F361510

General Info

Members Datasets Scaffolds Average Seq Length
250 192 225 233

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10254980|Ga0105240_102549802
Length 267
Sequence MTRAFRTPLGRDPAVDVGGRSWHAAGMRMIGLIGGMSWESSAEYYRILNQGVRDRLGPTASARCLLWSFDFAEIEALQHRGDWDALGDRLVDAAQRLEAGGAEGLLICTNTMHRLAAQVEAAVKIPLLHIADPTAARIKAAGFATVGLLGTAFTMEQPFYKDRLAARHGLRVLVPDAADRATVHRVIYEELVAGRIVPESRAAYRAVLQRLAAAGAEAVILGCTEIMLLIGAEDSPVPVFDTTALHAAAAVDWILAAPNDPHGAAQV

Samples

Sample ID Description Type Environment
1 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
2 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
3 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
4 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
5 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
6 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
7 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
8 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
9 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
10 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
11 2643221626 Ensifer sp. Root31 Isolate Unclassified
12 2643221698 Ensifer sp. Root142 Isolate Unclassified
13 2751185800 Brucella pituitosa AA2 Isolate Unclassified
14 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
15 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
16 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
17 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
18 2844163670 Ensifer sp. 1H6 Isolate Unclassified
19 2854911287 Brucella lupini LUP21 Isolate Unclassified
20 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
21 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
22 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
23 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
24 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
25 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
26 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
27 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
28 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
29 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
62 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
64 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
82 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
83 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
84 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
85 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
86 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
91 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
92 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
97 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
98 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
99 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
100 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
101 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
102 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
103 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
104 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
105 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
106 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
107 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
108 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
109 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
110 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
111 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
112 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
116 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
117 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
118 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
119 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
120 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
121 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
124 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
125 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
126 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
127 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
128 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
129 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
132 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
133 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
136 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
137 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
138 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
139 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
140 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
141 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
142 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
143 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
144 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
145 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
146 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
153 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
154 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
155 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
156 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
157 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
158 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
159 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
160 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
176 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
177 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
178 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
181 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
182 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
183 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
184 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
185 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
186 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
187 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
188 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
189 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
190 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
191 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
192 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.6
Metatranscriptomes 0.4
Isolates 10

Biome Distribution

Category Percentage (%)
Aerial Root 0.8
Bulb 0
Endosphere 12
Nodule 0
Rhizoplane 2.4
Rhizosphere 64
Stem 0
Stem Tuber 0
Unclassified 20.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000203 3300003214 Bacteria 86823
2 Ga0006562J51391_1011133 3300003578 Bacteria 2220
3 Ga0055536_1002164 3300003781 Bacteria 11196
4 Ga0055536_1007919 3300003781 Bacteria 4664
5 Ga0055530_10000871 3300003791 Bacteria 24827
6 Ga0055530_10007347 3300003791 Bacteria 4664
7 Ga0055531_10000864 3300003794 Bacteria 24831
8 Ga0055531_10002073 3300003794 Bacteria 13789
9 Ga0070658_10031880 3300005327 Bacteria 4235
10 Ga0070683_100348916 3300005329 Bacteria 1409
11 Ga0070660_100135363 3300005339 Bacteria 1974
12 Ga0070691_10106546 3300005341 Bacteria 1398
13 Ga0070674_100283845 3300005356 Bacteria 1313
14 Ga0070684_100249964 3300005535 Bacteria 1621
15 Ga0068853_100228657 3300005539 Bacteria 1701
16 Ga0068853_100474599 3300005539 Bacteria 1179
17 Ga0070696_100390342 3300005546 Bacteria 1087
18 Ga0070665_100012091 3300005548 Bacteria 8709
19 Ga0070664_100172857 3300005564 Bacteria 1917
20 Ga0068854_100485352 3300005578 Bacteria 1038
21 Ga0068859_100283186 3300005617 Bacteria 1750
22 Ga0068858_100008060 3300005842 Bacteria 10148
23 Ga0068860_100005947 3300005843 Bacteria 12279
24 Ga0068860_100006672 3300005843 Bacteria 11594
25 Ga0068862_100000092 3300005844 Bacteria 106896
26 Ga0081539_10062825 3300005985 Bacteria 2028
27 Ga0075365_10221964 3300006038 Bacteria 1326
28 Ga0075369_10000906 3300006186 Bacteria 9822
29 Ga0097620_100283194 3300006931 Bacteria 1750
30 Ga0105240_10254980 3300009093 Bacteria 2027
31 Ga0105245_10003304 3300009098 Bacteria 14476
32 Ga0105245_10632376 3300009098 Bacteria 1099
33 Ga0105243_10258737 3300009148 Bacteria 1557
34 Ga0105238_10088442 3300009551 Bacteria 3084
35 Ga0105249_10000100 3300009553 Bacteria 119358
36 Ga0157370_10314222 3300013104 Bacteria 1446
37 Ga0163162_10335839 3300013306 Bacteria 1643
38 Ga0157372_10211594 3300013307 Bacteria 2247
39 Ga0157380_10502532 3300014326 Bacteria 1178
40 Ga0183368_1004 3300015687 Bacteria 1211761
41 Ga0163161_10029271 3300017792 Bacteria 3915
42 Ga0163161_10082458 3300017792 Bacteria 2369
43 Ga0209437_117130 3300025233 Bacteria 957
44 Ga0209148_1011468 3300025254 Bacteria 1646
45 Ga0209233_1000066 3300025261 Bacteria 381218
46 Ga0209455_1000445 3300025272 Bacteria 31938
47 Ga0209676_1000163 3300025292 Bacteria 157845
48 Ga0209564_1020386 3300025295 Bacteria 2430
49 Ga0209050_1000209 3300025298 Bacteria 130884
50 Ga0209050_1000682 3300025298 Bacteria 51096
51 Ga0209050_1001123 3300025298 Bacteria 32326
52 Ga0209257_1000027 3300025304 Bacteria 703541
53 Ga0207695_10665232 3300025913 Bacteria 922
54 Ga0207671_10011587 3300025914 Bacteria 7161
55 Ga0207657_10014326 3300025919 Bacteria 7745
56 Ga0207694_10366508 3300025924 Bacteria 1194
57 Ga0207687_10004369 3300025927 Bacteria 9433
58 Ga0207709_10111748 3300025935 Bacteria 1828
59 Ga0207712_10000008 3300025961 Bacteria 527957
60 Ga0207703_10005516 3300026035 Bacteria 10161
61 Ga0207639_10556215 3300026041 Bacteria 1054
62 Ga0268266_10048545 3300028379 Bacteria 3639
63 Ga0268265_10000091 3300028380 Bacteria 115237
64 Ga0268264_10002617 3300028381 Bacteria 15732
65 Ga0316176_1135165 3300030732 Bacteria 4100
66 Ga0314311_1106310 3300030733 Bacteria 1686
67 Ga0265327_10021407 3300031251 Bacteria 3904
68 Ga0307508_10012554 3300031616 Bacteria 7749
69 Ga0316576_10087586 3300031727 Bacteria 2317
70 Ga0307516_10025334 3300031730 Bacteria 6042
71 Ga0307412_10000301 3300031911 Bacteria 31415
72 Ga0307412_10018848 3300031911 Bacteria 4164
73 Ga0307412_10097239 3300031911 Bacteria 2074
74 Ga0307409_100099342 3300031995 Bacteria 2410
75 Ga0307409_100670665 3300031995 Bacteria 1033
76 Ga0307414_10172787 3300032004 Bacteria 1729
77 Ga0307510_10205355 3300033180 Bacteria 1499
78 Ga0373936_0152557 3300035113 Bacteria 1002
79 Ga0316574_0106102 3300035398 Bacteria 1800
80 Ga0395900_0000867 3300037418 Bacteria 39764
81 Ga0395900_0052222 3300037418 Bacteria 4208
82 Ga0395898_0021850 3300037466 Bacteria 6482
83 Ga0395901_0010829 3300038443 Bacteria 9244
84 Ga0395901_0026825 3300038443 Bacteria 5915
85 Ga0439436_0022163 3300041404 Bacteria 1882
86 Ga0439461_0000199 3300041410 Bacteria 8385
87 Ga0439461_0009393 3300041410 Bacteria 1773
88 Ga0439465_0003530 3300041413 Bacteria 5096
89 Ga0439465_0009060 3300041413 Bacteria 3137
90 Ga0439465_0097263 3300041413 Bacteria 1013
91 Ga0439465_0100737 3300041413 Bacteria 997
92 Ga0439431_0003334 3300041997 Bacteria 3530
93 Ga0439442_001880 3300042002 Bacteria 4115
94 Ga0439445_0001434 3300042004 Bacteria 5178
95 Ga0439445_0014621 3300042004 Bacteria 1913
96 Ga0439432_001174 3300042006 Bacteria 9919
97 Ga0439452_011433 3300042010 Bacteria 2549
98 Ga0439462_0000902 3300042015 Bacteria 6257
99 Ga0439446_0020428 3300042156 Bacteria 1865
100 Ga0439434_0003580 3300042435 Bacteria 4538
101 Ga0439434_0017177 3300042435 Bacteria 2164
102 Ga0451577_0177044 3300042876 Bacteria 1923
103 Ga0466969_0015465 3300044656 Bacteria 4000
104 Ga0466972_0093209 3300044658 Bacteria 1428
105 Ga0466966_0063238 3300044684 Bacteria 2332
106 Ga0466964_0067857 3300044706 Bacteria 1500
107 Ga0466964_0139468 3300044706 Bacteria 1113
108 Ga0453684_0547088 3300044712 Bacteria 1276
109 Ga0466959_0039816 3300045049 Bacteria 3474
110 Ga0466967_0376874 3300045976 Bacteria 1377
111 Ga0495638_0003884 3300046460 Bacteria 11567
112 Ga0495638_0005483 3300046460 Bacteria 9432
113 Ga0495653_0001800 3300046463 Bacteria 16898
114 Ga0495664_0029062 3300046477 Bacteria 3231
115 Ga0495596_0001912 3300046500 Bacteria 11547
116 Ga0495583_0014428 3300046506 Bacteria 4361
117 Ga0495606_0004894 3300046507 Bacteria 13113
118 Ga0495606_0109475 3300046507 Bacteria 1668
119 Ga0495610_0002496 3300046512 Bacteria 15375
120 Ga0495628_0003355 3300046516 Bacteria 14318
121 Ga0495648_0205689 3300046524 Bacteria 982
122 Ga0495663_0001688 3300046525 Bacteria 6887
123 Ga0495586_0014935 3300046535 Bacteria 4126
124 Ga0495621_0044543 3300046539 Bacteria 1569
125 Ga0495597_0064050 3300046542 Bacteria 1597
126 Ga0495668_0000100 3300046616 Bacteria 137684
127 Ga0495625_0002661 3300046660 Bacteria 19020
128 Ga0495625_0006904 3300046660 Bacteria 10022
129 Ga0495625_0020989 3300046660 Bacteria 5035
130 Ga0495635_0002041 3300046663 Bacteria 13670
131 Ga0495588_0165895 3300046674 Bacteria 1168
132 Ga0495658_0109842 3300046683 Bacteria 1657
133 Ga0495613_0295002 3300046689 Bacteria 1123
134 Ga0495604_0021562 3300047317 Bacteria 5142
135 Ga0495674_0004225 3300047319 Bacteria 13831
136 Ga0495672_0022132 3300047320 Bacteria 4137
137 Ga0495676_0375217 3300047321 Bacteria 947
138 Ga0495680_0003582 3300047322 Bacteria 15206
139 Ga0495687_000007 3300047443 Bacteria 552679
140 Ga0495675_0012141 3300047444 Bacteria 5419
141 Ga0495675_0347705 3300047444 Bacteria 873
142 Ga0495673_0022416 3300047469 Bacteria 3096
143 Ga0495686_0000029 3300047472 Bacteria 369110
144 Ga0495686_0053408 3300047472 Bacteria 2532
145 Ga0495686_0079800 3300047472 Bacteria 2001
146 Ga0495593_0002224 3300047673 Bacteria 11636
147 Ga0495614_0002422 3300048089 Bacteria 8285
148 Ga0495614_0259154 3300048089 Bacteria 797
149 Ga0495615_0031214 3300048090 Bacteria 1277
150 Ga0495626_0000004 3300048091 Bacteria 356599
151 Ga0496101_0580499 3300048904 Bacteria 886
152 Ga0496105_0135737 3300048908 Bacteria 2027
153 Ga0496110_0097066 3300048913 Bacteria 2641
154 Ga0496114_0319531 3300048917 Bacteria 1372
155 Ga0496115_0279752 3300048918 Bacteria 1370
156 Ga0496117_0004473 3300048920 Bacteria 15383
157 Ga0496117_0008822 3300048920 Bacteria 9510
158 Ga0496118_0001513 3300048921 Bacteria 34617
159 Ga0496118_0007289 3300048921 Bacteria 11777
160 Ga0496118_0350171 3300048921 Bacteria 787
161 Ga0496119_0252556 3300048922 Bacteria 888
162 Ga0496120_0049914 3300048923 Bacteria 2398
163 Ga0496121_0000038 3300048924 Bacteria 351739
164 Ga0496121_0017082 3300048924 Bacteria 7439
165 Ga0496122_0010854 3300048925 Bacteria 9325
166 Ga0496122_0025668 3300048925 Bacteria 5108
167 Ga0496122_0035528 3300048925 Bacteria 4051
168 Ga0496122_0076988 3300048925 Bacteria 2345
169 Ga0496122_0297175 3300048925 Bacteria 873
170 Ga0496123_0003082 3300048926 Bacteria 19140
171 Ga0496123_0150055 3300048926 Bacteria 1259
172 Ga0496124_0000889 3300048927 Bacteria 48520
173 Ga0496124_0001663 3300048927 Bacteria 31733
174 Ga0496124_0003908 3300048927 Bacteria 17811
175 Ga0496124_0004242 3300048927 Bacteria 16870
176 Ga0496124_0031704 3300048927 Bacteria 4676
177 Ga0496124_0040854 3300048927 Bacteria 4007
178 Ga0496124_0050644 3300048927 Bacteria 3537
179 Ga0496124_0069436 3300048927 Bacteria 2925
180 Ga0496125_0002090 3300048928 Bacteria 26891
181 Ga0496125_0021775 3300048928 Bacteria 5964
182 Ga0496125_0022050 3300048928 Bacteria 5922
183 Ga0496125_0043117 3300048928 Bacteria 3834
184 Ga0496125_0053793 3300048928 Bacteria 3296
185 Ga0496126_0000328 3300048929 Bacteria 101511
186 Ga0496126_0002442 3300048929 Bacteria 25093
187 Ga0496126_0012275 3300048929 Bacteria 8791
188 Ga0496126_0337617 3300048929 Bacteria 1235
189 Ga0501031_0230459 3300049568 Bacteria 1205
190 Ga0501033_0031479 3300049570 Bacteria 3986
191 Ga0501033_0275708 3300049570 Bacteria 1188
192 Ga0501033_0366476 3300049570 Bacteria 1008
193 Ga0501034_0338614 3300049571 Bacteria 1435
194 Ga0501036_0021862 3300049572 Bacteria 5378
195 Ga0501038_0585407 3300049574 Bacteria 846
196 Ga0501042_0058871 3300049578 Bacteria 2743
197 Ga0501043_0284495 3300049579 Bacteria 1267
198 Ga0501046_0249411 3300049580 Bacteria 1307
199 Ga0501048_0043505 3300049582 Bacteria 3214
200 Ga0501071_0047727 3300049587 Bacteria 3077
201 Ga0501072_0121826 3300049588 Bacteria 2078
202 Ga0501073_0683341 3300049589 Bacteria 708
203 Ga0501074_0116377 3300049590 Bacteria 1913
204 Ga0501075_0081769 3300049591 Bacteria 2446
205 Ga0501076_0076759 3300049592 Bacteria 2680
206 Ga0501249_000271 3300049679 Bacteria 14781
207 Ga0501241_001722 3300049758 Bacteria 4355
208 Ga0501241_002027 3300049758 Bacteria 3970
209 Ga0501044_0555106 3300049823 Bacteria 1045
210 Ga0501044_0656503 3300049823 Bacteria 937
211 Ga0501204_001056 3300049850 Bacteria 2608
212 nmdc:mga0sz30_910_c1 3300050516 Bacteria 10633
213 Ga0500592_002111 3300053116 Bacteria 3204
214 Ga0500595_021418 3300053119 Bacteria 2308
215 Ga0500608_000027 3300053122 Bacteria 66998
216 Ga0500626_027229 3300053128 Bacteria 2575
217 Ga0500559_0030459 3300053136 Bacteria 2313
218 Ga0500559_0108764 3300053136 Bacteria 1283
219 Ga0500622_0002753 3300053156 Bacteria 12392
220 Ga0500622_0006673 3300053156 Bacteria 6651
221 Ga0500634_0000357 3300053161 Bacteria 14486
222 Ga0500601_003781 3300053737 Bacteria 1641
223 Ga0501084_0146264 3300054114 Bacteria 1991
224 Ga0501082_0056679 3300060353 Bacteria 3376
225 Ga0530510_0013878 3300061734 Bacteria 5673

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048091 Ga0495626_0000004 Ga0495626_0000004_92626_93372 216
2 3300037418 Ga0395900_0000867 Ga0395900_0000867_24407_25099 217
3 3300037466 Ga0395898_0021850 Ga0395898_0021850_73_765 217
4 3300038443 Ga0395901_0010829 Ga0395901_0010829_1907_2599 217
5 iso_pu_bacteria 2928027323 2928029869 218
6 3300005985 Ga0081539_10062825 Ga0081539_100628252 219
7 3300045976 Ga0466967_0376874 Ga0466967_0376874_56_718 220
8 3300009098 Ga0105245_10632376 Ga0105245_106323761 222
9 3300009148 Ga0105243_10258737 Ga0105243_102587372 222
10 3300037418 Ga0395900_0052222 Ga0395900_0052222_2222_2890 222
11 3300038443 Ga0395901_0026825 Ga0395901_0026825_4724_5392 222
12 3300047321 Ga0495676_0375217 Ga0495676_0375217_184_852 222
13 3300047443 Ga0495687_000007 Ga0495687_000007_391659_392387 223
14 3300049589 Ga0501073_0683341 Ga0501073_0683341_25_696 223
15 3300053156 Ga0500622_0002753 Ga0500622_0002753_7569_8261 224
16 3300046463 Ga0495653_0001800 Ga0495653_0001800_1393_2124 225
17 3300046535 Ga0495586_0014935 Ga0495586_0014935_173_904 225
18 3300046663 Ga0495635_0002041 Ga0495635_0002041_151_882 225
19 3300046689 Ga0495613_0295002 Ga0495613_0295002_176_907 225
20 3300047317 Ga0495604_0021562 Ga0495604_0021562_4261_4992 225
21 3300047322 Ga0495680_0003582 Ga0495680_0003582_12036_12767 225
22 3300047444 Ga0495675_0012141 Ga0495675_0012141_74_805 225
23 3300047673 Ga0495593_0002224 Ga0495593_0002224_8997_9728 225
24 3300048089 Ga0495614_0002422 Ga0495614_0002422_1920_2651 225
25 iso_pu_bacteria 2643221560 2643822135 225
26 iso_pu_bacteria 2751185897 2753764853 225
27 iso_pu_bacteria 2643221563 2643833403 226
28 iso_pu_bacteria 2643221608 2644054330 226
29 iso_pu_bacteria 2643221626 2644145907 226
30 iso_pu_bacteria 2643221698 2644541418 226
31 iso_pu_bacteria 2751185800 2753358790 226
32 iso_pu_bacteria 2844163670 2844169539 226
33 iso_pu_bacteria 2854911287 2854914366 226
34 iso_pu_bacteria 2909399089 2909402384 226
35 iso_pu_bacteria 2941499720 2941502891 226
36 3300006038 Ga0075365_10221964 Ga0075365_102219642 227
37 3300047320 Ga0495672_0022132 Ga0495672_0022132_1928_2611 227
38 3300047469 Ga0495673_0022416 Ga0495673_0022416_2255_2938 227
39 iso_pu_bacteria 2582581304 2585256038 227
40 iso_pu_bacteria 2643221588 2643949933 227
41 iso_pu_bacteria 2643221622 2644127741 227
42 iso_pu_bacteria 2775507255 2778123329 227
43 iso_pu_bacteria 2984555340 2984557658 227
44 iso_pu_bacteria 2993356040 2993359024 227
45 3300031730 Ga0307516_10025334 Ga0307516_100253341 228
46 iso_pu_bacteria 2758568016 2758641024 228
47 3300005546 Ga0070696_100390342 Ga0070696_1003903421 229
48 3300031911 Ga0307412_10018848 Ga0307412_100188484 229
49 3300032004 Ga0307414_10172787 Ga0307414_101727872 229
50 3300041410 Ga0439461_0000199 Ga0439461_0000199_3034_3723 229
51 3300041413 Ga0439465_0003530 Ga0439465_0003530_1205_1894 229
52 3300041997 Ga0439431_0003334 Ga0439431_0003334_302_991 229
53 3300042002 Ga0439442_001880 Ga0439442_001880_1155_1844 229
54 3300042004 Ga0439445_0001434 Ga0439445_0001434_2422_3111 229
55 3300042006 Ga0439432_001174 Ga0439432_001174_3418_4107 229
56 3300042010 Ga0439452_011433 Ga0439452_011433_1276_1965 229
57 3300042015 Ga0439462_0000902 Ga0439462_0000902_360_1049 229
58 3300042156 Ga0439446_0020428 Ga0439446_0020428_940_1629 229
59 3300042435 Ga0439434_0017177 Ga0439434_0017177_289_978 229
60 3300042876 Ga0451577_0177044 Ga0451577_0177044_249_947 229
61 3300046460 Ga0495638_0005483 Ga0495638_0005483_6861_7550 229
62 3300049570 Ga0501033_0031479 Ga0501033_0031479_108_797 229
63 3300049571 Ga0501034_0338614 Ga0501034_0338614_626_1315 229
64 3300049579 Ga0501043_0284495 Ga0501043_0284495_76_765 229
65 3300049758 Ga0501241_002027 Ga0501241_002027_1662_2351 229
66 3300049823 Ga0501044_0555106 Ga0501044_0555106_96_785 229
67 3300049823 Ga0501044_0656503 Ga0501044_0656503_233_922 229
68 3300053128 Ga0500626_027229 Ga0500626_027229_1749_2438 229
69 iso_pu_bacteria 2576861471 2578457195 229
70 3300003578 Ga0006562J51391_1011133 Ga0006562J51391_10111333 230
71 3300003781 Ga0055536_1002164 Ga0055536_100216411 230
72 3300003794 Ga0055531_10002073 Ga0055531_100020732 230
73 3300005327 Ga0070658_10031880 Ga0070658_100318806 230
74 3300005329 Ga0070683_100348916 Ga0070683_1003489161 230
75 3300005339 Ga0070660_100135363 Ga0070660_1001353633 230
76 3300005535 Ga0070684_100249964 Ga0070684_1002499642 230
77 3300005564 Ga0070664_100172857 Ga0070664_1001728572 230
78 3300005617 Ga0068859_100283186 Ga0068859_1002831862 230
79 3300005843 Ga0068860_100005947 Ga0068860_1000059472 230
80 3300005843 Ga0068860_100006672 Ga0068860_1000066723 230
81 3300005844 Ga0068862_100000092 Ga0068862_10000009257 230
82 3300006931 Ga0097620_100283194 Ga0097620_1002831942 230
83 3300009553 Ga0105249_10000100 Ga0105249_1000010057 230
84 3300013104 Ga0157370_10314222 Ga0157370_103142222 230
85 3300013307 Ga0157372_10211594 Ga0157372_102115942 230
86 3300014326 Ga0157380_10502532 Ga0157380_105025322 230
87 3300015687 Ga0183368_1004 Ga0183368_1004582 230
88 3300025919 Ga0207657_10014326 Ga0207657_100143262 230
89 3300025924 Ga0207694_10366508 Ga0207694_103665082 230
90 3300025961 Ga0207712_10000008 Ga0207712_1000000875 230
91 3300028380 Ga0268265_10000091 Ga0268265_1000009150 230
92 3300028381 Ga0268264_10002617 Ga0268264_100026179 230
93 3300041413 Ga0439465_0097263 Ga0439465_0097263_153_845 230
94 3300044658 Ga0466972_0093209 Ga0466972_0093209_677_1375 230
95 3300044706 Ga0466964_0139468 Ga0466964_0139468_24_722 230
96 3300046507 Ga0495606_0004894 Ga0495606_0004894_3703_4404 230
97 3300046660 Ga0495625_0006904 Ga0495625_0006904_4933_5625 230
98 3300046660 Ga0495625_0020989 Ga0495625_0020989_3665_4393 230
99 3300048908 Ga0496105_0135737 Ga0496105_0135737_1323_2015 230
100 3300048925 Ga0496122_0025668 Ga0496122_0025668_799_1491 230
101 3300048925 Ga0496122_0076988 Ga0496122_0076988_1283_1981 230
102 3300048926 Ga0496123_0150055 Ga0496123_0150055_98_790 230
103 3300048928 Ga0496125_0022050 Ga0496125_0022050_650_1342 230
104 3300048928 Ga0496125_0043117 Ga0496125_0043117_408_1106 230
105 3300048928 Ga0496125_0053793 Ga0496125_0053793_383_1075 230
106 3300049568 Ga0501031_0230459 Ga0501031_0230459_472_1164 230
107 3300049570 Ga0501033_0366476 Ga0501033_0366476_48_740 230
108 3300049572 Ga0501036_0021862 Ga0501036_0021862_843_1535 230
109 3300049574 Ga0501038_0585407 Ga0501038_0585407_109_801 230
110 3300049578 Ga0501042_0058871 Ga0501042_0058871_117_809 230
111 3300049580 Ga0501046_0249411 Ga0501046_0249411_381_1073 230
112 3300049582 Ga0501048_0043505 Ga0501048_0043505_235_927 230
113 3300049587 Ga0501071_0047727 Ga0501071_0047727_1597_2289 230
114 3300049588 Ga0501072_0121826 Ga0501072_0121826_762_1454 230
115 3300049590 Ga0501074_0116377 Ga0501074_0116377_112_804 230
116 3300053116 Ga0500592_002111 Ga0500592_002111_2404_3096 230
117 3300053737 Ga0500601_003781 Ga0500601_003781_560_1258 230
118 3300054114 Ga0501084_0146264 Ga0501084_0146264_659_1351 230
119 3300060353 Ga0501082_0056679 Ga0501082_0056679_421_1113 230
120 3300061734 Ga0530510_0013878 Ga0530510_0013878_2539_3231 230
121 3300003781 Ga0055536_1007919 Ga0055536_10079191 231
122 3300003791 Ga0055530_10000871 Ga0055530_1000087122 231
123 3300003791 Ga0055530_10007347 Ga0055530_100073471 231
124 3300003794 Ga0055531_10000864 Ga0055531_100008646 231
125 3300005341 Ga0070691_10106546 Ga0070691_101065462 231
126 3300005539 Ga0068853_100474599 Ga0068853_1004745991 231
127 3300005578 Ga0068854_100485352 Ga0068854_1004853522 231
128 3300025292 Ga0209676_1000163 Ga0209676_100016381 231
129 3300025298 Ga0209050_1000209 Ga0209050_100020922 231
130 3300025298 Ga0209050_1001123 Ga0209050_10011231 231
131 3300025304 Ga0209257_1000027 Ga0209257_1000027680 231
132 3300026041 Ga0207639_10556215 Ga0207639_105562151 231
133 3300031995 Ga0307409_100670665 Ga0307409_1006706652 231
134 3300033180 Ga0307510_10205355 Ga0307510_102053552 231
135 3300041404 Ga0439436_0022163 Ga0439436_0022163_467_1162 231
136 3300041410 Ga0439461_0009393 Ga0439461_0009393_963_1658 231
137 3300041413 Ga0439465_0009060 Ga0439465_0009060_1942_2637 231
138 3300041413 Ga0439465_0100737 Ga0439465_0100737_268_963 231
139 3300042004 Ga0439445_0014621 Ga0439445_0014621_614_1309 231
140 3300044656 Ga0466969_0015465 Ga0466969_0015465_3163_3858 231
141 3300044712 Ga0453684_0547088 Ga0453684_0547088_561_1256 231
142 3300045049 Ga0466959_0039816 Ga0466959_0039816_2594_3289 231
143 3300046539 Ga0495621_0044543 Ga0495621_0044543_352_1047 231
144 3300046674 Ga0495588_0165895 Ga0495588_0165895_30_734 231
145 3300046683 Ga0495658_0109842 Ga0495658_0109842_837_1541 231
146 3300047444 Ga0495675_0347705 Ga0495675_0347705_120_821 231
147 3300048089 Ga0495614_0259154 Ga0495614_0259154_61_765 231
148 3300048090 Ga0495615_0031214 Ga0495615_0031214_137_832 231
149 3300048904 Ga0496101_0580499 Ga0496101_0580499_119_814 231
150 3300048921 Ga0496118_0350171 Ga0496118_0350171_39_734 231
151 3300048924 Ga0496121_0000038 Ga0496121_0000038_136101_136796 231
152 3300048925 Ga0496122_0035528 Ga0496122_0035528_1424_2119 231
153 3300048927 Ga0496124_0001663 Ga0496124_0001663_26746_27441 231
154 3300048928 Ga0496125_0002090 Ga0496125_0002090_5535_6230 231
155 3300048929 Ga0496126_0002442 Ga0496126_0002442_15036_15731 231
156 3300049570 Ga0501033_0275708 Ga0501033_0275708_59_760 231
157 3300049679 Ga0501249_000271 Ga0501249_000271_8183_8878 231
158 3300049758 Ga0501241_001722 Ga0501241_001722_2028_2741 231
159 3300049850 Ga0501204_001056 Ga0501204_001056_703_1398 231
160 3300053119 Ga0500595_021418 Ga0500595_021418_575_1297 231
161 3300053136 Ga0500559_0108764 Ga0500559_0108764_86_808 231
162 3300005356 Ga0070674_100283845 Ga0070674_1002838451 232
163 3300006186 Ga0075369_10000906 Ga0075369_1000090610 232
164 3300013306 Ga0163162_10335839 Ga0163162_103358392 232
165 3300017792 Ga0163161_10029271 Ga0163161_100292713 232
166 3300025254 Ga0209148_1011468 Ga0209148_10114682 232
167 3300025272 Ga0209455_1000445 Ga0209455_100044525 232
168 3300030732 Ga0316176_1135165 Ga0316176_11351651 232
169 3300044684 Ga0466966_0063238 Ga0466966_0063238_1326_2024 232
170 3300046477 Ga0495664_0029062 Ga0495664_0029062_849_1556 232
171 3300046516 Ga0495628_0003355 Ga0495628_0003355_9630_10328 232
172 3300046524 Ga0495648_0205689 Ga0495648_0205689_77_778 232
173 3300046525 Ga0495663_0001688 Ga0495663_0001688_5865_6566 232
174 3300047319 Ga0495674_0004225 Ga0495674_0004225_10216_10923 232
175 3300047472 Ga0495686_0000029 Ga0495686_0000029_295283_295990 232
176 3300047472 Ga0495686_0079800 Ga0495686_0079800_419_1117 232
177 3300048913 Ga0496110_0097066 Ga0496110_0097066_208_909 232
178 3300048917 Ga0496114_0319531 Ga0496114_0319531_378_1085 232
179 3300048920 Ga0496117_0004473 Ga0496117_0004473_2108_2854 232
180 3300048920 Ga0496117_0008822 Ga0496117_0008822_7062_7763 232
181 3300048921 Ga0496118_0001513 Ga0496118_0001513_8028_8774 232
182 3300048921 Ga0496118_0007289 Ga0496118_0007289_1775_2476 232
183 3300048927 Ga0496124_0040854 Ga0496124_0040854_1769_2470 232
184 3300048927 Ga0496124_0050644 Ga0496124_0050644_681_1382 232
185 3300048927 Ga0496124_0069436 Ga0496124_0069436_1950_2651 232
186 3300048929 Ga0496126_0000328 Ga0496126_0000328_75430_76137 232
187 3300050516 nmdc:mga0sz30_910_c1 nmdc:mga0sz30_910_c1_1386_2120 232
188 iso_pu_bacteria 2857504554 2857507934 232
189 3300025295 Ga0209564_1020386 Ga0209564_10203861 233
190 3300030733 Ga0314311_1106310 Ga0314311_11063102 233
191 3300031251 Ga0265327_10021407 Ga0265327_100214072 233
192 3300031727 Ga0316576_10087586 Ga0316576_100875862 233
193 3300035398 Ga0316574_0106102 Ga0316574_0106102_793_1500 233
194 3300042435 Ga0439434_0003580 Ga0439434_0003580_2524_3225 233
195 3300044706 Ga0466964_0067857 Ga0466964_0067857_310_1020 233
196 3300046460 Ga0495638_0003884 Ga0495638_0003884_961_1662 233
197 3300046542 Ga0495597_0064050 Ga0495597_0064050_286_996 233
198 3300046616 Ga0495668_0000100 Ga0495668_0000100_31336_32046 233
199 3300048929 Ga0496126_0012275 Ga0496126_0012275_244_969 233
200 3300053122 Ga0500608_000027 Ga0500608_000027_19034_19744 233
201 3300053156 Ga0500622_0006673 Ga0500622_0006673_2133_2843 233
202 3300053161 Ga0500634_0000357 Ga0500634_0000357_5146_5847 233
203 iso_pu_bacteria 2510917021 2511126391 233
204 3300031995 Ga0307409_100099342 Ga0307409_1000993421 234
205 3300049591 Ga0501075_0081769 Ga0501075_0081769_115_819 234
206 3300049592 Ga0501076_0076759 Ga0501076_0076759_134_838 234
207 3300005548 Ga0070665_100012091 Ga0070665_10001209111 235
208 3300028379 Ga0268266_10048545 Ga0268266_100485451 235
209 3300046500 Ga0495596_0001912 Ga0495596_0001912_5191_5934 235
210 3300046506 Ga0495583_0014428 Ga0495583_0014428_1899_2642 235
211 iso_pu_bacteria 2599185359 2600228420 235
212 3300025913 Ga0207695_10665232 Ga0207695_106652321 236
213 3300035113 Ga0373936_0152557 Ga0373936_0152557_93_803 236
214 3300046507 Ga0495606_0109475 Ga0495606_0109475_924_1643 236
215 iso_pu_bacteria 2585428106 2587915470 236
216 iso_pu_bacteria 2818991438 2819552759 236
217 3300009551 Ga0105238_10088442 Ga0105238_100884422 238
218 3300031911 Ga0307412_10000301 Ga0307412_100003011 238
219 3300031911 Ga0307412_10097239 Ga0307412_100972392 238
220 3300009093 Ga0105240_10254980 Ga0105240_102549802 239
221 3300025914 Ga0207671_10011587 Ga0207671_100115876 239
222 3300048922 Ga0496119_0252556 Ga0496119_0252556_43_846 239
223 3300048923 Ga0496120_0049914 Ga0496120_0049914_360_1163 239
224 3300048925 Ga0496122_0297175 Ga0496122_0297175_27_830 239
225 3300048927 Ga0496124_0000889 Ga0496124_0000889_18821_19624 239
226 3300048927 Ga0496124_0031704 Ga0496124_0031704_2047_2850 239
227 3300048928 Ga0496125_0021775 Ga0496125_0021775_476_1261 239
228 3300048929 Ga0496126_0337617 Ga0496126_0337617_48_851 239
229 3300003214 JGI25165J46597_1000203 JGI25165J46597_100020376 240
230 3300005539 Ga0068853_100228657 Ga0068853_1002286573 240
231 3300005842 Ga0068858_100008060 Ga0068858_1000080609 240
232 3300009098 Ga0105245_10003304 Ga0105245_1000330417 240
233 3300017792 Ga0163161_10082458 Ga0163161_100824581 240
234 3300025233 Ga0209437_117130 Ga0209437_1171301 240
235 3300025261 Ga0209233_1000066 Ga0209233_1000066339 240
236 3300025298 Ga0209050_1000682 Ga0209050_100068210 240
237 3300025927 Ga0207687_10004369 Ga0207687_100043696 240
238 3300025935 Ga0207709_10111748 Ga0207709_101117482 240
239 3300026035 Ga0207703_10005516 Ga0207703_100055169 240
240 3300031616 Ga0307508_10012554 Ga0307508_100125542 240
241 3300046512 Ga0495610_0002496 Ga0495610_0002496_7987_8721 240
242 3300046660 Ga0495625_0002661 Ga0495625_0002661_10246_10980 240
243 3300047472 Ga0495686_0053408 Ga0495686_0053408_1382_2116 240
244 3300048918 Ga0496115_0279752 Ga0496115_0279752_458_1180 240
245 3300048924 Ga0496121_0017082 Ga0496121_0017082_2675_3406 240
246 3300048925 Ga0496122_0010854 Ga0496122_0010854_3240_3974 240
247 3300048926 Ga0496123_0003082 Ga0496123_0003082_15530_16264 240
248 3300048927 Ga0496124_0003908 Ga0496124_0003908_15284_16018 240
249 3300048927 Ga0496124_0004242 Ga0496124_0004242_4092_4823 240
250 3300053136 Ga0500559_0030459 Ga0500559_0030459_229_951 240

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01177

Asp_Glu_race

Asp/Glu/Hydantoin racemase

33

250

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5elm-assembly2.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9696 1 229
3ojc-assembly1.cif.gz_A crystal structure of a putative asp/glu racemase from yersinia pestis 0.9692 1 229
5hqt-assembly1.cif.gz_A crystal structure of an aspartate/glutamate racemase from escherichia coli o157 0.9689 1 229
3ojc-assembly1.cif.gz_A crystal structure of a putative asp/glu racemase from yersinia pestis 0.961 1 229
5elm-assembly2.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9415 1 229
ID Description Score Start End Superfamily
af_P03813_105_213_3.40.50.1860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9893 106 212 3.40.50.1860
af_P03813_2_104_3.40.50.1860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9847 2 103 3.40.50.1860
5ellB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9839 1 103 3.40.50.1860
af_P03813_2_229_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9795 2 229 3.40.50.720
af_P03813_2_229_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9753 2 229 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7W4NSQ4-F1-model_v4 Amino acid racemase (EC 5.1.1.-) 0.9978 83 229 GO:0047661
AF-X1G498-F1-model_v4 Aspartate racemase 0.9976 91 231 GO:0047661
AF-A0A364K2E8-F1-model_v4 Aspartate racemase 0.9975 1 229 GO:0047661
AF-A0A521SM13-F1-model_v4 deleted 0.997 1 100
AF-A0A124JYE6-F1-model_v4 Aspartate racemase 0.9961 1 229 GO:0047661

Feature Viewer

pLDDT pTM Quality
92.37 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map