F362628

General Info

Members Datasets Scaffolds Average Seq Length
251 140 502 162

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0148688|Ga0453684_0148688_161_655
Length 164
Sequence MREQDWPAVKRIYEEGIATGHSTFQAAAPETWEQFQAGKVAGCSLVATDADGACVGWVVLSPTSARPVYAGVTELSVYIAQAARGRGVGTALLKAAIAASEDKGIWTLCSGTFPENVASVRLQLAHGFRIVGTRERIGLMGHGPLAGCWRDLLLLERRSGRVGG

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
102 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
103 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
104 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
105 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
106 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
107 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
108 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
109 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
110 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
111 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
112 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
113 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
114 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
115 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
116 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
117 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
118 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
119 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
120 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
121 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
122 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
123 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
124 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
125 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
126 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
127 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
128 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
129 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
130 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
131 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
132 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
133 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
134 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
138 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
139 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
140 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.99
Rhizosphere 97.61
Stem 0
Stem Tuber 0
Unclassified 31.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0148688 3300044712 Unclassified 2787
2 CNAas_1000345 3300000532 Bacteria 4409
3 rootL2_10161459 3300003322 Unclassified 3370
4 Ga0065712_10083357 3300005290 Bacteria 2843
5 Ga0065712_10478652 3300005290 Bacteria 665
6 Ga0065715_10099210 3300005293 Bacteria 3442
7 Ga0065715_10118223 3300005293 Bacteria 2322
8 Ga0065715_10601309 3300005293 Unclassified 707
9 Ga0065707_10612736 3300005295 Unclassified 683
10 Ga0070690_100075950 3300005330 Unclassified 2191
11 Ga0070670_100079448 3300005331 Bacteria 2819
12 Ga0070670_100459995 3300005331 Unclassified 1128
13 Ga0068869_100025731 3300005334 Bacteria 4090
14 Ga0068869_100079105 3300005334 Bacteria 2450
15 Ga0068869_100144794 3300005334 Bacteria 1838
16 Ga0068869_100448881 3300005334 Bacteria 1069
17 Ga0070689_100002208 3300005340 Bacteria 12619
18 Ga0070689_100604561 3300005340 Bacteria 950
19 Ga0070692_10053292 3300005345 Bacteria 2109
20 Ga0070669_100116035 3300005353 Bacteria 2037
21 Ga0070669_100773199 3300005353 Unclassified 815
22 Ga0070673_100019367 3300005364 Bacteria 4884
23 Ga0070673_100433618 3300005364 Bacteria 1180
24 Ga0070659_100065760 3300005366 Unclassified 2872
25 Ga0070659_101473875 3300005366 Bacteria 606
26 Ga0070705_100031293 3300005440 Bacteria 2945
27 Ga0070705_100122883 3300005440 Bacteria 1679
28 Ga0070700_100076545 3300005441 Bacteria 2149
29 Ga0070694_100021749 3300005444 Bacteria 4104
30 Ga0070694_100343506 3300005444 Bacteria 1154
31 Ga0070678_101822088 3300005456 Bacteria 574
32 Ga0068867_100015835 3300005459 Bacteria 5352
33 Ga0068867_100343325 3300005459 Bacteria 1244
34 Ga0070685_10059720 3300005466 Unclassified 2227
35 Ga0070706_100000030 3300005467 Bacteria 153754
36 Ga0070707_100320643 3300005468 Unclassified 1506
37 Ga0070698_100075965 3300005471 Bacteria 3363
38 Ga0070695_100175005 3300005545 Bacteria 1517
39 Ga0070696_100049682 3300005546 Bacteria 2914
40 Ga0070696_100330626 3300005546 Unclassified 1175
41 Ga0070693_100030956 3300005547 Bacteria 2930
42 Ga0070693_100216803 3300005547 Unclassified 1252
43 Ga0070693_100306270 3300005547 Bacteria 1073
44 Ga0070693_100346374 3300005547 Bacteria 1016
45 Ga0070704_100014108 3300005549 Bacteria 4982
46 Ga0070704_100015455 3300005549 Bacteria 4794
47 Ga0070664_100276724 3300005564 Bacteria 1513
48 Ga0068857_100041893 3300005577 Bacteria 4060
49 Ga0068857_100500964 3300005577 Bacteria 1140
50 Ga0068857_101023360 3300005577 Bacteria 796
51 Ga0068854_100275344 3300005578 Unclassified 1353
52 Ga0068854_100481899 3300005578 Bacteria 1042
53 Ga0068856_100452279 3300005614 Bacteria 1305
54 Ga0070702_100115219 3300005615 Bacteria 1674
55 Ga0070702_100513778 3300005615 Unclassified 882
56 Ga0070702_101244090 3300005615 Unclassified 602
57 Ga0068859_100016557 3300005617 Bacteria 7402
58 Ga0068859_100022319 3300005617 Bacteria 6346
59 Ga0068859_100087448 3300005617 Bacteria 3164
60 Ga0068859_100132980 3300005617 Bacteria 2560
61 Ga0068859_100454212 3300005617 Bacteria 1377
62 Ga0068859_100600673 3300005617 Bacteria 1193
63 Ga0068864_100007029 3300005618 Bacteria 9238
64 Ga0068864_100020161 3300005618 Bacteria 5577
65 Ga0068864_100054476 3300005618 Bacteria 3452
66 Ga0068864_100249583 3300005618 Bacteria 1647
67 Ga0068861_100058240 3300005719 Bacteria 2954
68 Ga0068861_100575415 3300005719 Bacteria 1030
69 Ga0068870_10237620 3300005840 Bacteria 1123
70 Ga0068870_10373922 3300005840 Bacteria 920
71 Ga0068863_100053934 3300005841 Bacteria 3810
72 Ga0068863_100174330 3300005841 Unclassified 2064
73 Ga0068863_100300639 3300005841 Bacteria 1557
74 Ga0068863_100645214 3300005841 Bacteria 1050
75 Ga0068863_100996098 3300005841 Bacteria 841
76 Ga0068860_100044654 3300005843 Bacteria 4223
77 Ga0068860_100172156 3300005843 Bacteria 2091
78 Ga0068860_100352763 3300005843 Unclassified 1448
79 Ga0068860_100598763 3300005843 Bacteria 1107
80 Ga0068862_100081607 3300005844 Bacteria 2805
81 Ga0068862_100964933 3300005844 Unclassified 841
82 Ga0081539_10004088 3300005985 Bacteria 16676
83 Ga0097621_100147469 3300006237 Bacteria 2016
84 Ga0075428_100988330 3300006844 Bacteria 891
85 Ga0075430_100142850 3300006846 Unclassified 1993
86 Ga0075431_100114536 3300006847 Unclassified 2783
87 Ga0075433_10011109 3300006852 Bacteria 7242
88 Ga0075433_10033750 3300006852 Bacteria 4389
89 Ga0075433_10755244 3300006852 Unclassified 851
90 Ga0075434_100392580 3300006871 Bacteria 1408
91 Ga0075436_100001367 3300006914 Bacteria 16612
92 Ga0097620_100016556 3300006931 Bacteria 7402
93 Ga0097620_100022319 3300006931 Bacteria 6346
94 Ga0097620_100087447 3300006931 Bacteria 3164
95 Ga0097620_100132987 3300006931 Bacteria 2560
96 Ga0097620_100454214 3300006931 Bacteria 1377
97 Ga0097620_100600685 3300006931 Bacteria 1193
98 Ga0105251_10168794 3300009011 Bacteria 986
99 Ga0105240_10112063 3300009093 Bacteria 3299
100 Ga0105247_10053723 3300009101 Bacteria 2485
101 Ga0105247_10324699 3300009101 Bacteria 1075
102 Ga0105247_10802235 3300009101 Unclassified 718
103 Ga0114129_10043841 3300009147 Bacteria 6294
104 Ga0114129_10892768 3300009147 Bacteria 1127
105 Ga0114129_11619705 3300009147 Bacteria 792
106 Ga0105243_10002954 3300009148 Bacteria 14057
107 Ga0105243_10343387 3300009148 Bacteria 1368
108 Ga0105243_10822048 3300009148 Bacteria 918
109 Ga0105241_10030457 3300009174 Bacteria 4033
110 Ga0105241_10104926 3300009174 Bacteria 2253
111 Ga0105241_10259985 3300009174 Unclassified 1475
112 Ga0105241_10507406 3300009174 Unclassified 1076
113 Ga0105241_10509811 3300009174 Bacteria 1074
114 Ga0105241_10745010 3300009174 Unclassified 898
115 Ga0105241_11970875 3300009174 Bacteria 574
116 Ga0105242_10068615 3300009176 Bacteria 2934
117 Ga0105242_10183995 3300009176 Bacteria 1845
118 Ga0105248_10007433 3300009177 Bacteria 12020
119 Ga0105248_10067826 3300009177 Bacteria 4005
120 Ga0105248_10290222 3300009177 Bacteria 1842
121 Ga0105248_10370475 3300009177 Bacteria 1612
122 Ga0105248_10805012 3300009177 Bacteria 1061
123 Ga0105237_10138220 3300009545 Bacteria 2431
124 Ga0105237_10470762 3300009545 Bacteria 1262
125 Ga0105238_10043845 3300009551 Bacteria 4525
126 Ga0105238_10457208 3300009551 Bacteria 1274
127 Ga0105249_12200581 3300009553 Unclassified 624
128 Ga0105239_10691733 3300010375 Unclassified 1166
129 Ga0105239_10854724 3300010375 Bacteria 1044
130 Ga0105246_10031574 3300011119 Unclassified 3506
131 Ga0105246_10057243 3300011119 Bacteria 2697
132 Ga0105246_10648599 3300011119 Bacteria 919
133 Ga0105246_10867024 3300011119 Bacteria 807
134 Ga0105246_11912376 3300011119 Unclassified 570
135 Ga0157373_10054739 3300013100 Bacteria 2834
136 Ga0157373_10702609 3300013100 Bacteria 741
137 Ga0163162_10369321 3300013306 Bacteria 1568
138 Ga0163162_10849019 3300013306 Bacteria 1028
139 Ga0157372_10733943 3300013307 Bacteria 1149
140 Ga0157375_10647594 3300013308 Bacteria 1213
141 Ga0157375_11999477 3300013308 Unclassified 689
142 Ga0163163_10035763 3300014325 Unclassified 4821
143 Ga0163163_10205018 3300014325 Unclassified 2020
144 Ga0163163_10645399 3300014325 Bacteria 1122
145 Ga0157380_10002106 3300014326 Bacteria 13345
146 Ga0157377_10163408 3300014745 Unclassified 1386
147 Ga0157379_10006162 3300014968 Bacteria 10326
148 Ga0157379_10196746 3300014968 Bacteria 1822
149 Ga0157379_10711869 3300014968 Bacteria 943
150 Ga0163161_10527937 3300017792 Bacteria 965
151 Ga0207710_10023777 3300025900 Bacteria 2634
152 Ga0207710_10074465 3300025900 Bacteria 1563
153 Ga0207710_10283519 3300025900 Bacteria 834
154 Ga0207643_10247796 3300025908 Bacteria 1097
155 Ga0207643_10324730 3300025908 Unclassified 962
156 Ga0207684_10000089 3300025910 Bacteria 172593
157 Ga0207654_10035603 3300025911 Bacteria 2775
158 Ga0207654_10043068 3300025911 Bacteria 2557
159 Ga0207654_10310157 3300025911 Bacteria 1075
160 Ga0207695_10166714 3300025913 Bacteria 2130
161 Ga0207660_10147010 3300025917 Bacteria 1807
162 Ga0207662_10560586 3300025918 Unclassified 792
163 Ga0207681_10037859 3300025923 Unclassified 3191
164 Ga0207694_10027277 3300025924 Bacteria 4349
165 Ga0207694_10448084 3300025924 Bacteria 1077
166 Ga0207650_10229643 3300025925 Bacteria 1496
167 Ga0207650_10742439 3300025925 Unclassified 830
168 Ga0207690_10035498 3300025932 Unclassified 3221
169 Ga0207686_10000216 3300025934 Bacteria 43993
170 Ga0207709_10007385 3300025935 Bacteria 6123
171 Ga0207709_10125762 3300025935 Bacteria 1739
172 Ga0207670_10002834 3300025936 Bacteria 9147
173 Ga0207670_11123935 3300025936 Bacteria 664
174 Ga0207704_10930434 3300025938 Unclassified 732
175 Ga0207691_10317776 3300025940 Unclassified 1335
176 Ga0207711_10072152 3300025941 Bacteria 2999
177 Ga0207711_10435346 3300025941 Bacteria 1220
178 Ga0207711_10470059 3300025941 Bacteria 1171
179 Ga0207711_10538441 3300025941 Bacteria 1089
180 Ga0207689_10068800 3300025942 Bacteria 2909
181 Ga0207689_10091048 3300025942 Bacteria 2506
182 Ga0207689_10119774 3300025942 Bacteria 2166
183 Ga0207689_10135568 3300025942 Bacteria 2027
184 Ga0207679_10598379 3300025945 Unclassified 993
185 Ga0207651_10224545 3300025960 Bacteria 1521
186 Ga0207651_10305099 3300025960 Bacteria 1325
187 Ga0207640_10334274 3300025981 Unclassified 1211
188 Ga0207708_10194745 3300026075 Bacteria 1615
189 Ga0207702_10428720 3300026078 Bacteria 1280
190 Ga0207641_10181535 3300026088 Bacteria 1928
191 Ga0207641_10436618 3300026088 Bacteria 1263
192 Ga0207641_10599782 3300026088 Bacteria 1078
193 Ga0207648_10070185 3300026089 Bacteria 3054
194 Ga0207648_10591121 3300026089 Bacteria 1022
195 Ga0207676_10084571 3300026095 Bacteria 2586
196 Ga0207676_10100103 3300026095 Bacteria 2400
197 Ga0207676_10153741 3300026095 Bacteria 1984
198 Ga0207676_10472346 3300026095 Bacteria 1186
199 Ga0207674_10010415 3300026116 Bacteria 10534
200 Ga0207674_10040419 3300026116 Bacteria 4831
201 Ga0207674_10158244 3300026116 Bacteria 2220
202 Ga0207674_10356715 3300026116 Unclassified 1413
203 Ga0207683_11188560 3300026121 Unclassified 707
204 Ga0268265_10061504 3300028380 Unclassified 2882
205 Ga0268265_10205906 3300028380 Bacteria 1710
206 Ga0268264_10162344 3300028381 Bacteria 2014
207 Ga0268264_10187216 3300028381 Bacteria 1884
208 Ga0307414_11693648 3300032004 Bacteria 590
209 Ga0451576_1178041 3300045051 Unclassified 801
210 Ga0495643_0176832 3300046522 Bacteria 1040
211 Ga0495672_0034003 3300047320 Bacteria 3154
212 Ga0496106_0622040 3300048909 Unclassified 864
213 Ga0496107_0126384 3300048910 Bacteria 1886
214 Ga0496108_1580018 3300048911 Unclassified 543
215 Ga0496110_0144427 3300048913 Bacteria 2152
216 Ga0496111_1004434 3300048914 Unclassified 598
217 Ga0501291_002856 3300049514 Unclassified 2107
218 Ga0501067_0096441 3300049583 Unclassified 1642
219 Ga0501202_011128 3300049652 Unclassified 1681
220 Ga0501209_053015 3300049656 Unclassified 1112
221 Ga0501217_008790 3300049661 Unclassified 2188
222 Ga0501223_004200 3300049663 Unclassified 3104
223 Ga0501224_018558 3300049664 Unclassified 1036
224 Ga0501227_102840 3300049665 Unclassified 761
225 Ga0501230_011077 3300049667 Unclassified 1422
226 Ga0501233_004999 3300049668 Unclassified 2453
227 Ga0501236_008796 3300049670 Unclassified 1291
228 Ga0501240_020482 3300049673 Unclassified 990
229 Ga0501247_010507 3300049677 Unclassified 1104
230 Ga0501249_046645 3300049679 Unclassified 990
231 Ga0501257_008077 3300049686 Unclassified 2360
232 Ga0501259_080113 3300049688 Unclassified 716
233 Ga0501221_028285 3300049704 Unclassified 1152
234 Ga0501225_0048002 3300049705 Unclassified 1185
235 Ga0501245_009456 3300049708 Unclassified 1400
236 Ga0501268_009920 3300049765 Unclassified 1473
237 Ga0501279_031314 3300049775 Unclassified 790
238 Ga0501283_006489 3300049779 Unclassified 1640
239 Ga0501212_002588 3300049851 Unclassified 2196
240 nmdc:mga05p37_89365_c1 3300050507 Bacteria 3796
241 nmdc:mga09592_112482_c1 3300050508 Unclassified 2336
242 nmdc:mga09592_750689_c1 3300050508 Unclassified 828
243 nmdc:mga08y16_319295_c1 3300050511 Bacteria 1599
244 nmdc:mga0n895_1051936_c1 3300050512 Unclassified 793
245 nmdc:mga0n895_1698221_c1 3300050512 Unclassified 594
246 nmdc:mga08x19_1126_c1 3300050514 Bacteria 16648
247 nmdc:mga0a205_179752_c1 3300050515 Bacteria 2010
248 nmdc:mga0a205_301654_c1 3300050515 Unclassified 1475
249 nmdc:mga0a205_318730_c1 3300050515 Unclassified 1426
250 Ga0495619_0702347 3300053085 Unclassified 688
251 Ga0530510_0847382 3300061734 Unclassified 698
252 Ga0453684_0148688
253 CNAas_1000345
254 rootL2_10161459
255 Ga0065712_10083357
256 Ga0065712_10478652
257 Ga0065715_10099210
258 Ga0065715_10118223
259 Ga0065715_10601309
260 Ga0065707_10612736
261 Ga0070690_100075950
262 Ga0070670_100079448
263 Ga0070670_100459995
264 Ga0068869_100025731
265 Ga0068869_100079105
266 Ga0068869_100144794
267 Ga0068869_100448881
268 Ga0070689_100002208
269 Ga0070689_100604561
270 Ga0070692_10053292
271 Ga0070669_100116035
272 Ga0070669_100773199
273 Ga0070673_100019367
274 Ga0070673_100433618
275 Ga0070659_100065760
276 Ga0070659_101473875
277 Ga0070705_100031293
278 Ga0070705_100122883
279 Ga0070700_100076545
280 Ga0070694_100021749
281 Ga0070694_100343506
282 Ga0070678_101822088
283 Ga0068867_100015835
284 Ga0068867_100343325
285 Ga0070685_10059720
286 Ga0070706_100000030
287 Ga0070707_100320643
288 Ga0070698_100075965
289 Ga0070695_100175005
290 Ga0070696_100049682
291 Ga0070696_100330626
292 Ga0070693_100030956
293 Ga0070693_100216803
294 Ga0070693_100306270
295 Ga0070693_100346374
296 Ga0070704_100014108
297 Ga0070704_100015455
298 Ga0070664_100276724
299 Ga0068857_100041893
300 Ga0068857_100500964
301 Ga0068857_101023360
302 Ga0068854_100275344
303 Ga0068854_100481899
304 Ga0068856_100452279
305 Ga0070702_100115219
306 Ga0070702_100513778
307 Ga0070702_101244090
308 Ga0068859_100016557
309 Ga0068859_100022319
310 Ga0068859_100087448
311 Ga0068859_100132980
312 Ga0068859_100454212
313 Ga0068859_100600673
314 Ga0068864_100007029
315 Ga0068864_100020161
316 Ga0068864_100054476
317 Ga0068864_100249583
318 Ga0068861_100058240
319 Ga0068861_100575415
320 Ga0068870_10237620
321 Ga0068870_10373922
322 Ga0068863_100053934
323 Ga0068863_100174330
324 Ga0068863_100300639
325 Ga0068863_100645214
326 Ga0068863_100996098
327 Ga0068860_100044654
328 Ga0068860_100172156
329 Ga0068860_100352763
330 Ga0068860_100598763
331 Ga0068862_100081607
332 Ga0068862_100964933
333 Ga0081539_10004088
334 Ga0097621_100147469
335 Ga0075428_100988330
336 Ga0075430_100142850
337 Ga0075431_100114536
338 Ga0075433_10011109
339 Ga0075433_10033750
340 Ga0075433_10755244
341 Ga0075434_100392580
342 Ga0075436_100001367
343 Ga0097620_100016556
344 Ga0097620_100022319
345 Ga0097620_100087447
346 Ga0097620_100132987
347 Ga0097620_100454214
348 Ga0097620_100600685
349 Ga0105251_10168794
350 Ga0105240_10112063
351 Ga0105247_10053723
352 Ga0105247_10324699
353 Ga0105247_10802235
354 Ga0114129_10043841
355 Ga0114129_10892768
356 Ga0114129_11619705
357 Ga0105243_10002954
358 Ga0105243_10343387
359 Ga0105243_10822048
360 Ga0105241_10030457
361 Ga0105241_10104926
362 Ga0105241_10259985
363 Ga0105241_10507406
364 Ga0105241_10509811
365 Ga0105241_10745010
366 Ga0105241_11970875
367 Ga0105242_10068615
368 Ga0105242_10183995
369 Ga0105248_10007433
370 Ga0105248_10067826
371 Ga0105248_10290222
372 Ga0105248_10370475
373 Ga0105248_10805012
374 Ga0105237_10138220
375 Ga0105237_10470762
376 Ga0105238_10043845
377 Ga0105238_10457208
378 Ga0105249_12200581
379 Ga0105239_10691733
380 Ga0105239_10854724
381 Ga0105246_10031574
382 Ga0105246_10057243
383 Ga0105246_10648599
384 Ga0105246_10867024
385 Ga0105246_11912376
386 Ga0157373_10054739
387 Ga0157373_10702609
388 Ga0163162_10369321
389 Ga0163162_10849019
390 Ga0157372_10733943
391 Ga0157375_10647594
392 Ga0157375_11999477
393 Ga0163163_10035763
394 Ga0163163_10205018
395 Ga0163163_10645399
396 Ga0157380_10002106
397 Ga0157377_10163408
398 Ga0157379_10006162
399 Ga0157379_10196746
400 Ga0157379_10711869
401 Ga0163161_10527937
402 Ga0207710_10023777
403 Ga0207710_10074465
404 Ga0207710_10283519
405 Ga0207643_10247796
406 Ga0207643_10324730
407 Ga0207684_10000089
408 Ga0207654_10035603
409 Ga0207654_10043068
410 Ga0207654_10310157
411 Ga0207695_10166714
412 Ga0207660_10147010
413 Ga0207662_10560586
414 Ga0207681_10037859
415 Ga0207694_10027277
416 Ga0207694_10448084
417 Ga0207650_10229643
418 Ga0207650_10742439
419 Ga0207690_10035498
420 Ga0207686_10000216
421 Ga0207709_10007385
422 Ga0207709_10125762
423 Ga0207670_10002834
424 Ga0207670_11123935
425 Ga0207704_10930434
426 Ga0207691_10317776
427 Ga0207711_10072152
428 Ga0207711_10435346
429 Ga0207711_10470059
430 Ga0207711_10538441
431 Ga0207689_10068800
432 Ga0207689_10091048
433 Ga0207689_10119774
434 Ga0207689_10135568
435 Ga0207679_10598379
436 Ga0207651_10224545
437 Ga0207651_10305099
438 Ga0207640_10334274
439 Ga0207708_10194745
440 Ga0207702_10428720
441 Ga0207641_10181535
442 Ga0207641_10436618
443 Ga0207641_10599782
444 Ga0207648_10070185
445 Ga0207648_10591121
446 Ga0207676_10084571
447 Ga0207676_10100103
448 Ga0207676_10153741
449 Ga0207676_10472346
450 Ga0207674_10010415
451 Ga0207674_10040419
452 Ga0207674_10158244
453 Ga0207674_10356715
454 Ga0207683_11188560
455 Ga0268265_10061504
456 Ga0268265_10205906
457 Ga0268264_10162344
458 Ga0268264_10187216
459 Ga0307414_11693648
460 Ga0451576_1178041
461 Ga0495643_0176832
462 Ga0495672_0034003
463 Ga0496106_0622040
464 Ga0496107_0126384
465 Ga0496108_1580018
466 Ga0496110_0144427
467 Ga0496111_1004434
468 Ga0501291_002856
469 Ga0501067_0096441
470 Ga0501202_011128
471 Ga0501209_053015
472 Ga0501217_008790
473 Ga0501223_004200
474 Ga0501224_018558
475 Ga0501227_102840
476 Ga0501230_011077
477 Ga0501233_004999
478 Ga0501236_008796
479 Ga0501240_020482
480 Ga0501247_010507
481 Ga0501249_046645
482 Ga0501257_008077
483 Ga0501259_080113
484 Ga0501221_028285
485 Ga0501225_0048002
486 Ga0501245_009456
487 Ga0501268_009920
488 Ga0501279_031314
489 Ga0501283_006489
490 Ga0501212_002588
491 nmdc:mga05p37_89365_c1
492 nmdc:mga09592_112482_c1
493 nmdc:mga09592_750689_c1
494 nmdc:mga08y16_319295_c1
495 nmdc:mga0n895_1051936_c1
496 nmdc:mga0n895_1698221_c1
497 nmdc:mga08x19_1126_c1
498 nmdc:mga0a205_179752_c1
499 nmdc:mga0a205_301654_c1
500 nmdc:mga0a205_318730_c1
501 Ga0495619_0702347
502 Ga0530510_0847382

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

6

128

0.79

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

1

129

0.76

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

41

130

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vhs-assembly1.cif.gz_A crystal structure of a putative phosphinothricin n-acetyltransferase 0.9241 2 158
1yr0-assembly2.cif.gz_D crystal structure of phosphinothricin acetyltransferase from agrobacterium tumefaciens 0.9232 2 158
5t7d-assembly1.cif.gz_A crystal structure of streptomyces hygroscopicus bialaphos resistance (bar) protein in complex with acetyl coenzyme a 0.9221 4 158
5jtf-assembly1.cif.gz_B crystal structure of arsn n-acetyltransferase from pseudomonas putida kt2440 0.917 2 158
3dr8-assembly1.cif.gz_A structure of ynca, a putative acetyltransferase from salmonella typhimurium with its cofactor acetyl-coa 0.9105 1 158
ID Description Score Start End Superfamily
af_C7IYZ1_1_59_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9447 111 159 3.40.630.30
af_A0A1D6QIS1_205_278_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9211 95 158 3.40.630.30
5dwmA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9157 1 165 3.40.630.30
4mbuB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9107 4 158 3.40.630.30
5dwmA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9105 1 165 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A538FGT3-F1-model_v4 N-acetyltransferase family protein 0.9932 6 135 GO:0016747
AF-A0A1I5YB06-F1-model_v4 Phosphinothricin acetyltransferase 0.9931 3 162 GO:0016747
AF-A0A4R4SN75-F1-model_v4 N-acetyltransferase family protein 0.9916 2 161 GO:0016747
AF-A0A2I0P5V1-F1-model_v4 N-acetyltransferase domain-containing protein 0.9907 3 163 GO:0016747
AF-A0A841DDH6-F1-model_v4 L-amino acid N-acyltransferase YncA 0.9896 3 163 GO:0016747

Map