F361808

General Info

Members Datasets Scaffolds Average Seq Length
250 184 500 58

Family's Representative Sequence

Representative Sequence 3300045836|Ga0466958_0217705|Ga0466958_0217705_648_842
Length 64
Sequence MKEEAVLEMRGACERCDAALAPDGPARICSHECTFCVTCASGPLGNVCPNCGGELVPRPRRTGS

Samples

Sample ID Description Type Environment
1 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
57 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
58 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
86 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
89 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
90 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
91 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
92 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
93 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
94 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
95 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
103 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
104 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
105 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
106 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
107 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
108 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
109 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
110 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
111 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
112 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
115 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
120 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
121 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
122 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
123 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
124 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
125 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
126 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
127 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
128 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
134 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
135 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
136 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
137 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
140 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
141 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
142 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
157 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
165 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
168 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
169 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
172 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
176 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
177 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
178 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
179 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
180 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
181 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
182 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
183 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
184 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 0
Isolates 1.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 13.2
Rhizosphere 83.6
Stem 0
Stem Tuber 0
Unclassified 3.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466958_0217705 3300045836 Bacteria 1218
2 Ga0070683_100001734 3300005329 Bacteria 16979
3 Ga0070683_100457551 3300005329 Bacteria 1218
4 Ga0070683_101327944 3300005329 Bacteria 691
5 Ga0070690_100572120 3300005330 Bacteria 854
6 Ga0070677_10207710 3300005333 Bacteria 949
7 Ga0070680_100426044 3300005336 Bacteria 1132
8 Ga0070680_101605319 3300005336 Bacteria 563
9 Ga0070682_100901601 3300005337 Bacteria 726
10 Ga0068868_100897900 3300005338 Bacteria 805
11 Ga0070689_102065004 3300005340 Unclassified 522
12 Ga0070661_100441130 3300005344 Bacteria 1035
13 Ga0070692_10732224 3300005345 Unclassified 669
14 Ga0070671_101056279 3300005355 Bacteria 712
15 Ga0070674_100274380 3300005356 Bacteria 1334
16 Ga0070673_100742136 3300005364 Bacteria 904
17 Ga0070714_100014420 3300005435 Bacteria 6349
18 Ga0070714_100450122 3300005435 Bacteria 1223
19 Ga0070710_10047687 3300005437 Bacteria 2390
20 Ga0070710_11449621 3300005437 Bacteria 514
21 Ga0070701_10324260 3300005438 Bacteria 954
22 Ga0070711_100066427 3300005439 Bacteria 2526
23 Ga0070711_101703008 3300005439 Bacteria 552
24 Ga0070705_100214823 3300005440 Bacteria 1328
25 Ga0070705_100640354 3300005440 Bacteria 827
26 Ga0070700_100515478 3300005441 Bacteria 923
27 Ga0070694_100294035 3300005444 Bacteria 1242
28 Ga0070663_102078516 3300005455 Bacteria 512
29 Ga0070662_100405450 3300005457 Bacteria 1126
30 Ga0070681_10328591 3300005458 Bacteria 1439
31 Ga0068867_100291964 3300005459 Bacteria 1341
32 Ga0070685_10336330 3300005466 Bacteria 1028
33 Ga0070707_100248935 3300005468 Bacteria 1729
34 Ga0070679_100106836 3300005530 Bacteria 2784
35 Ga0070684_100152373 3300005535 Bacteria 2095
36 Ga0070672_100622576 3300005543 Bacteria 941
37 Ga0070672_101058547 3300005543 Bacteria 720
38 Ga0070695_100260632 3300005545 Bacteria 1266
39 Ga0070696_100010516 3300005546 Bacteria 6201
40 Ga0070696_100047275 3300005546 Bacteria 2985
41 Ga0070665_100648532 3300005548 Bacteria 1069
42 Ga0070704_101171072 3300005549 Bacteria 700
43 Ga0070704_102030499 3300005549 Bacteria 534
44 Ga0068857_100010024 3300005577 Bacteria 8227
45 Ga0068854_100145861 3300005578 Bacteria 1821
46 Ga0068856_100109445 3300005614 Bacteria 2759
47 Ga0068856_102213497 3300005614 Bacteria 559
48 Ga0070702_101629512 3300005615 Bacteria 535
49 Ga0068870_10524874 3300005840 Bacteria 793
50 Ga0081455_10056065 3300005937 Unclassified 3348
51 Ga0070717_10338181 3300006028 Bacteria 1344
52 Ga0070715_10003561 3300006163 Bacteria 4985
53 Ga0070715_10270296 3300006163 Bacteria 897
54 Ga0070716_100004091 3300006173 Bacteria 6920
55 Ga0097621_100242971 3300006237 Bacteria 1574
56 Ga0068871_100034404 3300006358 Bacteria 4020
57 Ga0075435_100117622 3300007076 Bacteria 2215
58 Ga0111539_10859682 3300009094 Bacteria 1055
59 Ga0105247_10470116 3300009101 Bacteria 910
60 Ga0105248_10567915 3300009177 Bacteria 1280
61 Ga0105239_11772679 3300010375 Bacteria 715
62 Ga0105239_13446550 3300010375 Unclassified 514
63 Ga0105246_10738325 3300011119 Bacteria 867
64 Ga0157320_1003877 3300012481 Bacteria 927
65 Ga0157375_11014234 3300013308 Bacteria 969
66 Ga0157375_12682905 3300013308 Unclassified 596
67 Ga0163163_10737891 3300014325 Bacteria 1048
68 Ga0157377_10126805 3300014745 Bacteria 1554
69 Ga0157377_11617469 3300014745 Bacteria 519
70 Ga0157376_10180633 3300014969 Bacteria 1928
71 Ga0213872_10431984 3300021361 Bacteria 531
72 Ga0213871_10177959 3300021441 Bacteria 657
73 Ga0207682_10250258 3300025893 Bacteria 825
74 Ga0207692_11089548 3300025898 Bacteria 529
75 Ga0207710_10430781 3300025900 Unclassified 679
76 Ga0207685_10648384 3300025905 Bacteria 571
77 Ga0207699_10155785 3300025906 Bacteria 1516
78 Ga0207654_10056829 3300025911 Bacteria 2272
79 Ga0207707_10392093 3300025912 Bacteria 1193
80 Ga0207707_11437675 3300025912 Bacteria 549
81 Ga0207693_10008182 3300025915 Bacteria 8569
82 Ga0207693_10010631 3300025915 Bacteria 7467
83 Ga0207663_10185236 3300025916 Bacteria 1490
84 Ga0207660_10670800 3300025917 Bacteria 845
85 Ga0207660_11029116 3300025917 Bacteria 671
86 Ga0207652_10132262 3300025921 Bacteria 2226
87 Ga0207646_10159826 3300025922 Bacteria 2033
88 Ga0207646_10591726 3300025922 Bacteria 996
89 Ga0207664_10008413 3300025929 Bacteria 7195
90 Ga0207644_10216032 3300025931 Bacteria 1518
91 Ga0207669_11260202 3300025937 Bacteria 627
92 Ga0207665_10003663 3300025939 Bacteria 10262
93 Ga0207711_11348990 3300025941 Unclassified 655
94 Ga0207661_10430324 3300025944 Bacteria 1200
95 Ga0207661_10654127 3300025944 Bacteria 966
96 Ga0207651_11807573 3300025960 Bacteria 550
97 Ga0207678_10024525 3300026067 Bacteria 5269
98 Ga0207678_10371319 3300026067 Bacteria 1236
99 Ga0207702_10035216 3300026078 Bacteria 4186
100 Ga0207702_10256671 3300026078 Bacteria 1644
101 Ga0207676_10460293 3300026095 Bacteria 1201
102 Ga0207674_11545633 3300026116 Bacteria 632
103 Ga0207683_10008099 3300026121 Bacteria 8987
104 Ga0268266_10249651 3300028379 Bacteria 1641
105 Ga0268265_11866245 3300028380 Bacteria 608
106 Ga0268264_12284801 3300028381 Bacteria 548
107 Ga0265322_10168835 3300028654 Bacteria 626
108 Ga0316182_1024034 3300030745 Bacteria 514
109 Ga0307408_102209872 3300031548 Bacteria 532
110 Ga0307407_11621927 3300031903 Bacteria 514
111 Ga0373940_0031629 3300035088 Bacteria 1414
112 Ga0373939_0008851 3300035114 Bacteria 2479
113 Ga0373941_0054849 3300035115 Bacteria 1279
114 Ga0373960_0083446 3300035121 Bacteria 1010
115 Ga0373924_0053101 3300035410 Bacteria 1683
116 Ga0373931_0024185 3300035691 Bacteria 3074
117 Ga0373933_0045999 3300035724 Bacteria 2590
118 Ga0373937_0000190 3300036401 Bacteria 60066
119 Ga0373937_2143093 3300036401 Bacteria 505
120 Ga0395900_0251159 3300037418 Bacteria 1770
121 Ga0395898_0071866 3300037466 Bacteria 3343
122 Ga0395905_0545152 3300037471 Bacteria 1061
123 Ga0395901_0988845 3300038443 Bacteria 818
124 Ga0436365_0513424 3300039437 Bacteria 4882
125 Ga0436365_0717668 3300039437 Bacteria 1155
126 Ga0436365_1434413 3300039437 Bacteria 1434
127 Ga0436360_0013059 3300039438 Bacteria 937
128 Ga0436361_0563686 3300039447 Bacteria 855
129 Ga0436362_0792504 3300039453 Bacteria 2863
130 Ga0451835_0408623 3300041492 Unclassified 591
131 Ga0451851_0110652 3300041507 Bacteria 607
132 Ga0451853_0976306 3300041512 Bacteria 750
133 Ga0439437_013526 3300042000 Bacteria 949
134 Ga0439450_077438 3300042008 Bacteria 823
135 Ga0450903_056054 3300042138 Bacteria 574
136 Ga0439459_0074544 3300042438 Bacteria 791
137 Ga0466961_0077744 3300044693 Bacteria 2102
138 Ga0466963_0079734 3300044694 Bacteria 2215
139 Ga0466963_0185331 3300044694 Bacteria 1454
140 Ga0466963_1157682 3300044694 Bacteria 544
141 Ga0466971_0067518 3300044719 Bacteria 1621
142 Ga0466971_0142488 3300044719 Bacteria 1116
143 Ga0466968_0113416 3300044735 Bacteria 1221
144 Ga0466957_0009632 3300044842 Bacteria 5517
145 Ga0466957_0026236 3300044842 Bacteria 3456
146 Ga0466957_0688654 3300044842 Bacteria 721
147 Ga0466957_0907561 3300044842 Bacteria 630
148 Ga0451576_0177504 3300045051 Bacteria 2224
149 Ga0466958_0020926 3300045836 Bacteria 3818
150 Ga0466967_0157071 3300045976 Bacteria 2131
151 Ga0466967_0186781 3300045976 Bacteria 1957
152 Ga0466967_0196953 3300045976 Bacteria 1906
153 Ga0495592_0000325 3300046454 Bacteria 39655
154 Ga0495590_0036157 3300046457 Bacteria 1723
155 Ga0495651_0000001 3300046462 Bacteria 210544
156 Ga0495653_0000365 3300046463 Bacteria 36511
157 Ga0495664_0202989 3300046477 Bacteria 1201
158 Ga0495664_0507099 3300046477 Bacteria 720
159 Ga0495584_0489486 3300046491 Bacteria 626
160 Ga0495594_0312205 3300046499 Bacteria 896
161 Ga0495608_0001129 3300046511 Bacteria 18885
162 Ga0495618_0001735 3300046514 Bacteria 14468
163 Ga0495620_0094999 3300046515 Bacteria 1193
164 Ga0495628_0000047 3300046516 Bacteria 97852
165 Ga0495652_0012072 3300046529 Bacteria 7806
166 Ga0495652_0275917 3300046529 Bacteria 1233
167 Ga0495652_0537343 3300046529 Bacteria 805
168 Ga0495640_0082822 3300046533 Bacteria 2129
169 Ga0495587_0000540 3300046536 Bacteria 26236
170 Ga0495587_0031779 3300046536 Bacteria 3194
171 Ga0495587_0203938 3300046536 Bacteria 1118
172 Ga0495645_0000039 3300046543 Bacteria 94569
173 Ga0495645_0044071 3300046543 Bacteria 3254
174 Ga0495657_0024325 3300046675 Bacteria 4316
175 Ga0495599_0000063 3300046678 Bacteria 73690
176 Ga0495623_0000214 3300046679 Bacteria 36993
177 Ga0495623_0522656 3300046679 Bacteria 624
178 Ga0495646_0000178 3300046680 Bacteria 31765
179 Ga0495600_0018621 3300046809 Bacteria 4426
180 Ga0495604_0000004 3300047317 Bacteria 456385
181 Ga0495680_0016838 3300047322 Bacteria 6263
182 Ga0495675_0000075 3300047444 Bacteria 69347
183 Ga0495602_0000159 3300048088 Bacteria 62801
184 Ga0495602_0431272 3300048088 Bacteria 934
185 Ga0495602_0909957 3300048088 Bacteria 585
186 Ga0496100_0012535 3300048903 Bacteria 4863
187 Ga0496100_0018012 3300048903 Bacteria 4182
188 Ga0496100_0022135 3300048903 Bacteria 3841
189 Ga0496100_0319754 3300048903 Bacteria 1165
190 Ga0496101_0031781 3300048904 Bacteria 3713
191 Ga0496101_0088394 3300048904 Bacteria 2301
192 Ga0496101_0249222 3300048904 Bacteria 1383
193 Ga0496102_0095005 3300048905 Bacteria 2762
194 Ga0496102_0206211 3300048905 Bacteria 1853
195 Ga0496103_0017719 3300048906 Bacteria 4264
196 Ga0496103_0020924 3300048906 Bacteria 3933
197 Ga0496104_0003880 3300048907 Bacteria 12937
198 Ga0496104_0374846 3300048907 Bacteria 1336
199 Ga0496104_0700166 3300048907 Bacteria 921
200 Ga0496105_0050025 3300048908 Bacteria 3452
201 Ga0496105_0125447 3300048908 Bacteria 2116
202 Ga0496107_0008081 3300048910 Bacteria 7265
203 Ga0496107_0064221 3300048910 Bacteria 2661
204 Ga0496107_0162329 3300048910 Bacteria 1656
205 Ga0496108_0016691 3300048911 Bacteria 5998
206 Ga0496109_0041036 3300048912 Bacteria 4193
207 Ga0496109_0298729 3300048912 Bacteria 1518
208 Ga0496109_1188183 3300048912 Unclassified 699
209 Ga0496110_0008586 3300048913 Bacteria 8226
210 Ga0496110_0547138 3300048913 Bacteria 1052
211 Ga0496111_0006421 3300048914 Bacteria 7632
212 Ga0496112_0048956 3300048915 Bacteria 4141
213 Ga0496113_0022962 3300048916 Bacteria 4420
214 Ga0496113_0082699 3300048916 Bacteria 2463
215 Ga0496114_0044159 3300048917 Bacteria 3697
216 Ga0496115_0192944 3300048918 Bacteria 1683
217 Ga0496115_0207739 3300048918 Bacteria 1617
218 Ga0496115_0305717 3300048918 Bacteria 1302
219 Ga0501032_0041290 3300049569 Bacteria 3133
220 Ga0501034_0013652 3300049571 Bacteria 8352
221 Ga0501037_0033348 3300049573 Bacteria 3803
222 Ga0501037_0821499 3300049573 Bacteria 613
223 Ga0501040_0003415 3300049576 Bacteria 10244
224 Ga0501047_0030861 3300049581 Bacteria 5167
225 Ga0501047_0030863 3300049581 Bacteria 5166
226 Ga0501048_0039966 3300049582 Bacteria 3362
227 Ga0501067_0458267 3300049583 Bacteria 712
228 Ga0501069_0296020 3300049585 Bacteria 948
229 Ga0501070_0123290 3300049586 Bacteria 2142
230 Ga0501070_1214184 3300049586 Bacteria 578
231 Ga0501071_0045665 3300049587 Bacteria 3144
232 Ga0501074_0048940 3300049590 Bacteria 3052
233 Ga0501075_0034101 3300049591 Bacteria 3788
234 Ga0501080_0496392 3300049742 Bacteria 1091
235 Ga0501081_0000504 3300049743 Bacteria 21914
236 Ga0501035_0252584 3300049822 Bacteria 1497
237 Ga0501045_0018873 3300049824 Bacteria 4909
238 nmdc:mga0rr50_971120_c1 3300050513 Bacteria 724
239 Ga0495601_0000148 3300053077 Bacteria 40030
240 Ga0495601_0075712 3300053077 Bacteria 2154
241 Ga0495601_0563628 3300053077 Bacteria 732
242 Ga0495612_0119176 3300053078 Bacteria 1134
243 Ga0495655_0106271 3300053083 Bacteria 838
244 Ga0495595_0064837 3300053084 Bacteria 1717
245 Ga0495619_0056668 3300053085 Bacteria 2598
246 Ga0501082_0060453 3300060353 Bacteria 3262
247 Ga0466962_0012693 3300061719 Bacteria 4052
248 2643942193 2643221587 Bacteria 7586415
249 2644429276 2643221677 Bacteria 7584031
250 8025484642 8025478263 Bacteria 8209203
251 Ga0466958_0217705
252 Ga0070683_100001734
253 Ga0070683_100457551
254 Ga0070683_101327944
255 Ga0070690_100572120
256 Ga0070677_10207710
257 Ga0070680_100426044
258 Ga0070680_101605319
259 Ga0070682_100901601
260 Ga0068868_100897900
261 Ga0070689_102065004
262 Ga0070661_100441130
263 Ga0070692_10732224
264 Ga0070671_101056279
265 Ga0070674_100274380
266 Ga0070673_100742136
267 Ga0070714_100014420
268 Ga0070714_100450122
269 Ga0070710_10047687
270 Ga0070710_11449621
271 Ga0070701_10324260
272 Ga0070711_100066427
273 Ga0070711_101703008
274 Ga0070705_100214823
275 Ga0070705_100640354
276 Ga0070700_100515478
277 Ga0070694_100294035
278 Ga0070663_102078516
279 Ga0070662_100405450
280 Ga0070681_10328591
281 Ga0068867_100291964
282 Ga0070685_10336330
283 Ga0070707_100248935
284 Ga0070679_100106836
285 Ga0070684_100152373
286 Ga0070672_100622576
287 Ga0070672_101058547
288 Ga0070695_100260632
289 Ga0070696_100010516
290 Ga0070696_100047275
291 Ga0070665_100648532
292 Ga0070704_101171072
293 Ga0070704_102030499
294 Ga0068857_100010024
295 Ga0068854_100145861
296 Ga0068856_100109445
297 Ga0068856_102213497
298 Ga0070702_101629512
299 Ga0068870_10524874
300 Ga0081455_10056065
301 Ga0070717_10338181
302 Ga0070715_10003561
303 Ga0070715_10270296
304 Ga0070716_100004091
305 Ga0097621_100242971
306 Ga0068871_100034404
307 Ga0075435_100117622
308 Ga0111539_10859682
309 Ga0105247_10470116
310 Ga0105248_10567915
311 Ga0105239_11772679
312 Ga0105239_13446550
313 Ga0105246_10738325
314 Ga0157320_1003877
315 Ga0157375_11014234
316 Ga0157375_12682905
317 Ga0163163_10737891
318 Ga0157377_10126805
319 Ga0157377_11617469
320 Ga0157376_10180633
321 Ga0213872_10431984
322 Ga0213871_10177959
323 Ga0207682_10250258
324 Ga0207692_11089548
325 Ga0207710_10430781
326 Ga0207685_10648384
327 Ga0207699_10155785
328 Ga0207654_10056829
329 Ga0207707_10392093
330 Ga0207707_11437675
331 Ga0207693_10008182
332 Ga0207693_10010631
333 Ga0207663_10185236
334 Ga0207660_10670800
335 Ga0207660_11029116
336 Ga0207652_10132262
337 Ga0207646_10159826
338 Ga0207646_10591726
339 Ga0207664_10008413
340 Ga0207644_10216032
341 Ga0207669_11260202
342 Ga0207665_10003663
343 Ga0207711_11348990
344 Ga0207661_10430324
345 Ga0207661_10654127
346 Ga0207651_11807573
347 Ga0207678_10024525
348 Ga0207678_10371319
349 Ga0207702_10035216
350 Ga0207702_10256671
351 Ga0207676_10460293
352 Ga0207674_11545633
353 Ga0207683_10008099
354 Ga0268266_10249651
355 Ga0268265_11866245
356 Ga0268264_12284801
357 Ga0265322_10168835
358 Ga0316182_1024034
359 Ga0307408_102209872
360 Ga0307407_11621927
361 Ga0373940_0031629
362 Ga0373939_0008851
363 Ga0373941_0054849
364 Ga0373960_0083446
365 Ga0373924_0053101
366 Ga0373931_0024185
367 Ga0373933_0045999
368 Ga0373937_0000190
369 Ga0373937_2143093
370 Ga0395900_0251159
371 Ga0395898_0071866
372 Ga0395905_0545152
373 Ga0395901_0988845
374 Ga0436365_0513424
375 Ga0436365_0717668
376 Ga0436365_1434413
377 Ga0436360_0013059
378 Ga0436361_0563686
379 Ga0436362_0792504
380 Ga0451835_0408623
381 Ga0451851_0110652
382 Ga0451853_0976306
383 Ga0439437_013526
384 Ga0439450_077438
385 Ga0450903_056054
386 Ga0439459_0074544
387 Ga0466961_0077744
388 Ga0466963_0079734
389 Ga0466963_0185331
390 Ga0466963_1157682
391 Ga0466971_0067518
392 Ga0466971_0142488
393 Ga0466968_0113416
394 Ga0466957_0009632
395 Ga0466957_0026236
396 Ga0466957_0688654
397 Ga0466957_0907561
398 Ga0451576_0177504
399 Ga0466958_0020926
400 Ga0466967_0157071
401 Ga0466967_0186781
402 Ga0466967_0196953
403 Ga0495592_0000325
404 Ga0495590_0036157
405 Ga0495651_0000001
406 Ga0495653_0000365
407 Ga0495664_0202989
408 Ga0495664_0507099
409 Ga0495584_0489486
410 Ga0495594_0312205
411 Ga0495608_0001129
412 Ga0495618_0001735
413 Ga0495620_0094999
414 Ga0495628_0000047
415 Ga0495652_0012072
416 Ga0495652_0275917
417 Ga0495652_0537343
418 Ga0495640_0082822
419 Ga0495587_0000540
420 Ga0495587_0031779
421 Ga0495587_0203938
422 Ga0495645_0000039
423 Ga0495645_0044071
424 Ga0495657_0024325
425 Ga0495599_0000063
426 Ga0495623_0000214
427 Ga0495623_0522656
428 Ga0495646_0000178
429 Ga0495600_0018621
430 Ga0495604_0000004
431 Ga0495680_0016838
432 Ga0495675_0000075
433 Ga0495602_0000159
434 Ga0495602_0431272
435 Ga0495602_0909957
436 Ga0496100_0012535
437 Ga0496100_0018012
438 Ga0496100_0022135
439 Ga0496100_0319754
440 Ga0496101_0031781
441 Ga0496101_0088394
442 Ga0496101_0249222
443 Ga0496102_0095005
444 Ga0496102_0206211
445 Ga0496103_0017719
446 Ga0496103_0020924
447 Ga0496104_0003880
448 Ga0496104_0374846
449 Ga0496104_0700166
450 Ga0496105_0050025
451 Ga0496105_0125447
452 Ga0496107_0008081
453 Ga0496107_0064221
454 Ga0496107_0162329
455 Ga0496108_0016691
456 Ga0496109_0041036
457 Ga0496109_0298729
458 Ga0496109_1188183
459 Ga0496110_0008586
460 Ga0496110_0547138
461 Ga0496111_0006421
462 Ga0496112_0048956
463 Ga0496113_0022962
464 Ga0496113_0082699
465 Ga0496114_0044159
466 Ga0496115_0192944
467 Ga0496115_0207739
468 Ga0496115_0305717
469 Ga0501032_0041290
470 Ga0501034_0013652
471 Ga0501037_0033348
472 Ga0501037_0821499
473 Ga0501040_0003415
474 Ga0501047_0030861
475 Ga0501047_0030863
476 Ga0501048_0039966
477 Ga0501067_0458267
478 Ga0501069_0296020
479 Ga0501070_0123290
480 Ga0501070_1214184
481 Ga0501071_0045665
482 Ga0501074_0048940
483 Ga0501075_0034101
484 Ga0501080_0496392
485 Ga0501081_0000504
486 Ga0501035_0252584
487 Ga0501045_0018873
488 nmdc:mga0rr50_971120_c1
489 Ga0495601_0000148
490 Ga0495601_0075712
491 Ga0495601_0563628
492 Ga0495612_0119176
493 Ga0495655_0106271
494 Ga0495595_0064837
495 Ga0495619_0056668
496 Ga0501082_0060453
497 Ga0466962_0012693
498 2643942193
499 2644429276
500 8025484642

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06906

DUF1272

Protein of unknown function (DUF1272)

6

61

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zb8-assembly2.cif.gz_B crystal structure of the novel lesion-specific endonuclease pfuendoq from pyrococcus furiosus 0.8699 21 52
2csz-assembly1.cif.gz_A solution structure of the ring domain of the synaptotagmin-like protein 4 0.7831 7 36
4bv2-assembly5.cif.gz_B crystal structure of sir2 in complex with the inhibitor ex-527, 2'-o-acetyl-adp-ribose and deacetylated p53-peptide 0.773 21 52
3mmk-assembly2.cif.gz_B the structural basis for partial redundancy in a class of transcription factors, the lim-homeodomain proteins, in neural cell type specification 0.7609 8 52
5yph-assembly1.cif.gz_A p62/sqstm1 zz domain with ile-peptide 0.7472 7 54
ID Description Score Start End Superfamily
af_Q9VU52_598_715_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8759 8 52 3.30.40.10
af_Q09476_347_411_2.10.110.10 Mainly Beta;Ribbon;Cysteine Rich Protein;Cysteine Rich Protein 0.858 8 38 2.10.110.10
af_P53407_27_84_2.10.110.10 Mainly Beta;Ribbon;Cysteine Rich Protein;Cysteine Rich Protein 0.8518 7 38 2.10.110.10
af_Q06407_7_68_2.10.110.10 Mainly Beta;Ribbon;Cysteine Rich Protein;Cysteine Rich Protein 0.847 8 36 2.10.110.10
af_P61371_17_74_2.10.110.10 Mainly Beta;Ribbon;Cysteine Rich Protein;Cysteine Rich Protein 0.8391 7 38 2.10.110.10
ID Description Score Start End GO Terms
AF-A0A5S4YZ54-F1-model_v4 deleted 0.9879 8 53
AF-A0A3Q7HP01-F1-model_v4 Calcineurin B-like protein 0.9841 22 51 GO:0005509
GO:0005737
GO:0006511
GO:0008270
GO:0016567
GO:0019722
GO:0019900
GO:0061630
AF-A0A836TZW2-F1-model_v4 DUF1272 domain-containing protein 0.9723 23 57
AF-A0A536NX58-F1-model_v4 DUF1272 domain-containing protein 0.9716 6 54
AF-A0A2U1PJ19-F1-model_v4 Aminotransferase-like mobile domain-containing protein 0.9633 22 51 GO:0008270
GO:0008483
GO:0016567

Map