F362449

General Info

Members Datasets Scaffolds Average Seq Length
251 144 502 167

Family's Representative Sequence

Representative Sequence 3300025315|Ga0207697_10138252|Ga0207697_101382521
Length 202
Sequence VTPKSSSVTLRETPVQAASVSGPLVVHAESLLVQTGKRIELVDITDVVMERVRQSGVREGMASLWSMHTTCALFINEAQKALHADIMRVLEQVVDRDAEWQHNDPQHSDCDRMNADSHLRAMLLGHSVTLQISAGEPVLGQWQRVLVAELDGPRAGEVLVVLASPAPARMADLDLETHRAIVAGRAGTGTRFAWNRSLRSSA

Samples

Sample ID Description Type Environment
1 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
71 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
72 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
73 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
74 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
78 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
79 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
80 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
81 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
82 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
83 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
84 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
85 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
86 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
87 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
88 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
89 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
90 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
91 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
92 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
93 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
94 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
97 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
98 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
99 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
100 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
101 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
102 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
103 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
104 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
105 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
106 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
107 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
108 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
109 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
114 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
115 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
116 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
117 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
118 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
119 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
120 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
121 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
122 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
123 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
124 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
125 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
128 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
130 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
131 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
132 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
133 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
134 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
135 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
136 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
137 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
138 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
139 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
140 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
141 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
142 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
143 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
144 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.4
Nodule 0
Rhizoplane 5.18
Rhizosphere 94.02
Stem 0
Stem Tuber 0
Unclassified 17.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207697_10138252 3300025315 Bacteria 1055
2 MRS1b_contig_7053365 2162886011 Bacteria 949
3 Ga0065712_10071169 3300005290 Bacteria 5443
4 Ga0065715_10107001 3300005293 Bacteria 2796
5 Ga0065707_10084922 3300005295 Bacteria 6632
6 Ga0070683_100003796 3300005329 Bacteria 12336
7 Ga0070670_100871725 3300005331 Bacteria 815
8 Ga0070677_10368630 3300005333 Bacteria 749
9 Ga0070689_100527081 3300005340 Bacteria 1015
10 Ga0070661_100102731 3300005344 Bacteria 2128
11 Ga0070668_100237683 3300005347 Bacteria 1508
12 Ga0070668_100844236 3300005347 Unclassified 816
13 Ga0070669_100003506 3300005353 Bacteria 11310
14 Ga0070669_100416806 3300005353 Bacteria 1101
15 Ga0070675_100094637 3300005354 Bacteria 2507
16 Ga0070688_100221668 3300005365 Bacteria 1333
17 Ga0070667_100144937 3300005367 Bacteria 2082
18 Ga0070701_10091215 3300005438 Unclassified 1670
19 Ga0070701_10208893 3300005438 Unclassified 1158
20 Ga0070701_10210435 3300005438 Unclassified 1154
21 Ga0070694_100037457 3300005444 Bacteria 3217
22 Ga0070694_100396759 3300005444 Bacteria 1079
23 Ga0070663_100015108 3300005455 Bacteria 4972
24 Ga0070707_101306403 3300005468 Unclassified 692
25 Ga0070698_100225578 3300005471 Bacteria 1807
26 Ga0070698_100533907 3300005471 Bacteria 1112
27 Ga0070684_100002103 3300005535 Bacteria 14661
28 Ga0070672_100189374 3300005543 Bacteria 1717
29 Ga0070686_100030981 3300005544 Bacteria 3267
30 Ga0070686_100638233 3300005544 Bacteria 843
31 Ga0070695_100001675 3300005545 Bacteria 12485
32 Ga0070696_100542232 3300005546 Bacteria 931
33 Ga0070696_100543344 3300005546 Bacteria 930
34 Ga0070693_100031360 3300005547 Bacteria 2912
35 Ga0070704_100002643 3300005549 Bacteria 10113
36 Ga0070704_100097860 3300005549 Bacteria 2203
37 Ga0070664_100013660 3300005564 Bacteria 6618
38 Ga0068857_100251577 3300005577 Unclassified 1620
39 Ga0068859_100757119 3300005617 Bacteria 1060
40 Ga0068862_100050500 3300005844 Bacteria 3555
41 Ga0075366_10245396 3300006195 Unclassified 1092
42 Ga0075428_100000086 3300006844 Bacteria 77110
43 Ga0075428_100162339 3300006844 Bacteria 2425
44 Ga0075430_100000028 3300006846 Bacteria 74712
45 Ga0075430_100008967 3300006846 Bacteria 8451
46 Ga0075430_100198403 3300006846 Bacteria 1667
47 Ga0075430_100899728 3300006846 Bacteria 729
48 Ga0075431_100002556 3300006847 Bacteria 17557
49 Ga0075431_100011426 3300006847 Bacteria 8948
50 Ga0075431_100059201 3300006847 Bacteria 3954
51 Ga0075431_100325023 3300006847 Bacteria 1550
52 Ga0075431_101324668 3300006847 Unclassified 681
53 Ga0075433_10013585 3300006852 Bacteria 6628
54 Ga0075433_10040096 3300006852 Bacteria 4052
55 Ga0075433_10180601 3300006852 Unclassified 1878
56 Ga0075434_100005852 3300006871 Bacteria 11231
57 Ga0075434_100045127 3300006871 Bacteria 4372
58 Ga0075434_100049220 3300006871 Bacteria 4184
59 Ga0075434_100504134 3300006871 Unclassified 1231
60 Ga0075429_100007122 3300006880 Bacteria 9714
61 Ga0075429_100050717 3300006880 Bacteria 3611
62 Ga0075436_100004018 3300006914 Bacteria 10094
63 Ga0075436_100049925 3300006914 Bacteria 2887
64 Ga0097620_100757245 3300006931 Bacteria 1060
65 Ga0075435_100002059 3300007076 Bacteria 13182
66 Ga0075435_100034220 3300007076 Bacteria 4024
67 Ga0111539_10004018 3300009094 Bacteria 19307
68 Ga0111539_10071911 3300009094 Bacteria 4080
69 Ga0111539_10218643 3300009094 Bacteria 2219
70 Ga0111539_11427785 3300009094 Bacteria 803
71 Ga0114129_10014496 3300009147 Bacteria 11235
72 Ga0114129_10015571 3300009147 Bacteria 10810
73 Ga0114129_10020475 3300009147 Bacteria 9409
74 Ga0114129_10076439 3300009147 Bacteria 4661
75 Ga0114129_10113908 3300009147 Bacteria 3729
76 Ga0114129_11794433 3300009147 Bacteria 746
77 Ga0105248_10107324 3300009177 Bacteria 3149
78 Ga0105248_10114565 3300009177 Bacteria 3041
79 Ga0105249_10001013 3300009553 Bacteria 24888
80 Ga0105249_10069695 3300009553 Bacteria 3246
81 Ga0157374_10055119 3300013296 Bacteria 3710
82 Ga0157378_11372514 3300013297 Bacteria 749
83 Ga0157375_11629448 3300013308 Unclassified 763
84 Ga0157377_10016726 3300014745 Unclassified 3777
85 Ga0157377_10927752 3300014745 Bacteria 653
86 Ga0157376_10189929 3300014969 Unclassified 1883
87 Ga0157376_10323032 3300014969 Bacteria 1468
88 Ga0207649_10936524 3300025920 Bacteria 680
89 Ga0207646_11047994 3300025922 Unclassified 719
90 Ga0207681_10009073 3300025923 Bacteria 6075
91 Ga0207681_10471305 3300025923 Bacteria 1024
92 Ga0207650_10595888 3300025925 Bacteria 929
93 Ga0207687_10616501 3300025927 Unclassified 916
94 Ga0207670_10224115 3300025936 Unclassified 1441
95 Ga0207670_11346183 3300025936 Bacteria 606
96 Ga0207691_10224732 3300025940 Bacteria 1627
97 Ga0207711_10111462 3300025941 Bacteria 2434
98 Ga0207711_10240349 3300025941 Bacteria 1660
99 Ga0207711_10256158 3300025941 Bacteria 1608
100 Ga0207711_10404653 3300025941 Bacteria 1268
101 Ga0207661_11247333 3300025944 Bacteria 684
102 Ga0207679_10125924 3300025945 Bacteria 2047
103 Ga0207640_10396199 3300025981 Unclassified 1123
104 Ga0207658_10199112 3300025986 Bacteria 1671
105 Ga0207678_10071342 3300026067 Bacteria 2978
106 Ga0207674_10169160 3300026116 Bacteria 2139
107 Ga0207674_10275490 3300026116 Unclassified 1630
108 Ga0207683_11118267 3300026121 Bacteria 731
109 Ga0207428_10000251 3300027907 Bacteria 73186
110 Ga0207428_10008935 3300027907 Bacteria 9024
111 Ga0207428_10084268 3300027907 Bacteria 2478
112 Ga0207428_10191280 3300027907 Bacteria 1542
113 Ga0207428_10841926 3300027907 Unclassified 650
114 Ga0268266_10280211 3300028379 Bacteria 1550
115 Ga0268265_11034707 3300028380 Bacteria 812
116 Ga0307408_100066288 3300031548 Bacteria 2651
117 Ga0307408_100907818 3300031548 Bacteria 807
118 Ga0307405_10139262 3300031731 Bacteria 1689
119 Ga0307405_10557379 3300031731 Bacteria 928
120 Ga0307405_10559969 3300031731 Bacteria 926
121 Ga0307413_10033375 3300031824 Bacteria 2930
122 Ga0307413_10124447 3300031824 Bacteria 1753
123 Ga0307413_10708408 3300031824 Unclassified 837
124 Ga0307410_10773899 3300031852 Bacteria 814
125 Ga0307410_11150669 3300031852 Unclassified 674
126 Ga0307410_11233030 3300031852 Bacteria 652
127 Ga0307407_10155663 3300031903 Bacteria 1490
128 Ga0307407_11003436 3300031903 Bacteria 645
129 Ga0307412_10102263 3300031911 Bacteria 2029
130 Ga0307412_10110850 3300031911 Bacteria 1959
131 Ga0307412_10248536 3300031911 Bacteria 1380
132 Ga0307409_100074105 3300031995 Bacteria 2719
133 Ga0307409_100120051 3300031995 Bacteria 2224
134 Ga0307409_100131489 3300031995 Bacteria 2140
135 Ga0307416_100006748 3300032002 Bacteria 7218
136 Ga0307416_100136472 3300032002 Bacteria 2220
137 Ga0307416_100157884 3300032002 Bacteria 2091
138 Ga0307416_100174613 3300032002 Bacteria 2005
139 Ga0307416_100240361 3300032002 Bacteria 1754
140 Ga0307414_10744880 3300032004 Bacteria 890
141 Ga0307414_11714386 3300032004 Bacteria 586
142 Ga0307411_10129606 3300032005 Bacteria 1841
143 Ga0307411_10180530 3300032005 Bacteria 1601
144 Ga0307411_10263724 3300032005 Bacteria 1362
145 Ga0307411_10283439 3300032005 Unclassified 1320
146 Ga0307415_100061179 3300032126 Bacteria 2606
147 Ga0373937_0034205 3300036401 Bacteria 4623
148 Ga0436363_1041534 3300039450 Bacteria 1536
149 Ga0439433_0008947 3300041999 Bacteria 2180
150 Ga0439441_051879 3300042001 Bacteria 847
151 Ga0439445_0088016 3300042004 Unclassified 873
152 Ga0439449_0029444 3300042007 Bacteria 2047
153 Ga0439462_0167525 3300042015 Unclassified 621
154 Ga0450914_013011 3300042118 Bacteria 842
155 Ga0439446_0004620 3300042156 Bacteria 3493
156 Ga0439446_0048795 3300042156 Unclassified 1261
157 Ga0439435_0087746 3300042436 Bacteria 941
158 Ga0439444_0102323 3300042437 Unclassified 651
159 Ga0450916_080239 3300042530 Unclassified 556
160 Ga0451577_0185214 3300042876 Bacteria 1877
161 Ga0439440_0182493 3300042993 Unclassified 615
162 Ga0453684_0373165 3300044712 Bacteria 1603
163 Ga0451576_0658203 3300045051 Archaea 1101
164 Ga0451576_0743993 3300045051 Unclassified 1030
165 Ga0495613_0235310 3300046689 Bacteria 1282
166 Ga0495624_0325276 3300046690 Bacteria 926
167 Ga0496102_1004065 3300048905 Unclassified 755
168 Ga0496104_0044924 3300048907 Bacteria 4152
169 Ga0496105_0012040 3300048908 Bacteria 6847
170 Ga0496108_0003663 3300048911 Bacteria 12325
171 Ga0496108_0101869 3300048911 Unclassified 2450
172 Ga0496109_0005853 3300048912 Bacteria 10308
173 Ga0496109_1066653 3300048912 Unclassified 745
174 Ga0496110_0011509 3300048913 Bacteria 7244
175 Ga0496111_0037885 3300048914 Bacteria 3452
176 Ga0496112_0001306 3300048915 Bacteria 18933
177 Ga0496112_0123079 3300048915 Bacteria 2564
178 Ga0496113_0151093 3300048916 Bacteria 1832
179 Ga0496113_0219167 3300048916 Unclassified 1516
180 Ga0501291_008579 3300049514 Bacteria 1415
181 Ga0501303_022006 3300049526 Bacteria 686
182 Ga0501031_0372619 3300049568 Bacteria 924
183 Ga0501041_0424767 3300049577 Bacteria 843
184 Ga0501042_0282339 3300049578 Unclassified 1199
185 Ga0501042_0433307 3300049578 Unclassified 953
186 Ga0501048_0475915 3300049582 Bacteria 895
187 Ga0501048_0998065 3300049582 Archaea 602
188 Ga0501071_0056129 3300049587 Bacteria 2844
189 Ga0501071_0481344 3300049587 Bacteria 951
190 Ga0501073_0225436 3300049589 Unclassified 1295
191 Ga0501074_0159977 3300049590 Bacteria 1608
192 Ga0501075_0140014 3300049591 Bacteria 1843
193 Ga0501076_0757634 3300049592 Unclassified 801
194 Ga0501076_1172697 3300049592 Bacteria 632
195 Ga0501202_030998 3300049652 Bacteria 1115
196 Ga0501217_024682 3300049661 Bacteria 1440
197 Ga0501222_047731 3300049662 Bacteria 622
198 Ga0501233_027234 3300049668 Bacteria 1268
199 Ga0501251_013317 3300049681 Bacteria 1006
200 Ga0501221_014131 3300049704 Bacteria 1479
201 Ga0501225_0059677 3300049705 Bacteria 1072
202 Ga0501079_0050668 3300049741 Bacteria 3205
203 Ga0501080_0308767 3300049742 Unclassified 1434
204 Ga0501080_0493394 3300049742 Unclassified 1095
205 Ga0501080_0636085 3300049742 Bacteria 945
206 Ga0501081_0418512 3300049743 Archaea 993
207 Ga0501081_0444916 3300049743 Unclassified 962
208 Ga0501035_0456670 3300049822 Bacteria 1056
209 Ga0501045_0298797 3300049824 Bacteria 1198
210 Ga0501045_0554635 3300049824 Bacteria 852
211 nmdc:mga05p37_1403088_c1 3300050507 Unclassified 703
212 nmdc:mga05p37_15284_c1 3300050507 Bacteria 9221
213 nmdc:mga05p37_33774_c1 3300050507 Bacteria 6266
214 nmdc:mga05p37_48730_c1 3300050507 Bacteria 5210
215 nmdc:mga05p37_524073_c1 3300050507 Bacteria 1355
216 nmdc:mga0qj67_19971_c1 3300050509 Bacteria 5127
217 nmdc:mga0qj67_597741_c1 3300050509 Bacteria 883
218 nmdc:mga0qj67_78204_c1 3300050509 Bacteria 1833
219 nmdc:mga06r32_392184_c1 3300050510 Bacteria 1371
220 nmdc:mga06r32_409562_c1 3300050510 Bacteria 1337
221 nmdc:mga06r32_654_c1 3300050510 Bacteria 30275
222 nmdc:mga06r32_73906_c1 3300050510 Bacteria 3303
223 nmdc:mga08y16_109313_c1 3300050511 Unclassified 2879
224 nmdc:mga08y16_22253_c1 3300050511 Bacteria 6689
225 nmdc:mga08y16_302466_c1 3300050511 Bacteria 1648
226 nmdc:mga0n895_24119_c1 3300050512 Bacteria 5728
227 nmdc:mga0n895_4801_c1 3300050512 Bacteria 11189
228 nmdc:mga0n895_61583_c1 3300050512 Bacteria 3706
229 nmdc:mga0n895_657003_c1 3300050512 Unclassified 1047
230 nmdc:mga0n895_84090_c1 3300050512 Bacteria 3175
231 nmdc:mga0rr50_17708_c1 3300050513 Bacteria 4765
232 nmdc:mga0rr50_33475_c1 3300050513 Bacteria 3672
233 nmdc:mga0rr50_743904_c1 3300050513 Bacteria 837
234 nmdc:mga08x19_185751_c1 3300050514 Bacteria 1421
235 nmdc:mga08x19_35838_c1 3300050514 Bacteria 3140
236 nmdc:mga0a205_15700_c1 3300050515 Bacteria 7077
237 nmdc:mga0a205_169833_c1 3300050515 Bacteria 2077
238 nmdc:mga0a205_19152_c1 3300050515 Bacteria 6451
239 nmdc:mga0a205_43559_c1 3300050515 Bacteria 4328
240 nmdc:mga0a205_75711_c1 3300050515 Bacteria 3252
241 Ga0501084_0192992 3300054114 Bacteria 1718
242 Ga0590071_000197 3300059421 Bacteria 17607
243 Ga0590071_113586 3300059421 Bacteria 688
244 Ga0590074_005734 3300059423 Bacteria 2060
245 Ga0590075_000168 3300059424 Bacteria 18054
246 Ga0590075_019695 3300059424 Bacteria 1676
247 Ga0590077_000297 3300059426 Bacteria 14069
248 Ga0501082_0138048 3300060353 Bacteria 2116
249 Ga0501082_1065836 3300060353 Unclassified 707
250 Ga0530510_0106698 3300061734 Bacteria 2050
251 Ga0530510_0284841 3300061734 Archaea 1235
252 Ga0207697_10138252
253 MRS1b_contig_7053365
254 Ga0065712_10071169
255 Ga0065715_10107001
256 Ga0065707_10084922
257 Ga0070683_100003796
258 Ga0070670_100871725
259 Ga0070677_10368630
260 Ga0070689_100527081
261 Ga0070661_100102731
262 Ga0070668_100237683
263 Ga0070668_100844236
264 Ga0070669_100003506
265 Ga0070669_100416806
266 Ga0070675_100094637
267 Ga0070688_100221668
268 Ga0070667_100144937
269 Ga0070701_10091215
270 Ga0070701_10208893
271 Ga0070701_10210435
272 Ga0070694_100037457
273 Ga0070694_100396759
274 Ga0070663_100015108
275 Ga0070707_101306403
276 Ga0070698_100225578
277 Ga0070698_100533907
278 Ga0070684_100002103
279 Ga0070672_100189374
280 Ga0070686_100030981
281 Ga0070686_100638233
282 Ga0070695_100001675
283 Ga0070696_100542232
284 Ga0070696_100543344
285 Ga0070693_100031360
286 Ga0070704_100002643
287 Ga0070704_100097860
288 Ga0070664_100013660
289 Ga0068857_100251577
290 Ga0068859_100757119
291 Ga0068862_100050500
292 Ga0075366_10245396
293 Ga0075428_100000086
294 Ga0075428_100162339
295 Ga0075430_100000028
296 Ga0075430_100008967
297 Ga0075430_100198403
298 Ga0075430_100899728
299 Ga0075431_100002556
300 Ga0075431_100011426
301 Ga0075431_100059201
302 Ga0075431_100325023
303 Ga0075431_101324668
304 Ga0075433_10013585
305 Ga0075433_10040096
306 Ga0075433_10180601
307 Ga0075434_100005852
308 Ga0075434_100045127
309 Ga0075434_100049220
310 Ga0075434_100504134
311 Ga0075429_100007122
312 Ga0075429_100050717
313 Ga0075436_100004018
314 Ga0075436_100049925
315 Ga0097620_100757245
316 Ga0075435_100002059
317 Ga0075435_100034220
318 Ga0111539_10004018
319 Ga0111539_10071911
320 Ga0111539_10218643
321 Ga0111539_11427785
322 Ga0114129_10014496
323 Ga0114129_10015571
324 Ga0114129_10020475
325 Ga0114129_10076439
326 Ga0114129_10113908
327 Ga0114129_11794433
328 Ga0105248_10107324
329 Ga0105248_10114565
330 Ga0105249_10001013
331 Ga0105249_10069695
332 Ga0157374_10055119
333 Ga0157378_11372514
334 Ga0157375_11629448
335 Ga0157377_10016726
336 Ga0157377_10927752
337 Ga0157376_10189929
338 Ga0157376_10323032
339 Ga0207649_10936524
340 Ga0207646_11047994
341 Ga0207681_10009073
342 Ga0207681_10471305
343 Ga0207650_10595888
344 Ga0207687_10616501
345 Ga0207670_10224115
346 Ga0207670_11346183
347 Ga0207691_10224732
348 Ga0207711_10111462
349 Ga0207711_10240349
350 Ga0207711_10256158
351 Ga0207711_10404653
352 Ga0207661_11247333
353 Ga0207679_10125924
354 Ga0207640_10396199
355 Ga0207658_10199112
356 Ga0207678_10071342
357 Ga0207674_10169160
358 Ga0207674_10275490
359 Ga0207683_11118267
360 Ga0207428_10000251
361 Ga0207428_10008935
362 Ga0207428_10084268
363 Ga0207428_10191280
364 Ga0207428_10841926
365 Ga0268266_10280211
366 Ga0268265_11034707
367 Ga0307408_100066288
368 Ga0307408_100907818
369 Ga0307405_10139262
370 Ga0307405_10557379
371 Ga0307405_10559969
372 Ga0307413_10033375
373 Ga0307413_10124447
374 Ga0307413_10708408
375 Ga0307410_10773899
376 Ga0307410_11150669
377 Ga0307410_11233030
378 Ga0307407_10155663
379 Ga0307407_11003436
380 Ga0307412_10102263
381 Ga0307412_10110850
382 Ga0307412_10248536
383 Ga0307409_100074105
384 Ga0307409_100120051
385 Ga0307409_100131489
386 Ga0307416_100006748
387 Ga0307416_100136472
388 Ga0307416_100157884
389 Ga0307416_100174613
390 Ga0307416_100240361
391 Ga0307414_10744880
392 Ga0307414_11714386
393 Ga0307411_10129606
394 Ga0307411_10180530
395 Ga0307411_10263724
396 Ga0307411_10283439
397 Ga0307415_100061179
398 Ga0373937_0034205
399 Ga0436363_1041534
400 Ga0439433_0008947
401 Ga0439441_051879
402 Ga0439445_0088016
403 Ga0439449_0029444
404 Ga0439462_0167525
405 Ga0450914_013011
406 Ga0439446_0004620
407 Ga0439446_0048795
408 Ga0439435_0087746
409 Ga0439444_0102323
410 Ga0450916_080239
411 Ga0451577_0185214
412 Ga0439440_0182493
413 Ga0453684_0373165
414 Ga0451576_0658203
415 Ga0451576_0743993
416 Ga0495613_0235310
417 Ga0495624_0325276
418 Ga0496102_1004065
419 Ga0496104_0044924
420 Ga0496105_0012040
421 Ga0496108_0003663
422 Ga0496108_0101869
423 Ga0496109_0005853
424 Ga0496109_1066653
425 Ga0496110_0011509
426 Ga0496111_0037885
427 Ga0496112_0001306
428 Ga0496112_0123079
429 Ga0496113_0151093
430 Ga0496113_0219167
431 Ga0501291_008579
432 Ga0501303_022006
433 Ga0501031_0372619
434 Ga0501041_0424767
435 Ga0501042_0282339
436 Ga0501042_0433307
437 Ga0501048_0475915
438 Ga0501048_0998065
439 Ga0501071_0056129
440 Ga0501071_0481344
441 Ga0501073_0225436
442 Ga0501074_0159977
443 Ga0501075_0140014
444 Ga0501076_0757634
445 Ga0501076_1172697
446 Ga0501202_030998
447 Ga0501217_024682
448 Ga0501222_047731
449 Ga0501233_027234
450 Ga0501251_013317
451 Ga0501221_014131
452 Ga0501225_0059677
453 Ga0501079_0050668
454 Ga0501080_0308767
455 Ga0501080_0493394
456 Ga0501080_0636085
457 Ga0501081_0418512
458 Ga0501081_0444916
459 Ga0501035_0456670
460 Ga0501045_0298797
461 Ga0501045_0554635
462 nmdc:mga05p37_1403088_c1
463 nmdc:mga05p37_15284_c1
464 nmdc:mga05p37_33774_c1
465 nmdc:mga05p37_48730_c1
466 nmdc:mga05p37_524073_c1
467 nmdc:mga0qj67_19971_c1
468 nmdc:mga0qj67_597741_c1
469 nmdc:mga0qj67_78204_c1
470 nmdc:mga06r32_392184_c1
471 nmdc:mga06r32_409562_c1
472 nmdc:mga06r32_654_c1
473 nmdc:mga06r32_73906_c1
474 nmdc:mga08y16_109313_c1
475 nmdc:mga08y16_22253_c1
476 nmdc:mga08y16_302466_c1
477 nmdc:mga0n895_24119_c1
478 nmdc:mga0n895_4801_c1
479 nmdc:mga0n895_61583_c1
480 nmdc:mga0n895_657003_c1
481 nmdc:mga0n895_84090_c1
482 nmdc:mga0rr50_17708_c1
483 nmdc:mga0rr50_33475_c1
484 nmdc:mga0rr50_743904_c1
485 nmdc:mga08x19_185751_c1
486 nmdc:mga08x19_35838_c1
487 nmdc:mga0a205_15700_c1
488 nmdc:mga0a205_169833_c1
489 nmdc:mga0a205_19152_c1
490 nmdc:mga0a205_43559_c1
491 nmdc:mga0a205_75711_c1
492 Ga0501084_0192992
493 Ga0590071_000197
494 Ga0590071_113586
495 Ga0590074_005734
496 Ga0590075_000168
497 Ga0590075_019695
498 Ga0590077_000297
499 Ga0501082_0138048
500 Ga0501082_1065836
501 Ga0530510_0106698
502 Ga0530510_0284841

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01894

UPF0047

Uncharacterised protein family UPF0047

43

162

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vph-assembly2.cif.gz_E crystal structure of a ybjq-like protein of unknown function (sso2532) from sulfolobus solfataricus p2 at 1.76 a resolution 0.9644 23 164
1xbf-assembly1.cif.gz_C x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum 0.961 27 163
1ve0-assembly1.cif.gz_A crystal structure of uncharacterized protein st2072 from sulfolobus tokodaii 0.9589 25 164
1vmh-assembly1.cif.gz_A crystal structure of an uncharacterized conserved protein yjbq/upf0047 family, ortholog yugu b.subtilis (ca_c0907) from clostridium acetobutylicum at 1.31 a resolution 0.9588 29 162
2p6h-assembly1.cif.gz_A crystal structure of hypothetical protein ape1520 from aeropyrum pernix k1 0.9562 27 164
ID Description Score Start End Superfamily
1ve0A00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9585 25 162 2.60.120.460
1xbfB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9567 29 163 2.60.120.460
2p6hB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9562 27 164 2.60.120.460
1vphC00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9527 21 164 2.60.120.460
1ve0A00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9374 25 162 2.60.120.460
ID Description Score Start End GO Terms
AF-A0A7V0Y392-F1-model_v4 YjbQ family protein 0.9906 26 166
AF-A0A1F7NPW3-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9896 25 165
AF-A0A1Q7AG94-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9879 31 166
AF-A0A1F2THL7-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9872 17 166
AF-A0A1F2QXK2-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9867 26 165

Map