F361408

General Info

Members Datasets Scaffolds Average Seq Length
250 186 500 177

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100000088|Ga0070697_10000008823
Length 198
Sequence MIRVGCGCFSASRIVRCRPLASMNFKETRLEGAFIVEPDIFEDERGFLGRSWSLEEFAARGLDPRLKECNMSFNRRRGTLRGMHFQMAPFGQVKLVRCTAGAIYDVIIDLRRNSPTFRQWVGVELTANNRRMLYIPTEFAHGFLTLEDETEVFYQLSEVYAPDSARGVRWSDPAFDISWPGEILIINDRDRTYPDFQL

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
54 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
81 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
82 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
83 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
84 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
87 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
88 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
89 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
90 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
91 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
96 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
105 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
106 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
109 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
110 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
111 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
112 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
117 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
118 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
119 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
120 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
121 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
122 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
123 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
124 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
125 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
128 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
129 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
130 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
142 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
143 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
144 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
145 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
146 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
147 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
148 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
149 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
150 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
151 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
152 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
153 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
154 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
158 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
159 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
160 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
161 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
162 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
163 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
164 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
165 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
166 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
167 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
168 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
171 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
176 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
178 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
179 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
182 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
183 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
184 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
185 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
186 2928125067 Methylobacterium sp. 1973 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.4
Metatranscriptomes 0
Isolates 1.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6
Nodule 0.4
Rhizoplane 4.4
Rhizosphere 84
Stem 0
Stem Tuber 0
Unclassified 19.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100000088 3300005536 Bacteria 76474
2 JGI25405J52794_10000923 3300003911 Bacteria 4602
3 Ga0065714_10381595 3300005288 Unclassified 606
4 Ga0065704_10005874 3300005289 Bacteria 3853
5 Ga0065715_10024044 3300005293 Bacteria 2443
6 Ga0065715_10253295 3300005293 Bacteria 1160
7 Ga0070690_100093609 3300005330 Bacteria 1982
8 Ga0070670_100295560 3300005331 Bacteria 1416
9 Ga0070661_100478214 3300005344 Bacteria 994
10 Ga0070675_100003190 3300005354 Bacteria 12419
11 Ga0070673_100210439 3300005364 Unclassified 1679
12 Ga0070688_100060059 3300005365 Unclassified 2400
13 Ga0070667_100519050 3300005367 Bacteria 1093
14 Ga0070713_100001270 3300005436 Bacteria 16131
15 Ga0070694_100010946 3300005444 Bacteria 5612
16 Ga0070694_100112401 3300005444 Bacteria 1942
17 Ga0070662_100043065 3300005457 Unclassified 3228
18 Ga0070706_100038978 3300005467 Bacteria 4386
19 Ga0070706_100138264 3300005467 Bacteria 2273
20 Ga0070698_100030202 3300005471 Bacteria 5621
21 Ga0070698_100057044 3300005471 Bacteria 3953
22 Ga0070698_100058312 3300005471 Unclassified 3904
23 Ga0070698_100128763 3300005471 Bacteria 2487
24 Ga0070698_100295078 3300005471 Unclassified 1552
25 Ga0070697_100289568 3300005536 Bacteria 1406
26 Ga0070686_101157964 3300005544 Unclassified 641
27 Ga0070695_100002227 3300005545 Bacteria 11106
28 Ga0070696_100287110 3300005546 Bacteria 1256
29 Ga0070664_100273384 3300005564 Bacteria 1522
30 Ga0068857_100478260 3300005577 Bacteria 1167
31 Ga0070702_100004055 3300005615 Bacteria 6638
32 Ga0068859_100754762 3300005617 Bacteria 1062
33 Ga0068864_100004098 3300005618 Bacteria 11965
34 Ga0068864_100038384 3300005618 Unclassified 4090
35 Ga0068864_100102019 3300005618 Bacteria 2546
36 Ga0068861_100007200 3300005719 Bacteria 7622
37 Ga0068861_100083106 3300005719 Bacteria 2511
38 Ga0068851_10111761 3300005834 Bacteria 1459
39 Ga0068870_10001882 3300005840 Bacteria 8648
40 Ga0081455_10003101 3300005937 Bacteria 19344
41 Ga0081455_10004177 3300005937 Bacteria 16282
42 Ga0070717_10196403 3300006028 Bacteria 1765
43 Ga0075365_10250232 3300006038 Bacteria 1245
44 Ga0075363_100313002 3300006048 Unclassified 912
45 Ga0075370_10107133 3300006353 Bacteria 1621
46 Ga0075428_100176635 3300006844 Bacteria 2312
47 Ga0075428_100964259 3300006844 Unclassified 903
48 Ga0075428_101074743 3300006844 Bacteria 850
49 Ga0075428_101089759 3300006844 Bacteria 844
50 Ga0075430_100144447 3300006846 Bacteria 1981
51 Ga0075430_100638843 3300006846 Bacteria 878
52 Ga0075431_100026330 3300006847 Bacteria 5966
53 Ga0075431_100282618 3300006847 Bacteria 1680
54 Ga0075434_100064308 3300006871 Bacteria 3652
55 Ga0075434_100360766 3300006871 Unclassified 1474
56 Ga0075429_100028848 3300006880 Bacteria 4819
57 Ga0075436_100387612 3300006914 Bacteria 1011
58 Ga0075436_100462793 3300006914 Bacteria 925
59 Ga0097620_100754762 3300006931 Bacteria 1062
60 Ga0075435_100207349 3300007076 Bacteria 1662
61 Ga0111539_10043631 3300009094 Bacteria 5375
62 Ga0111539_10245161 3300009094 Bacteria 2086
63 Ga0111539_11833494 3300009094 Unclassified 703
64 Ga0114129_10002063 3300009147 Bacteria 27605
65 Ga0114129_10032667 3300009147 Bacteria 7354
66 Ga0114129_10108609 3300009147 Bacteria 3830
67 Ga0114129_10269053 3300009147 Bacteria 2281
68 Ga0105242_10385937 3300009176 Unclassified 1303
69 Ga0105248_10096862 3300009177 Bacteria 3323
70 Ga0105248_10303609 3300009177 Unclassified 1797
71 Ga0105248_11278334 3300009177 Bacteria 830
72 Ga0105248_11304271 3300009177 Unclassified 821
73 Ga0105249_11016062 3300009553 Unclassified 898
74 Ga0105239_10075901 3300010375 Bacteria 3696
75 Ga0157374_10969739 3300013296 Bacteria 869
76 Ga0157375_10996854 3300013308 Bacteria 978
77 Ga0157377_10444958 3300014745 Bacteria 893
78 Ga0157379_10159976 3300014968 Bacteria 2033
79 Ga0213876_10153406 3300021384 Bacteria 1225
80 Ga0213875_10049728 3300021388 Bacteria 1965
81 Ga0207656_10067709 3300025321 Bacteria 1581
82 Ga0207647_10454639 3300025904 Bacteria 717
83 Ga0207643_10000971 3300025908 Bacteria 17239
84 Ga0207684_10023847 3300025910 Bacteria 5221
85 Ga0207684_10063206 3300025910 Bacteria 3143
86 Ga0207663_10030890 3300025916 Bacteria 3164
87 Ga0207649_10386861 3300025920 Bacteria 1044
88 Ga0207646_10128306 3300025922 Unclassified 2281
89 Ga0207646_10141503 3300025922 Bacteria 2167
90 Ga0207681_10282164 3300025923 Bacteria 1308
91 Ga0207650_10202562 3300025925 Bacteria 1590
92 Ga0207659_10043133 3300025926 Unclassified 3166
93 Ga0207687_10974421 3300025927 Bacteria 727
94 Ga0207700_10001097 3300025928 Bacteria 15607
95 Ga0207706_11341335 3300025933 Unclassified 590
96 Ga0207686_10352143 3300025934 Unclassified 1109
97 Ga0207709_10714492 3300025935 Bacteria 803
98 Ga0207670_10038352 3300025936 Unclassified 3129
99 Ga0207711_10402373 3300025941 Bacteria 1272
100 Ga0207679_10080041 3300025945 Bacteria 2493
101 Ga0207651_10340992 3300025960 Unclassified 1259
102 Ga0207676_10048667 3300026095 Bacteria 3292
103 Ga0207676_10086976 3300026095 Unclassified 2555
104 Ga0207674_10772465 3300026116 Bacteria 927
105 Ga0207675_100064468 3300026118 Bacteria 3424
106 Ga0207675_100099216 3300026118 Bacteria 2743
107 Ga0207428_10287607 3300027907 Bacteria 1219
108 Ga0268266_11147200 3300028379 Bacteria 752
109 Ga0265319_1018544 3300028563 Bacteria 2618
110 Ga0265338_10004409 3300028800 Bacteria 19035
111 Ga0265320_10014493 3300031240 Bacteria 4484
112 Ga0316575_10006794 3300031665 Bacteria 4133
113 Ga0316576_10005916 3300031727 Unclassified 7550
114 Ga0316578_10082373 3300031728 Bacteria 1915
115 Ga0316578_10099325 3300031728 Unclassified 1744
116 Ga0316577_10219843 3300031733 Bacteria 1074
117 Ga0307416_100315112 3300032002 Bacteria 1563
118 Ga0307415_100760216 3300032126 Bacteria 881
119 Ga0373945_0121416 3300035116 Bacteria 1039
120 Ga0373943_0043054 3300035170 Bacteria 2191
121 Ga0373943_0566092 3300035170 Unclassified 668
122 Ga0373946_0021622 3300035171 Bacteria 2496
123 Ga0373946_0075105 3300035171 Bacteria 1468
124 Ga0373946_0155196 3300035171 Bacteria 1071
125 Ga0316574_0007436 3300035398 Bacteria 6005
126 Ga0316574_0012693 3300035398 Unclassified 4825
127 Ga0373935_0520078 3300035692 Bacteria 865
128 Ga0373927_0074789 3300035695 Bacteria 2193
129 Ga0373947_0067548 3300035725 Bacteria 2184
130 Ga0373947_0082942 3300035725 Bacteria 1987
131 Ga0373937_1091292 3300036401 Bacteria 747
132 Ga0316582_0181497 3300036647 Unclassified 1432
133 Ga0316584_0028418 3300036712 Bacteria 4124
134 Ga0373925_0045395 3300037068 Bacteria 3264
135 Ga0373925_0122057 3300037068 Bacteria 2023
136 Ga0395899_0214044 3300037312 Bacteria 1338
137 Ga0395899_0448902 3300037312 Bacteria 845
138 Ga0395899_0462494 3300037312 Unclassified 829
139 Ga0395900_0026620 3300037418 Bacteria 5922
140 Ga0395898_0152336 3300037466 Bacteria 2212
141 Ga0395898_0305041 3300037466 Bacteria 1519
142 Ga0395905_0003795 3300037471 Bacteria 15977
143 Ga0436364_0334558 3300037853 Unclassified 2372
144 Ga0436364_0542426 3300037853 Bacteria 11995
145 Ga0436364_0719730 3300037853 Bacteria 1383
146 Ga0395901_0026526 3300038443 Bacteria 5949
147 Ga0395901_0174456 3300038443 Bacteria 2255
148 Ga0395901_0185663 3300038443 Bacteria 2181
149 Ga0242422_08321 3300038699 Bacteria 608
150 Ga0400484_10402 3300038725 Unclassified 4701
151 Ga0400487_13334 3300039110 Bacteria 4291
152 Ga0436365_0240717 3300039437 Bacteria 1360
153 Ga0436365_0958033 3300039437 Bacteria 1860
154 Ga0436365_1612915 3300039437 Bacteria 5349
155 Ga0436361_1186597 3300039447 Bacteria 636
156 Ga0436363_0296465 3300039450 Unclassified 1125
157 Ga0439449_0034365 3300042007 Bacteria 1888
158 Ga0439464_0200596 3300042439 Unclassified 636
159 Ga0453683_0227760 3300044673 Bacteria 1186
160 Ga0453684_1934385 3300044712 Bacteria 596
161 Ga0451576_0359746 3300045051 Bacteria 1524
162 Ga0495592_0557920 3300046454 Bacteria 703
163 Ga0495603_0082731 3300046455 Bacteria 1880
164 Ga0495638_0023030 3300046460 Bacteria 4080
165 Ga0495641_0212204 3300046461 Unclassified 868
166 Ga0495582_0078211 3300046473 Bacteria 1835
167 Ga0495616_0353602 3300046513 Unclassified 611
168 Ga0495644_0133674 3300046523 Bacteria 946
169 Ga0495652_0316213 3300046529 Bacteria 1130
170 Ga0495645_0042787 3300046543 Bacteria 3303
171 Ga0495599_0177082 3300046678 Unclassified 1315
172 Ga0495613_0363438 3300046689 Unclassified 992
173 Ga0495604_0558668 3300047317 Bacteria 737
174 Ga0495676_0156157 3300047321 Bacteria 1618
175 Ga0496101_0436521 3300048904 Bacteria 1033
176 Ga0496102_0152432 3300048905 Unclassified 2173
177 Ga0496102_0461750 3300048905 Bacteria 1191
178 Ga0496102_0670764 3300048905 Bacteria 960
179 Ga0496103_0566605 3300048906 Bacteria 725
180 Ga0496104_0097767 3300048907 Bacteria 2810
181 Ga0496105_0307350 3300048908 Bacteria 1274
182 Ga0496109_0116491 3300048912 Bacteria 2487
183 Ga0496110_0126282 3300048913 Bacteria 2308
184 Ga0496112_0145901 3300048915 Bacteria 2335
185 Ga0496112_0812476 3300048915 Bacteria 859
186 Ga0501298_062864 3300049521 Unclassified 789
187 Ga0501036_1007120 3300049572 Bacteria 682
188 Ga0501039_0733150 3300049575 Bacteria 772
189 Ga0501039_0745465 3300049575 Bacteria 765
190 Ga0501040_0137247 3300049576 Unclassified 1722
191 Ga0501040_0575629 3300049576 Unclassified 813
192 Ga0501048_0483428 3300049582 Bacteria 888
193 Ga0501067_0172370 3300049583 Bacteria 1205
194 Ga0501072_0206791 3300049588 Bacteria 1565
195 Ga0501075_0081229 3300049591 Bacteria 2454
196 Ga0501075_0372946 3300049591 Bacteria 1088
197 Ga0501076_0168128 3300049592 Bacteria 1787
198 Ga0501077_0196049 3300049593 Bacteria 1283
199 Ga0501207_036573 3300049654 Unclassified 842
200 Ga0501223_018940 3300049663 Bacteria 1352
201 Ga0501235_016098 3300049669 Bacteria 1650
202 Ga0501243_013811 3300049675 Bacteria 1287
203 Ga0501259_000813 3300049688 Bacteria 5122
204 Ga0501261_006507 3300049690 Bacteria 1485
205 Ga0501221_013826 3300049704 Unclassified 1491
206 Ga0501234_004737 3300049707 Bacteria 2134
207 Ga0501245_018310 3300049708 Bacteria 1076
208 Ga0501079_0173800 3300049741 Bacteria 1680
209 Ga0501080_0102838 3300049742 Bacteria 2650
210 Ga0501080_0659941 3300049742 Bacteria 925
211 Ga0501081_0175148 3300049743 Unclassified 1550
212 Ga0501273_004604 3300049770 Bacteria 1523
213 Ga0501280_036974 3300049776 Unclassified 780
214 Ga0501283_002466 3300049779 Bacteria 2402
215 Ga0501045_0489893 3300049824 Unclassified 913
216 nmdc:mga03683_115063_c1 3300050489 Bacteria 1192
217 nmdc:mga03n38_450635_c1 3300050490 Bacteria 716
218 nmdc:mga00v17_134584_c1 3300050491 Bacteria 1581
219 nmdc:mga0yw44_3971_c2 3300050492 Bacteria 6270
220 nmdc:mga0yw44_574928_c1 3300050492 Unclassified 765
221 nmdc:mga0yw44_8016_c1 3300050492 Bacteria 5237
222 nmdc:mga06z11_33557_c1 3300050494 Bacteria 2512
223 nmdc:mga06z11_49828_c1 3300050494 Bacteria 2138
224 nmdc:mga04h51_365668_c1 3300050495 Bacteria 599
225 nmdc:mga07m45_151801_c1 3300050496 Bacteria 1343
226 nmdc:mga05p37_220222_c1 3300050507 Bacteria 2291
227 nmdc:mga05p37_8059_c1 3300050507 Bacteria 12446
228 nmdc:mga09592_11090_c1 3300050508 Bacteria 7332
229 nmdc:mga09592_158009_c1 3300050508 Bacteria 1957
230 nmdc:mga0qj67_167083_c1 3300050509 Bacteria 1786
231 nmdc:mga0qj67_292777_c1 3300050509 Bacteria 1319
232 nmdc:mga06r32_268938_c1 3300050510 Bacteria 1692
233 nmdc:mga06r32_73325_c1 3300050510 Bacteria 3316
234 nmdc:mga08y16_27757_c1 3300050511 Bacteria 5965
235 nmdc:mga0n895_54703_c1 3300050512 Bacteria 3927
236 nmdc:mga0rr50_311767_c1 3300050513 Bacteria 1318
237 Ga0495655_0011835 3300053083 Unclassified 1763
238 Ga0495619_0172278 3300053085 Bacteria 1497
239 Ga0500641_0249948 3300053096 Bacteria 744
240 Ga0500616_0000530 3300053153 Bacteria 47939
241 Ga0501084_0119341 3300054114 Unclassified 2216
242 Ga0501084_0249328 3300054114 Bacteria 1499
243 Ga0501082_1266362 3300060353 Bacteria 644
244 Ga0530510_0010374 3300061734 Bacteria 6531
245 Ga0530510_0070558 3300061734 Bacteria 2536
246 Ga0530510_0176633 3300061734 Bacteria 1583
247 2735818081 2734482258 Unclassified 2930739
248 2792641950 2791355094 Bacteria 7011481
249 2808939823 2808606379 Bacteria 5022697
250 2928130583 2928125067 Bacteria 5937560
251 Ga0070697_100000088
252 JGI25405J52794_10000923
253 Ga0065714_10381595
254 Ga0065704_10005874
255 Ga0065715_10024044
256 Ga0065715_10253295
257 Ga0070690_100093609
258 Ga0070670_100295560
259 Ga0070661_100478214
260 Ga0070675_100003190
261 Ga0070673_100210439
262 Ga0070688_100060059
263 Ga0070667_100519050
264 Ga0070713_100001270
265 Ga0070694_100010946
266 Ga0070694_100112401
267 Ga0070662_100043065
268 Ga0070706_100038978
269 Ga0070706_100138264
270 Ga0070698_100030202
271 Ga0070698_100057044
272 Ga0070698_100058312
273 Ga0070698_100128763
274 Ga0070698_100295078
275 Ga0070697_100289568
276 Ga0070686_101157964
277 Ga0070695_100002227
278 Ga0070696_100287110
279 Ga0070664_100273384
280 Ga0068857_100478260
281 Ga0070702_100004055
282 Ga0068859_100754762
283 Ga0068864_100004098
284 Ga0068864_100038384
285 Ga0068864_100102019
286 Ga0068861_100007200
287 Ga0068861_100083106
288 Ga0068851_10111761
289 Ga0068870_10001882
290 Ga0081455_10003101
291 Ga0081455_10004177
292 Ga0070717_10196403
293 Ga0075365_10250232
294 Ga0075363_100313002
295 Ga0075370_10107133
296 Ga0075428_100176635
297 Ga0075428_100964259
298 Ga0075428_101074743
299 Ga0075428_101089759
300 Ga0075430_100144447
301 Ga0075430_100638843
302 Ga0075431_100026330
303 Ga0075431_100282618
304 Ga0075434_100064308
305 Ga0075434_100360766
306 Ga0075429_100028848
307 Ga0075436_100387612
308 Ga0075436_100462793
309 Ga0097620_100754762
310 Ga0075435_100207349
311 Ga0111539_10043631
312 Ga0111539_10245161
313 Ga0111539_11833494
314 Ga0114129_10002063
315 Ga0114129_10032667
316 Ga0114129_10108609
317 Ga0114129_10269053
318 Ga0105242_10385937
319 Ga0105248_10096862
320 Ga0105248_10303609
321 Ga0105248_11278334
322 Ga0105248_11304271
323 Ga0105249_11016062
324 Ga0105239_10075901
325 Ga0157374_10969739
326 Ga0157375_10996854
327 Ga0157377_10444958
328 Ga0157379_10159976
329 Ga0213876_10153406
330 Ga0213875_10049728
331 Ga0207656_10067709
332 Ga0207647_10454639
333 Ga0207643_10000971
334 Ga0207684_10023847
335 Ga0207684_10063206
336 Ga0207663_10030890
337 Ga0207649_10386861
338 Ga0207646_10128306
339 Ga0207646_10141503
340 Ga0207681_10282164
341 Ga0207650_10202562
342 Ga0207659_10043133
343 Ga0207687_10974421
344 Ga0207700_10001097
345 Ga0207706_11341335
346 Ga0207686_10352143
347 Ga0207709_10714492
348 Ga0207670_10038352
349 Ga0207711_10402373
350 Ga0207679_10080041
351 Ga0207651_10340992
352 Ga0207676_10048667
353 Ga0207676_10086976
354 Ga0207674_10772465
355 Ga0207675_100064468
356 Ga0207675_100099216
357 Ga0207428_10287607
358 Ga0268266_11147200
359 Ga0265319_1018544
360 Ga0265338_10004409
361 Ga0265320_10014493
362 Ga0316575_10006794
363 Ga0316576_10005916
364 Ga0316578_10082373
365 Ga0316578_10099325
366 Ga0316577_10219843
367 Ga0307416_100315112
368 Ga0307415_100760216
369 Ga0373945_0121416
370 Ga0373943_0043054
371 Ga0373943_0566092
372 Ga0373946_0021622
373 Ga0373946_0075105
374 Ga0373946_0155196
375 Ga0316574_0007436
376 Ga0316574_0012693
377 Ga0373935_0520078
378 Ga0373927_0074789
379 Ga0373947_0067548
380 Ga0373947_0082942
381 Ga0373937_1091292
382 Ga0316582_0181497
383 Ga0316584_0028418
384 Ga0373925_0045395
385 Ga0373925_0122057
386 Ga0395899_0214044
387 Ga0395899_0448902
388 Ga0395899_0462494
389 Ga0395900_0026620
390 Ga0395898_0152336
391 Ga0395898_0305041
392 Ga0395905_0003795
393 Ga0436364_0334558
394 Ga0436364_0542426
395 Ga0436364_0719730
396 Ga0395901_0026526
397 Ga0395901_0174456
398 Ga0395901_0185663
399 Ga0242422_08321
400 Ga0400484_10402
401 Ga0400487_13334
402 Ga0436365_0240717
403 Ga0436365_0958033
404 Ga0436365_1612915
405 Ga0436361_1186597
406 Ga0436363_0296465
407 Ga0439449_0034365
408 Ga0439464_0200596
409 Ga0453683_0227760
410 Ga0453684_1934385
411 Ga0451576_0359746
412 Ga0495592_0557920
413 Ga0495603_0082731
414 Ga0495638_0023030
415 Ga0495641_0212204
416 Ga0495582_0078211
417 Ga0495616_0353602
418 Ga0495644_0133674
419 Ga0495652_0316213
420 Ga0495645_0042787
421 Ga0495599_0177082
422 Ga0495613_0363438
423 Ga0495604_0558668
424 Ga0495676_0156157
425 Ga0496101_0436521
426 Ga0496102_0152432
427 Ga0496102_0461750
428 Ga0496102_0670764
429 Ga0496103_0566605
430 Ga0496104_0097767
431 Ga0496105_0307350
432 Ga0496109_0116491
433 Ga0496110_0126282
434 Ga0496112_0145901
435 Ga0496112_0812476
436 Ga0501298_062864
437 Ga0501036_1007120
438 Ga0501039_0733150
439 Ga0501039_0745465
440 Ga0501040_0137247
441 Ga0501040_0575629
442 Ga0501048_0483428
443 Ga0501067_0172370
444 Ga0501072_0206791
445 Ga0501075_0081229
446 Ga0501075_0372946
447 Ga0501076_0168128
448 Ga0501077_0196049
449 Ga0501207_036573
450 Ga0501223_018940
451 Ga0501235_016098
452 Ga0501243_013811
453 Ga0501259_000813
454 Ga0501261_006507
455 Ga0501221_013826
456 Ga0501234_004737
457 Ga0501245_018310
458 Ga0501079_0173800
459 Ga0501080_0102838
460 Ga0501080_0659941
461 Ga0501081_0175148
462 Ga0501273_004604
463 Ga0501280_036974
464 Ga0501283_002466
465 Ga0501045_0489893
466 nmdc:mga03683_115063_c1
467 nmdc:mga03n38_450635_c1
468 nmdc:mga00v17_134584_c1
469 nmdc:mga0yw44_3971_c2
470 nmdc:mga0yw44_574928_c1
471 nmdc:mga0yw44_8016_c1
472 nmdc:mga06z11_33557_c1
473 nmdc:mga06z11_49828_c1
474 nmdc:mga04h51_365668_c1
475 nmdc:mga07m45_151801_c1
476 nmdc:mga05p37_220222_c1
477 nmdc:mga05p37_8059_c1
478 nmdc:mga09592_11090_c1
479 nmdc:mga09592_158009_c1
480 nmdc:mga0qj67_167083_c1
481 nmdc:mga0qj67_292777_c1
482 nmdc:mga06r32_268938_c1
483 nmdc:mga06r32_73325_c1
484 nmdc:mga08y16_27757_c1
485 nmdc:mga0n895_54703_c1
486 nmdc:mga0rr50_311767_c1
487 Ga0495655_0011835
488 Ga0495619_0172278
489 Ga0500641_0249948
490 Ga0500616_0000530
491 Ga0501084_0119341
492 Ga0501084_0249328
493 Ga0501082_1266362
494 Ga0530510_0010374
495 Ga0530510_0070558
496 Ga0530510_0176633
497 2735818081
498 2792641950
499 2808939823
500 2928130583

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

27

197

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6c46-assembly3.cif.gz_E-2 crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase from elizabethkingia anophelis nuhp1 0.9699 1 175
6c46-assembly2.cif.gz_C crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase from elizabethkingia anophelis nuhp1 0.958 1 175
7pvi-assembly1.cif.gz_BBB dtdp-sugar epimerase 0.9542 2 176
3ryk-assembly1.cif.gz_B 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound 0.9541 2 173
1dzt-assembly1.cif.gz_B rmlc from salmonella typhimurium 0.9507 2 173
ID Description Score Start End Superfamily
5buvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9409 2 174 2.60.120.10
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9347 1 173 2.60.120.10
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9336 1 175 2.60.120.10
1epzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9319 2 179 2.60.120.10
5buvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9202 2 174 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A845RPB3-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9954 1 175 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A519D6F7-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9953 1 173 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A3N5XMZ5-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9952 1 173 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A1Q6VP32-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9952 1 145 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A533Q854-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9951 1 174 GO:0005829
GO:0008830
GO:0019305
GO:0045226

Map