10148195 3300025909 Bacteria 1757
96 Ga0207684_10098486 3300025910 Bacteria 2497
97 Ga0207707_10044150 3300025912 Bacteria 3887
98 Ga0207663_10030896 3300025916 Bacteria 3164
99 Ga0207662_10105003 3300025918 Bacteria 1755
100 Ga0207646_10249251 3300025922 Bacteria 1604
101 Ga0207681_10754344 3300025923 Bacteria 811
102 Ga0207706_10252906 3300025933 Unclassified 1539
103 Ga0207706_10421055 3300025933 Bacteria 1157
104 Ga0207709_10455283 3300025935 Bacteria 990
105 Ga0207670_10053017 3300025936 Unclassified 2730
106 Ga0207670_10883331 3300025936 Unclassified 748
107 Ga0207689_10066117 3300025942 Bacteria 2973
108 Ga0207661_10061327 3300025944 Bacteria 3038
109 Ga0207677_11231179 3300026023 Bacteria 686
110 Ga0207703_10278299 3300026035 Unclassified 1519
111 Ga0207639_12193887 3300026041 Unclassified 514
112 Ga0207678_10480826 3300026067 Bacteria 1081
113 Ga0207708_10387071 3300026075 Bacteria 1154
114 Ga0207702_11103697 3300026078 Bacteria 787
115 Ga0207676_10271529 3300026095 Unclassified 1536
116 Ga0207676_10862349 3300026095 Bacteria 886
117 Ga0207674_10444284 3300026116 Unclassified 1253
118 Ga0207675_100011414 3300026118 Bacteria 8313
119 Ga0207675_100206423 3300026118 Bacteria 1888
120 Ga0207428_10462914 3300027907 Bacteria 924
121 Ga0268265_11028117 3300028380 Bacteria 815
122 Ga0265336_10003115 3300028666 Bacteria 6593
123 Ga0265338_10043322 3300028800 Bacteria 4176
124 Ga0265332_10086625 3300031238 Bacteria 1327
125 Ga0265332_10358243 3300031238 Unclassified 602
126 Ga0265328_10093017 3300031239 Bacteria 1114
127 Ga0265339_10004244 3300031249 Bacteria 9817
128 Ga0265339_10369570 3300031249 Bacteria 673
129 Ga0265316_10069243 3300031344 Bacteria 2723
130 Ga0307408_100654212 3300031548 Unclassified 940
131 Ga0307408_100774751 3300031548 Unclassified 868
132 Ga0265314_10025137 3300031711 Bacteria 4499
133 Ga0265342_10000063 3300031712 Bacteria 114505
134 Ga0265342_10039379 3300031712 Bacteria 2873
135 Ga0307413_10033217 3300031824 Bacteria 2935
136 Ga0307413_10945832 3300031824 Unclassified 735
137 Ga0307413_11088204 3300031824 Bacteria 690
138 Ga0307410_10005432 3300031852 Bacteria 6745
139 Ga0307410_10064756 3300031852 Bacteria 2512
140 Ga0326468_10026472 3300031889 Unclassified 737
141 Ga0307407_10312701 3300031903 Bacteria 1099
142 Ga0307407_10708372 3300031903 Bacteria 759
143 Ga0307412_10545171 3300031911 Unclassified 973
144 Ga0307409_100389782 3300031995 Unclassified 1327
145 Ga0307409_100610395 3300031995 Unclassified 1079
146 Ga0307409_101096302 3300031995 Bacteria 817
147 Ga0307416_100177469 3300032002 Unclassified 1992
148 Ga0307416_103523315 3300032002 Bacteria 524
149 Ga0307414_10211429 3300032004 Bacteria 1586
150 Ga0307411_10096844 3300032005 Unclassified 2075
151 Ga0307411_10100379 3300032005 Bacteria 2045
152 Ga0307411_10145440 3300032005 Bacteria 1754
153 Ga0307415_100005531 3300032126 Bacteria 6720
154 Ga0307415_100191653 3300032126 Bacteria 1614
155 Ga0307507_10523089 3300033179 Bacteria 633
156 Ga0373950_0000014 3300034818 Bacteria 284896
157 Ga0373950_0000049 3300034818 Bacteria 87604
158 Ga0373934_0012069 3300035086 Bacteria 3260
159 Ga0373923_0651741 3300035111 Bacteria 521
160 Ga0373945_0374272 3300035116 Bacteria 621
161 Ga0373954_0197040 3300035118 Unclassified 989
162 Ga0373956_0486967 3300035119 Unclassified 589
163 Ga0373957_0111980 3300035120 Bacteria 1100
164 Ga0373943_0117587 3300035170 Bacteria 1410
165 Ga0373955_0063240 3300035172 Bacteria 2049
166 Ga0373931_0848474 3300035691 Bacteria 611
167 Ga0373935_0256094 3300035692 Bacteria 1226
168 Ga0373933_0000126 3300035724 Bacteria 49228
169 Ga0373937_0008210 3300036401 Bacteria 9067
170 Ga0373937_0187868 3300036401 Bacteria 1941
171 Ga0373937_1699545 3300036401 Unclassified 578
172 Ga0373925_1325435 3300037068 Bacteria 590
173 Ga0395900_1828984 3300037418 Bacteria 518
174 Ga0395905_0655539 3300037471 Unclassified 952
175 Ga0439436_0062114 3300041404 Bacteria 1045
176 Ga0439439_0001062 3300041406 Bacteria 5222
177 Ga0451798_0357423 3300041458 Unclassified 1880
178 Ga0451800_1087815 3300041459 Bacteria 1012
179 Ga0451853_1059096 3300041512 Unclassified 1584
180 Ga0451853_3821866 3300041512 Unclassified 751
181 Ga0439462_0153859 3300042015 Unclassified 647
182 Ga0439446_0007977 3300042156 Bacteria 2797
183 Ga0439446_0154481 3300042156 Bacteria 756
184 Ga0451576_0049089 3300045051 Bacteria 4429
185 Ga0451576_1022399 3300045051 Bacteria 866
186 Ga0495629_1037845 3300046459 Bacteria 532
187 Ga0495628_0417678 3300046516 Bacteria 978
188 Ga0495635_0556348 3300046663 Bacteria 752
189 Ga0495604_0104831 3300047317 Bacteria 2071
190 Ga0495680_0825861 3300047322 Bacteria 604
191 Ga0496103_0384595 3300048906 Unclassified 902
192 Ga0496104_1375273 3300048907 Bacteria 609
193 Ga0496106_0171510 3300048909 Unclassified 1720
194 Ga0496107_0190538 3300048910 Bacteria 1523
195 Ga0496109_0810492 3300048912 Bacteria 874
196 Ga0496114_0006321 3300048917 Bacteria 9322
197 Ga0496114_1316927 3300048917 Unclassified 609
198 Ga0496115_0026459 3300048918 Bacteria 4528
199 Ga0501034_0002939 3300049571 Bacteria 19748
200 Ga0501036_0001732 3300049572 Bacteria 16950
201 Ga0501036_0148318 3300049572 Bacteria 1979
202 Ga0501036_0448879 3300049572 Bacteria 1074
203 Ga0501038_0027821 3300049574 Bacteria 5025
204 Ga0501038_0959755 3300049574 Bacteria 629
205 Ga0501039_0949464 3300049575 Bacteria 669
206 Ga0501040_0761917 3300049576 Bacteria 700
207 Ga0501040_0934450 3300049576 Bacteria 628
208 Ga0501042_0543688 3300049578 Bacteria 844
209 Ga0501042_0704586 3300049578 Bacteria 734
210 Ga0501043_0078015 3300049579 Bacteria 2602
211 Ga0501043_0430978 3300049579 Bacteria 993
212 Ga0501046_0002493 3300049580 Bacteria 17239
213 Ga0501046_0148871 3300049580 Bacteria 1767
214 Ga0501047_0000831 3300049581 Bacteria 31839
215 Ga0501047_0509542 3300049581 Bacteria 1030
216 Ga0501048_0000791 3300049582 Bacteria 23190
217 Ga0501048_0046677 3300049582 Bacteria 3092
218 Ga0501067_0000007 3300049583 Bacteria 126276
219 Ga0501069_0362318 3300049585 Bacteria 855
220 Ga0501070_0089389 3300049586 Bacteria 2549
221 Ga0501071_0489485 3300049587 Bacteria 943
222 Ga0501072_0000019 3300049588 Bacteria 158156
223 Ga0501073_0004065 3300049589 Bacteria 10987
224 Ga0501073_0005815 3300049589 Bacteria 9215
225 Ga0501074_0002037 3300049590 Bacteria 13945
226 Ga0501074_0664244 3300049590 Bacteria 736
227 Ga0501076_0113798 3300049592 Bacteria 2189
228 Ga0501077_0447802 3300049593 Bacteria 827
229 Ga0501258_067995 3300049687 Unclassified 525
230 Ga0501079_0000435 3300049741 Bacteria 27172
231 Ga0501080_0017823 3300049742 Bacteria 6572
232 Ga0501080_0623533 3300049742 Bacteria 956
233 Ga0501080_0744210 3300049742 Bacteria 862
234 Ga0501080_1091500 3300049742 Unclassified 689
235 Ga0501083_0010391 3300049744 Bacteria 6553
236 Ga0501035_0763608 3300049822 Bacteria 775
237 Ga0501044_0529532 3300049823 Bacteria 1077
238 nmdc:mga05p37_135388_c1 3300050507 Bacteria 3021
239 nmdc:mga05p37_912129_c1 3300050507 Bacteria 946
240 nmdc:mga09592_34668_c1 3300050508 Bacteria 4220
241 nmdc:mga0qj67_2233_c1 3300050509 Bacteria 13757
242 nmdc:mga0qj67_384903_c1 3300050509 Unclassified 1132
243 nmdc:mga06r32_28913_c1 3300050510 Bacteria 5189
244 nmdc:mga08y16_439_c1 3300050511 Bacteria 38374
245 nmdc:mga08y16_59639_c1 3300050511 Bacteria 3985
246 nmdc:mga0n895_30985_c1 3300050512 Bacteria 5116
247 nmdc:mga0a205_1225_c1 3300050515 Bacteria 21505
248 Ga0501084_0000075 3300054114 Bacteria 72001
249 Ga0501084_0712315 3300054114 Bacteria 846
250 Ga0501082_0007794 3300060353 Bacteria 9240
251 Ga0501082_0073762 3300060353 Bacteria 2939
252 Ga0501067_0063290
253 Ga0065715_10677564
254 Ga0070658_10041008
255 Ga0070676_10693151
256 Ga0070683_100537247
257 Ga0070690_100003673
258 Ga0070670_100457296
259 Ga0068869_100016434
260 Ga0070666_10128724
261 Ga0068868_100509539
262 Ga0070689_100102956
263 Ga0070689_100904880
264 Ga0070689_101115344
265 Ga0070687_100206604
266 Ga0070687_101401636
267 Ga0070692_10218989
268 Ga0070668_101158373
269 Ga0070675_101249117
270 Ga0070671_100612733
271 Ga0070688_100072292
272 Ga0070688_100303532
273 Ga0070703_10006821
274 Ga0070709_10417371
275 Ga0070714_101011644
276 Ga0070710_10249776
277 Ga0070701_10134585
278 Ga0070705_100680602
279 Ga0070694_101027982
280 Ga0070708_100048235
281 Ga0070708_101586061
282 Ga0070678_101677119
283 Ga0070681_10091912
284 Ga0070706_100286456
285 Ga0070707_101163431
286 Ga0070698_100000087
287 Ga0070699_100010060
288 Ga0070699_100596030
289 Ga0070679_100207868
290 Ga0070684_101038040
291 Ga0070672_101534379
292 Ga0070686_100014194
293 Ga0070686_100087656
294 Ga0070696_100085904
295 Ga0070704_101371191
296 Ga0068859_100037046
297 Ga0068866_10663859
298 Ga0068861_100025354
299 Ga0068861_100126672
300 Ga0068861_101322671
301 Ga0068863_100138830
302 Ga0068858_100427541
303 Ga0068862_100132071
304 Ga0068862_100730148
305 Ga0070717_10041309
306 Ga0075428_100012468
307 Ga0075428_100774647
308 Ga0075430_100001985
309 Ga0075430_100703966
310 Ga0075431_100000994
311 Ga0075431_100804372
312 Ga0075431_101393686
313 Ga0075433_10003451
314 Ga0075434_100044592
315 Ga0075434_101773476
316 Ga0075429_100001053
317 Ga0075436_100504754
318 Ga0097620_100037041
319 Ga0105240_10262855
320 Ga0111539_10093840
321 Ga0111539_10156603
322 Ga0114129_10088129
323 Ga0114129_10964428
324 Ga0105243_11867254
325 Ga0105242_11941928
326 Ga0105248_12266998
327 Ga0105238_12013681
328 Ga0105246_10304185
329 Ga0157369_11790057
330 Ga0157374_10422226
331 Ga0157374_11183485
332 Ga0157378_11570881
333 Ga0157375_10540096
334 Ga0157375_11791602
335 Ga0157380_10063257
336 Ga0157380_11902346
337 Ga0157380_13548951
338 Ga0157377_10448561
339 Ga0157376_10186227
340 Ga0157376_11568061
341 Ga0163161_10502050
342 Ga0207653_10011078
343 Ga0207692_10019042
344 Ga0207680_10213436
345 Ga0207699_10347834
346 Ga0207705_10148195
347 Ga0207684_10098486
348 Ga0207707_10044150
349 Ga0207663_10030896
350 Ga0207662_10105003
351 Ga0207646_10249251
352 Ga0207681_10754344
353 Ga0207706_10252906
354 Ga0207706_10421055
355 Ga0207709_10455283
356 Ga0207670_10053017
357 Ga0207670_10883331
358 Ga0207689_10066117
359 Ga0207661_10061327
360 Ga0207677_11231179
361 Ga0207703_10278299
362 Ga0207639_12193887
363 Ga0207678_10480826
364 Ga0207708_10387071
365 Ga0207702_11103697
366 Ga0207676_10271529
367 Ga0207676_10862349
368 Ga0207674_10444284
369 Ga0207675_100011414
370 Ga0207675_100206423
371 Ga0207428_10462914
372 Ga0268265_11028117
373 Ga0265336_10003115
374 Ga0265338_10043322
375 Ga0265332_10086625
376 Ga0265332_10358243
377 Ga0265328_10093017
378 Ga0265339_10004244
379 Ga0265339_10369570
380 Ga0265316_10069243
381 Ga0307408_100654212
382 Ga0307408_100774751
383 Ga0265314_10025137
384 Ga0265342_10000063
385 Ga0265342_10039379
386 Ga0307413_10033217
387 Ga0307413_10945832
388 Ga0307413_11088204
389 Ga0307410_10005432
390 Ga0307410_10064756
391 Ga0326468_10026472
392 Ga0307407_10312701
393 Ga0307407_10708372
394 Ga0307412_10545171
395 Ga0307409_100389782
396 Ga0307409_100610395
397 Ga0307409_101096302
398 Ga0307416_100177469
399 Ga0307416_103523315
400 Ga0307414_10211429
401 Ga0307411_10096844
402 Ga0307411_10100379
403 Ga0307411_10145440
404 Ga0307415_100005531
405 Ga0307415_100191653
406 Ga0307507_10523089
407 Ga0373950_0000014
408 Ga0373950_0000049
409 Ga0373934_0012069
410 Ga0373923_0651741
411 Ga0373945_0374272
412 Ga0373954_0197040
413 Ga0373956_0486967
414 Ga0373957_0111980
415 Ga0373943_0117587
416 Ga0373955_0063240
417 Ga0373931_0848474
418 Ga0373935_0256094
419 Ga0373933_0000126
420 Ga0373937_0008210
421 Ga0373937_0187868
422 Ga0373937_1699545
423 Ga0373925_1325435
424 Ga0395900_1828984
425 Ga0395905_0655539
426 Ga0439436_0062114
427 Ga0439439_0001062
428 Ga0451798_0357423
429 Ga0451800_1087815
430 Ga0451853_1059096
431 Ga0451853_3821866
432 Ga0439462_0153859
433 Ga0439446_0007977
434 Ga0439446_0154481
435 Ga0451576_0049089
436 Ga0451576_1022399
437 Ga0495629_1037845
438 Ga0495628_0417678
439 Ga0495635_0556348
440 Ga0495604_0104831
441 Ga0495680_0825861
442 Ga0496103_0384595
443 Ga0496104_1375273
444 Ga0496106_0171510
445 Ga0496107_0190538
446 Ga0496109_0810492
447 Ga0496114_0006321
448 Ga0496114_1316927
449 Ga0496115_0026459
450 Ga0501034_0002939
451 Ga0501036_0001732
452 Ga0501036_0148318
453 Ga0501036_0448879
454 Ga0501038_0027821
455 Ga0501038_0959755
456 Ga0501039_0949464
457 Ga0501040_0761917
458 Ga0501040_0934450
459 Ga0501042_0543688
460 Ga0501042_0704586
461 Ga0501043_0078015
462 Ga0501043_0430978
463 Ga0501046_0002493
464 Ga0501046_0148871
465 Ga0501047_0000831
466 Ga0501047_0509542
467 Ga0501048_0000791
468 Ga0501048_0046677
469 Ga0501067_0000007
470 Ga0501069_0362318
471 Ga0501070_0089389
472 Ga0501071_0489485
473 Ga0501072_0000019
474 Ga0501073_0004065
475 Ga0501073_0005815
476 Ga0501074_0002037
477 Ga0501074_0664244
478 Ga0501076_0113798
479 Ga0501077_0447802
480 Ga0501258_067995
481 Ga0501079_0000435
482 Ga0501080_0017823
483 Ga0501080_0623533
484 Ga0501080_0744210
485 Ga0501080_1091500
486 Ga0501083_0010391
487 Ga0501035_0763608
488 Ga0501044_0529532
489 nmdc:mga05p37_135388_c1
490 nmdc:mga05p37_912129_c1
491 nmdc:mga09592_34668_c1
492 nmdc:mga0qj67_2233_c1
493 nmdc:mga0qj67_384903_c1
494 nmdc:mga06r32_28913_c1
495 nmdc:mga08y16_439_c1
496 nmdc:mga08y16_59639_c1
497 nmdc:mga0n895_30985_c1
498 nmdc:mga0a205_1225_c1
499 Ga0501084_0000075
500 Ga0501084_0712315
501 Ga0501082_0007794
502 Ga0501082_0073762

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06127

Mpo1-like

2-hydroxy-palmitic acid dioxygenase Mpo1-like

21

117

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6s1k-assembly1.cif.gz_E e. coli core signaling unit, carrying qqqq receptor mutation 0.5382 11 100
6h2f-assembly1.cif.gz_A structure of the pre-pore ahlb of the tripartite alpha-pore forming toxin, ahl, from aeromonas hydrophila. 0.5371 7 99
6s1k-assembly1.cif.gz_E e. coli core signaling unit, carrying qqqq receptor mutation 0.4842 11 100
6s1k-assembly1.cif.gz_I e. coli core signaling unit, carrying qqqq receptor mutation 0.4819 3 100
6s1k-assembly1.cif.gz_I e. coli core signaling unit, carrying qqqq receptor mutation 0.4691 3 100
ID Description Score Start End Superfamily
af_A0A1D6I862_132_224_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.6818 27 76 1.20.1280.290
af_Q0IZQ3_71_212_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6041 23 96 1.20.1250.20
af_Q7JZW3_1_100_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.5992 23 96 1.20.120.350
3e6sF00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.5819 8 85 1.20.1260.10
4zkhB00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.5774 8 85 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A3C1WEP4-F1-model_v4 DUF962 domain-containing protein 0.9918 1 100 GO:0016020
AF-A0A136KAY9-F1-model_v4 deleted 0.989 1 96
AF-A0A2V8SS57-F1-model_v4 DUF962 domain-containing protein 0.9822 1 98 GO:0016020
AF-A0A059XA65-F1-model_v4 DUF962 domain-containing protein 0.9781 1 100 GO:0016020
AF-A0A250K2M9-F1-model_v4 DUF962 domain-containing protein 0.9778 1 100

Map